3UTAB

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaB00
5B2JB 1U35B 4KGCC 3MGRA 3W99C 4G91C 1AOID 3AZID 4WZSB 2BYMA 3WA9A 5AV8C 3VH6T 3X1UC 3AZFC 3LZ0C 4ZBJC 1P34C 3W98B 4ZUXC 3WTPC 3X1UB 3LZ0B 1P34B 5B33C 5GXQB 3VH5W 3MGRD 3MGQA 1TZYA 5C3IC 1KX3B 1KX5D 5AVCC 4J8XC 3WA9D 5C3IB 3AN2C 4J8WD 3AZNA 5GSUD 5B0YC 5KDMA 1ZLAC 5F99C 3X1VA 5B2JA 1U35A 5F99B 3AZEC 3UT9C 3B6FC 3KWQD 1TZYD 4WU9D 2NQBB 3W98A 3AZKC 3RELD 3AZND 1P3KB 1P3BC 1F66C 3X1UA 5CPJD 5CPKB 3X1VD 1P34A 3AZKB 2CV5C 3KSYA 5G49B 1P3BB 1ULYA 5GXQA 3AV1B 2CV5B 1KX3A 1BFMA 3UTAD 1P3MB 4J8VD 1P3OC 3W98D 5B31D 1P3OB 5F99A 3KXBD 3LELC 5B32G 3MGPA 4XZQC 3W97C 2NQBA 1KX3D 1M18B 1H3OB 3KUYC 1M19C 1P3KA 1TAFB 4NFTA 4Z2MG 3KUYB 5CPKA 3AZKA 1P3BA 5G49A 4E45A 1KU5A 5GT3C 3AV1A 2CV5A 4Z66C 2HUEB 3AZJC 3MGPD 5GT3B 4R8PC 4LD9C 2NQBD 1P3MA 3AZJB 3REHD 5AVBC 2FJ7A 3TU4D 4R8PB 1P3KD 1P3GC 5AVBB 4Z5TB 4JJND 5CPKD 1P3OA 5E5AC 3AZMC 3AV1D 4WU8C 4J8UD 3B6GD 5B32C 5BS7A 1M18A 1H3OA 5B1MA 1KX4C 1P3MD 5B32B 2FJ7D 1TAFA 1KX4B 1AOIC 1P3FB 3REIB 5GT3A 3AZIB 5B2ID 3W96D 1P3AB 5B1MD 5BO0B 4R8PA 1Q9CA 3AZHA 3AYWD 5AVBA 4Z5TA 3MGRC 3AV2B 4HGAC 5CPID 3MGRB 3REJB 4XUJD 3WA9C 3UTBB 1KX5B 5B31G 5B32A 4J8WB 3X1SD 5GSUB 2AROB 3AZHD 4YM6D 3WAAB 4Z5TD 1P3FA 3REIA 2NZDB 3MGQC 1TZYC 4WU9C 3AZIA 1BH9B 3KWQB 4WU9B 3MGSD 3AZNC 2LY8A 1P3AA 3C1BD 4WV4B 5CPJC 2BYKB 3X1VC 3RELB 1U35C 3AV2A 5CPJB 1P3FD 3REID 3AZLA 1P3ID 2YFVB 5AV5D 1ID3B 3REJA 4G92B 3UTBA 1M1AD 1KX5A 4J8VC 3W98C 3UTAB 1P3AD 4J8WA 5GSUA 4J8VB 2AROA 3WAAA 1B67A 5GXQC 5B31B 3AV2D 3R45B 2NZDA 3KXBB 3AZLD 1KX3C 1BH9A 3REJD 3KWQA 2RVQC 4WU9A 3UTBD 3VH6A 5BNVB 2BYKA 4YS3D 3RELA 2AROD 1S32B 5CPJA 3WAAD 5BT1D 2NZDD 3MGPC 2YFVA 1ID3A 2NQBC 3MGPB 3TU4C 1P3KC 3UTAA 3REHB 3TU4B 4J8VA 4DRAA 5CPKC 1JFIB 5B31A 4JJNB 3AV1C 3R45A 1P3LB 3KXBA 3B6GC 4J8UC 1ID3D 1P3MC 4J8UB 3B6GB 2FJ7C 4UUZB 5BNVA 2FJ7B 1S32A 5B0ZB 3B0DC 5BS7C 1M18C 2F8NH 5B1MC 3B0DB 5B2IB 3W96B 2JSSA 5B1MB 3REHA 3TU4A 4H9PB 1JFIA 5DNNB 3AYWB 3X1TA 1S32D 4JJNA 4EO5B 1P3LA 2HUEC 5JA4B 4XUJC 2F8ND 3MNND 4H9RB 5FUGB 5CPIB 3WTPE 3B0CW 3MVDA 4AWLB 4XUJB 5DNMB 4J8UA 3C1CB 3X1VB 3B6GA 4UUZA 3AZGA 3AZHC 5AV6B 3AZFD 4Z5TC 3X1SB 4ZUXD 3AZHB 5BNXB 3X1TD 4YM6B 2IO5B 5B33D 5B0ZA 1P3LD 3B0BA 3VH5T 3MVDD 5B2IA 3W96A 3MGSB 5AVCD 4J8XD 3AZGD 3C1BB 4H9PA 5DNNA 3AYWA 1A7WA 1B6WA 3REIC 1P3IC 1P3FC 4H9NB 5AV5C 2L5AA 5JA4A 1P3IB 5B0ZD 4H9RA 5FUGA 3AZIC 5CPIA 3VH5A 5B1LA 5AV5B 4XUJA 5DNMA 1P3AC 3C1CA 1M1AB 4CSRB 5AV6A 3X1SA 1F1EA 3AV2C 5BNXA 5DNND 4YM6A 5GT0D 3AZLC 3REJC 3AZLB 3UTBC 5B1LD 1KX5C 1EQZB 5DNMD 3A6NA 5JRGB 3C1CD 3MGSA 1P3PA 4J8WC 5AV9B 5GSUC 2HIOD 3LJAB 2AROC 3C1BA 5AV6D 3WAAC 4YS3B 3WKJD 5BT1C 2NZDC 4H9NA 1P3IA 3V9RB 3NQUB 3LELD 3NQJB 4NE3A 5AV5A 3KWQC 4DRBA 4WNNB 1M1AA 3A6ND 1P3PD 1BH8B 4CSRA 3RELC 1M19D 1WWSA 2F8NG 4KUDB 1ID3C 4G92C 4Z66D 1EQZA 3B0CT 3UTAC 5JRGA 3AFAD 5AV9A 3LJAA 3REKB 4YS3A 5B31C 5B40A 3O62A 1HQ3B 3KXBC 3V9RA 4H9SC 3NQUA 4H9OB 3NQJA 4WU8D 5AY8D 4WNNA 5B24B 1EQZD 5JRGD 1BH8A 5AV9D 4X23A 3LJAD 1S32C 4KUDA 3LZ1B 2PYOD 5B40D 3MNNC 4QLCB 3O62D 4KGCB 3W99B 2F8NB 4H9QB 4G91B 3MNNB 3REHC 5AV8B 4X23D 3X1TC 3REKA 4KHAB 3AZFB 4ZBJB 4JJNC 3WTPB 4ZUXB 4KUDD 1P3LC 1HQ3A 3X1TB 5B33B 4H9OA 3MVDC 5CP6A 4H9SA 5B24A 3AZGC 3MVDB 5AVCB 4J8XB 3AZGB 4NE6A 3AN2B 3REKD 5B0YB 3LZ1A 1ZLAB 4QLCA 5B0ZC 1HQ3D 4KGCA 3W99A 2F8NA 4H9QA 3MNNA 3MGQD 5B2IC 3W96C 3UT9B 3AZEB 5CP6D 3B6FB 5B24D 4CAYB 4NE5A 5AV8A 1R4VA 5DNNC 3AYWC 4KHAA 5GT0C 3AZFA 3LZ0A 4EO5C 4ZUXA 3WTPA 3LZ1D 5B2JD 1U35D 1F66B 5GT0B 4QLCD 5CPIC 5B33A 5B1LC 4KGCD 4AWLC 3W99D 5DNMC 3C1CC 5B1LB 2HIOC 5CHLB 5AV6C 3WKJC 4E44A 5AV8D 5AVCA 2HIOB 4J8XA 3X1SC 3AN2A 4YM6C 5B0YA 3X1UD 3WKJB 3LZ0D 2IO5C 1P34D 3WTPD 1ZLAA 5GXQD 3LELB 3A6NC 3MGSC 3UT9A 3AZEA 1P3PC 4XZQB 3B6FA 3W97B 2RVQD 4CAYA 3C1BC 3A6NB 1P3PB 1M19B 3AN2D 5B0YD 1F66A 1HTAA 4M6BA 5GT0A 1ZLAD 5F99D 1N1JB 2CWEA 4Z66B 3AFAC 1M1AC 3VH6W 3AZED 3UT9D 3B6FD 4LD9B 3AFAB 2HIOA 3WKJA 3AZKD 1P3BD 1P3GB 1F66D 2YFWB 5E5AB 2CV5D 5AY8C 1EQZC 3LELA 3AZMB 5JRGC 3W97A 4XZQA 5AV9C 4WU8B 3LJAC 5AY8B 4YS3C 3KUYA 2PYOC 1M19A 5B40C 3O62C 1P3OD 2PYOB 1N1JA 5B40B 3O62B 1AOIB 4Z66A 3AZJA 1M18D 4XZQD 4X23C 3W97D 4LD9A 3AFAA 4KUDC 3KUYD 4X23B 1P3GA 2YFWA 5E5AA 4HGAB 5GT3D 3AZMA 2BYMB 4WU8A 3WA9B 5AY8A 3AZJD 4R8PD 3REKC 4LD9D 1KX4A 5AVBD 1HQ3C 2PYOA 1P3GD 1AOIA 5E5AD 5CP6C 3MGQB 1TZYB 5B24C 3AZMD 4Z2MH 5BO0A 5CP6B 2F8NK 5B32D 3AZNB 5KDMB 5B2JC 3LZ1C 1KX4D 1WWIA 4QLCC
chains in the Genus database with same CATH superfamily
5B2JB 1U35B 4KGCC 3MGRA 3W99C 4G91C 1AOID 2XD5A 3AZID 4WZSB 2BYMA 3WA9A 5AV8C 3VH6T 3X1UC 3AZFC 3LZ0C 2W8SA 4ZBJC 1P34C 4ZUXC 3WTPC 3W98B 3X1UB 3LZ0B 1P34B 2DF4C 5B33C 5GXQB 3VH5W 3MGRD 3MGQA 1TZYA 5C3IC 1KX3B 1KX5D 5AVCC 4J8XC 3WA9D 4WJ3C 5C3IB 3AN2C 4J8WD 3AZNA 5GSUD 5B0YC 5KDMA 3A1IA 1ZLAC 5F99C 3X1VA 5B2JA 1U35A 5F99B 3AZEC 2Y2HA 3UT9C 3B6FC 2Y2LA 1TZYD 3KWQD 4WU9D 2NQBB 3W98A 3AZKC 3EPKA 3RELD 3AZND 1P3KB 1P3BC 1F66C 3X1UA 5CPJD 5CPKB 3X1VD 1P34A 3AZKB 2CV5C 2Y2IA 3KSYA 5G49B 1ULYA 5GXQA 1P3BB 3AV1B 2CV5B 4DQYB 1KX3A 3FDDA 3UTAD 1P3MB 1BFMA 4J8VD 1P3OC 3W98D 1PZRA 5B31D 1P3OB 2Y2GA 5F99A 3KXBD 3LELC 5B32G 3MGPA 4XZQC 3W97C 2NQBA 1KX3D 1M18B 1H3OB 3KUYC 1M19C 1P3KA 1TAFB 4NFTA 4Z2MG 3KUYB 5CPKA 3AZKA 3KFUG 1P3BA 5G49A 4E45A 1KU5A 5GT3C 3AV1A 2CV5A 4Z66C 2HUEB 3AZJC 3MGPD 5GT3B 4R8PC 2ZM5A 4LD9C 1T3UA 2NQBD 1P3MA 3AZJB 3REHD 5AVBC 2FJ7A 3TU4D 4R8PB 1P3KD 1P3GC 5AVBB 4Z5TB 4JJND 5CPKD 1P3OA 5E5AC 1W2EA 3AZMC 3AV1D 4WU8C 4J8UD 3B6GD 5B32C 5BS7A 1M18A 1H3OA 5B1MA 1KX4C 1P3MD 5B32B 2FJ7D 1TAFA 1KX4B 1AOIC 1P3FB 3REIB 5GT3A 3AZIB 5B2ID 3W96D 1P3AB 5B1MD 5BO0B 4R8PA 1Q9CA 3AZHA 3AYWD 5AVBA 4Z5TA 3MGRC 3AV2B 2UWXA 4HGAC 5CPID 2ZY2A 3MGRB 3REJB 4XUJD 3WA9C 3UTBB 1KX5B 5B31G 5B32A 4J8WB 3X1SD 5GSUB 2AROB 3AZHD 4YM6D 3WAAB 4Z5TD 1P3FA 3REIA 2NZDB 3MGQC 1TZYC 4WU9C 3AZIA 1BH9B 3KWQB 4WU9B 3MGSD 3AZNC 2LY8A 1P3AA 3C1BD 4WV4B 5CPJC 2BYKB 3X1VC 3RELB 1U35C 3AV2A 2BG1A 5CPJB 3A1KA 1P3FD 3REID 3AZLA 1P3ID 2YFVB 5AV5D 1ID3B 3REJA 4G92B 3UTBA 1M1AD 1KX5A 4J8VC 3W98C 2JCHA 3UTAB 1P3AD 4J8WA 5GSUA 4J8VB 2AROA 3WAAA 1B67A 5GXQC 5B31B 3AV2D 3R45B 2NZDA 3KXBB 3AZLD 1KX3C 1BH9A 3REJD 3KWQA 2RVQC 4WU9A 3UTBD 3VH6A 5BNVB 2BYKA 4YS3D 3RELA 2AROD 1S32B 2Y2KA 2VQRA 5CPJA 3WAAD 5BT1D 2NZDD 3MGPC 2YFVA 1ID3A 3AL0C 2NQBC 3MGPB 3TU4C 1P3KC 3UTAA 3REHB 3TU4B 4J8VA 4DRAA 5CPKC 1JFIB 5B31A 4JJNB 3AV1C 3R45A 1P3LB 3KXBA 3B6GC 4J8UC 1ID3D 1P3MC 4J8UB 3B6GB 2FJ7C 4UUZB 5BNVA 2FJ7B 1S32A 3EG5B 5B0ZB 3B0DC 4UPKA 5BS7C 1M18C 2F8NH 5B1MC 3B0DB 5B2IB 3W96B 2JSSA 5B1MB 3REHA 3TU4A 4H9PB 1JFIA 5DNNB 3AYWB 3X1TA 1S32D 4JJNA 4EO5B 1P3LA 2HUEC 5JA4B 4XUJC 2F8ND 3MNND 4H9RB 5FUGB 5CPIB 3WTPE 3B0CW 3MVDA 4AWLB 4XUJB 5DNMB 4J8UA 3C1CB 3X1VB 3B6GA 4UUZA 3AZGA 3AZHC 5AV6B 3AZFD 4Z5TC 3X1SB 4ZUXD 3AZHB 5BNXB 3X1TD 4YM6B 2IO5B 5B33D 5B0ZA 1P3LD 3B0BA 3VH5T 3MVDD 5B2IA 3W96A 3MGSB 5AVCD 4J8XD 3AZGD 2F2AC 3C1BB 4H9PA 5DNNA 2Y2NA 3AYWA 1A7WA 1B6WA 3REIC 1P3IC 1P3FC 4H9NB 5AV5C 3EPHA 2L5AA 5JA4A 1P3IB 5B0ZD 4H9RA 5FUGA 3AZIC 5CPIA 3VH5A 5B1LA 5AV5B 4XUJA 5DNMA 1P3AC 3C1CA 1M1AB 4CSRB 5AV6A 3X1SA 1F1EA 3AV2C 5BNXA 5DNND 4YM6A 5GT0D 3AZLC 3REJC 3AZLB 3UTBC 5B1LD 1KX5C 1EQZB 5DNMD 3A6NA 5JRGB 3C1CD 3MGSA 1P3PA 4J8WC 5AV9B 5GSUC 2HIOD 3LJAB 2AROC 3C1BA 5AV6D 3WAAC 4YS3B 3WKJD 5BT1C 2NZDC 4H9NA 2ZY4A 1P3IA 3V9RB 3NQUB 3LELD 3NQJB 4NE3A 5AV5A 3KWQC 4DRBA 2Y2JA 4WNNB 1M1AA 3A6ND 1P3PD 1BH8B 2G5IC 4CSRA 3P5JB 3RELC 1M19D 1WWSA 2F8NG 4KUDB 1ID3C 4G92C 4Z66D 1EQZA 3B0CT 3UTAC 5JRGA 3AFAD 5AV9A 3LJAA 3REKB 4YS3A 5B31C 5B40A 3H0RC 3O62A 1HQ3B 3KXBC 3V9RA 4H9SC 3NQUA 4H9OB 3NQJA 2G5HC 4WU8D 5AY8D 4WNNA 5B24B 1EQZD 5JRGD 1BH8A 5AV9D 4X23A 3LJAD 1S32C 4KUDA 3LZ1B 2DQNC 2PYOD 5B40D 3MNNC 4QLCB 3O62D 4KGCB 3W99B 2F8NB 4H9QB 4G91B 3MNNB 3REHC 2Y2PA 5AV8B 4X23D 3X1TC 3REKA 4KHAB 3AZFB 4ZBJB 4JJNC 3WTPB 4ZUXB 4KUDD 1P3LC 1HQ3A 3X1TB 5B33B 4H9OA 3MVDC 5CP6A 4H9SA 5B24A 3AZGC 3MVDB 5AVCB 4J8XB 3AZGB 4NE6A 3AN2B 3REKD 5B0YB 3LZ1A 1ZLAB 4QLCA 5B0ZC 1HQ3D 4KGCA 3W99A 2JE5A 4H9QA 3MNNA 3MGQD 2F8NA 5B2IC 3W96C 3UT9B 3F6TA 5CP6D 3AZEB 5B24D 3B6FB 4CAYB 4NE5A 5AV8A 1R4VA 5DNNC 3AYWC 4KHAA 5GT0C 3AZFA 3LZ0A 4EO5C 4ZUXA 3WTPA 3LZ1D 5B2JD 1U35D 1F66B 5GT0B 4QLCD 5CPIC 5B33A 5B1LC 4KGCD 4AWLC 3W99D 5DNMC 3C1CC 5B1LB 2HIOC 2Y2MA 5CHLB 5AV6C 3WKJC 4E44A 5AV8D 5AVCA 2HIOB 4J8XA 3X1SC 3AN2A 4YM6C 5B0YA 3X1UD 3WKJB 3LZ0D 2IO5C 1P34D 1Z2CB 3WTPD 1ZLAA 5GXQD 3LELB 3A6NC 3MGSC 3UT9A 3AZEA 1P3PC 4XZQB 3B6FA 3W97B 2RVQD 4CAYA 3C1BC 2J8PA 3A6NB 1P3PB 2ZY3A 1M19B 3AN2D 3EPLA 5B0YD 1F66A 1HTAA 4M6BA 5GT0A 1ZLAD 5F99D 1N1JB 2Y2QA 2CWEA 4Z66B 3AFAC 1M1AC 3VH6W 3AZED 3UT9D 3B6FD 3IP4C 4LD9B 3AFAB 2HIOA 3WKJA 3AZKD 1P3BD 1P3GB 1F66D 2YFWB 5E5AB 2CV5D 2FFFB 5AY8C 2XD1A 3LELA 1EQZC 3AZMB 5JRGC 3W97A 4XZQA 5AV9C 4WU8B 3LJAC 5AY8B 2Y2OA 3H0MC 4YS3C 3KUYA 2PYOC 1M19A 5B40C 3O62C 1P3OD 2PYOB 1N1JA 5B40B 3O62B 1AOIB 4Z66A 3AZJA 1M18D 4XZQD 4X23C 3W97D 4LD9A 3AFAA 4KUDC 3KUYD 3EPJA 4X23B 2RIQA 1P3GA 2YFWA 5E5AA 4HGAB 5GT3D 3AZMA 2BYMB 4WU8A 3WA9B 5AY8A 3AZJD 4R8PD 3H0LC 3REKC 4LD9D 1KX4A 2ZY5A 5AVBD 1HQ3C 2PYOA 1P3GD 1AOIA 5E5AD 5CP6C 3MGQB 1TZYB 5B24C 3AZMD 4Z2MH 5BO0A 5CP6B 2F8NK 5B32D 3AZNB 5KDMB 5B2JC 3LZ1C 1KX4D 1WWIA 4QLCC
chains in the Genus database with same CATH topology
5B2JB 1U35B 4KGCC 3MGRA 3W99C 4G91C 1AOID 2XD5A 3AZID 4WZSB 2BYMA 3WA9A 5AV8C 3VH6T 3X1UC 3AZFC 3LZ0C 2W8SA 4ZBJC 1P34C 4ZUXC 3WTPC 3W98B 3X1UB 3LZ0B 1P34B 2DF4C 5B33C 5GXQB 3VH5W 3MGRD 3MGQA 1TZYA 5C3IC 1KX3B 1KX5D 5AVCC 4J8XC 3WA9D 4WJ3C 5C3IB 3AN2C 4J8WD 3AZNA 5GSUD 5B0YC 5KDMA 3A1IA 1ZLAC 5F99C 3X1VA 5B2JA 1U35A 5F99B 3AZEC 2Y2HA 3UT9C 3B6FC 2Y2LA 1TZYD 3KWQD 4WU9D 2NQBB 3W98A 3AZKC 3EPKA 3RELD 3AZND 1P3KB 1P3BC 1F66C 3X1UA 5CPJD 5CPKB 3X1VD 1P34A 3AZKB 2CV5C 2Y2IA 3KSYA 5G49B 1ULYA 5GXQA 1P3BB 3AV1B 2CV5B 4DQYB 1KX3A 3FDDA 3UTAD 1P3MB 1BFMA 4J8VD 1P3OC 3W98D 1PZRA 5B31D 1P3OB 2Y2GA 5F99A 3KXBD 3LELC 5B32G 3MGPA 4XZQC 3W97C 2NQBA 1KX3D 1M18B 1H3OB 3KUYC 1M19C 1P3KA 1TAFB 4NFTA 4Z2MG 3KUYB 5CPKA 3AZKA 3KFUG 1P3BA 5G49A 4E45A 1KU5A 5GT3C 3AV1A 2CV5A 4Z66C 2HUEB 3AZJC 3MGPD 5GT3B 4R8PC 2ZM5A 4LD9C 1T3UA 2NQBD 1P3MA 3AZJB 3REHD 5AVBC 2FJ7A 3TU4D 4R8PB 1P3KD 1P3GC 5AVBB 4Z5TB 4JJND 5CPKD 1P3OA 5E5AC 1W2EA 3AZMC 3AV1D 4WU8C 4J8UD 3B6GD 5B32C 5BS7A 1M18A 1H3OA 5B1MA 1KX4C 1P3MD 5B32B 2FJ7D 1TAFA 1KX4B 1AOIC 1P3FB 3REIB 5GT3A 3AZIB 5B2ID 3W96D 1P3AB 5B1MD 5BO0B 4R8PA 1Q9CA 3AZHA 3AYWD 5AVBA 4Z5TA 3MGRC 3AV2B 2UWXA 4HGAC 5CPID 2ZY2A 3MGRB 3REJB 4XUJD 3WA9C 3UTBB 1KX5B 5B31G 5B32A 4J8WB 3X1SD 5GSUB 2AROB 3AZHD 4YM6D 3WAAB 4Z5TD 1P3FA 3REIA 2NZDB 3MGQC 1TZYC 4WU9C 3AZIA 1BH9B 3KWQB 4WU9B 3MGSD 3AZNC 2LY8A 1P3AA 3C1BD 4WV4B 5CPJC 2BYKB 3X1VC 3RELB 1U35C 3AV2A 2BG1A 5CPJB 3A1KA 1P3FD 3REID 3AZLA 1P3ID 2YFVB 5AV5D 1ID3B 3REJA 4G92B 3UTBA 1M1AD 1KX5A 4J8VC 3W98C 2JCHA 3UTAB 1P3AD 4J8WA 5GSUA 4J8VB 2AROA 3WAAA 1B67A 5GXQC 5B31B 3AV2D 3R45B 2NZDA 3KXBB 3AZLD 1KX3C 1BH9A 3REJD 3KWQA 2RVQC 4WU9A 3UTBD 3VH6A 5BNVB 2BYKA 4YS3D 3RELA 2AROD 1S32B 2Y2KA 2VQRA 5CPJA 3WAAD 5BT1D 2NZDD 3MGPC 2YFVA 1ID3A 3AL0C 2NQBC 3MGPB 3TU4C 1P3KC 3UTAA 3REHB 3TU4B 4J8VA 4DRAA 5CPKC 1JFIB 5B31A 4JJNB 3AV1C 3R45A 1P3LB 3KXBA 3B6GC 4J8UC 1ID3D 1P3MC 4J8UB 3B6GB 2FJ7C 4UUZB 5BNVA 2FJ7B 1S32A 3EG5B 5B0ZB 3B0DC 4UPKA 5BS7C 1M18C 2F8NH 5B1MC 3B0DB 5B2IB 3W96B 2JSSA 5B1MB 3REHA 3TU4A 4H9PB 1JFIA 5DNNB 3AYWB 3X1TA 1S32D 4JJNA 4EO5B 1P3LA 2HUEC 5JA4B 4XUJC 2F8ND 3MNND 4H9RB 5FUGB 5CPIB 3WTPE 3B0CW 3MVDA 4AWLB 4XUJB 5DNMB 4J8UA 3C1CB 3X1VB 3B6GA 4UUZA 3AZGA 3AZHC 5AV6B 3AZFD 4Z5TC 3X1SB 4ZUXD 3AZHB 5BNXB 3X1TD 4YM6B 2IO5B 5B33D 5B0ZA 1P3LD 3B0BA 3VH5T 3MVDD 5B2IA 3W96A 3MGSB 5AVCD 4J8XD 3AZGD 2F2AC 3C1BB 4H9PA 5DNNA 2Y2NA 3AYWA 1A7WA 1B6WA 3REIC 1P3IC 1P3FC 4H9NB 5AV5C 3EPHA 2L5AA 5JA4A 1P3IB 5B0ZD 4H9RA 5FUGA 3AZIC 5CPIA 3VH5A 5B1LA 5AV5B 4XUJA 5DNMA 1P3AC 3C1CA 1M1AB 4CSRB 5AV6A 3X1SA 1F1EA 3AV2C 5BNXA 5DNND 4YM6A 5GT0D 3AZLC 3REJC 3AZLB 3UTBC 5B1LD 1KX5C 1EQZB 5DNMD 3A6NA 5JRGB 3C1CD 3MGSA 1P3PA 4J8WC 5AV9B 5GSUC 2HIOD 3LJAB 2AROC 3C1BA 5AV6D 3WAAC 4YS3B 3WKJD 5BT1C 2NZDC 4H9NA 2ZY4A 1P3IA 3V9RB 3NQUB 3LELD 3NQJB 4NE3A 5AV5A 3KWQC 4DRBA 2Y2JA 4WNNB 1M1AA 3A6ND 1P3PD 1BH8B 2G5IC 4CSRA 3P5JB 3RELC 1M19D 1WWSA 2F8NG 4KUDB 1ID3C 4G92C 4Z66D 1EQZA 3B0CT 3UTAC 5JRGA 3AFAD 5AV9A 3LJAA 3REKB 4YS3A 5B31C 5B40A 3H0RC 3O62A 1HQ3B 3KXBC 3V9RA 4H9SC 3NQUA 4H9OB 3NQJA 2G5HC 4WU8D 5AY8D 4WNNA 5B24B 1EQZD 5JRGD 1BH8A 5AV9D 4X23A 3LJAD 1S32C 4KUDA 3LZ1B 2DQNC 2PYOD 5B40D 3MNNC 4QLCB 3O62D 4KGCB 3W99B 2F8NB 4H9QB 4G91B 3MNNB 3REHC 2Y2PA 5AV8B 4X23D 3X1TC 3REKA 4KHAB 3AZFB 4ZBJB 4JJNC 3WTPB 4ZUXB 4KUDD 1P3LC 1HQ3A 3X1TB 5B33B 4H9OA 3MVDC 5CP6A 4H9SA 5B24A 3AZGC 3MVDB 5AVCB 4J8XB 3AZGB 4NE6A 3AN2B 3REKD 5B0YB 3LZ1A 1ZLAB 4QLCA 5B0ZC 1HQ3D 4KGCA 3W99A 2JE5A 4H9QA 3MNNA 3MGQD 2F8NA 5B2IC 3W96C 3UT9B 3F6TA 5CP6D 3AZEB 5B24D 3B6FB 4CAYB 4NE5A 5AV8A 1R4VA 5DNNC 3AYWC 4KHAA 5GT0C 3AZFA 3LZ0A 4EO5C 4ZUXA 3WTPA 3LZ1D 5B2JD 1U35D 1F66B 5GT0B 4QLCD 5CPIC 5B33A 5B1LC 4KGCD 4AWLC 3W99D 5DNMC 3C1CC 5B1LB 2HIOC 2Y2MA 5CHLB 5AV6C 3WKJC 4E44A 5AV8D 5AVCA 2HIOB 4J8XA 3X1SC 3AN2A 4YM6C 5B0YA 3X1UD 3WKJB 3LZ0D 2IO5C 1P34D 1Z2CB 3WTPD 1ZLAA 5GXQD 3LELB 3A6NC 3MGSC 3UT9A 3AZEA 1P3PC 4XZQB 3B6FA 3W97B 2RVQD 4CAYA 3C1BC 2J8PA 3A6NB 1P3PB 2ZY3A 1M19B 3AN2D 3EPLA 5B0YD 1F66A 1HTAA 4M6BA 5GT0A 1ZLAD 5F99D 1N1JB 2Y2QA 2CWEA 4Z66B 3AFAC 1M1AC 3VH6W 3AZED 3UT9D 3B6FD 3IP4C 4LD9B 3AFAB 2HIOA 3WKJA 3AZKD 1P3BD 1P3GB 1F66D 2YFWB 5E5AB 2CV5D 2FFFB 5AY8C 2XD1A 3LELA 1EQZC 3AZMB 5JRGC 3W97A 4XZQA 5AV9C 4WU8B 3LJAC 5AY8B 2Y2OA 3H0MC 4YS3C 3KUYA 2PYOC 1M19A 5B40C 3O62C 1P3OD 2PYOB 1N1JA 5B40B 3O62B 1AOIB 4Z66A 3AZJA 1M18D 4XZQD 4X23C 3W97D 4LD9A 3AFAA 4KUDC 3KUYD 3EPJA 4X23B 2RIQA 1P3GA 2YFWA 5E5AA 4HGAB 5GT3D 3AZMA 2BYMB 4WU8A 3WA9B 5AY8A 3AZJD 4R8PD 3H0LC 3REKC 4LD9D 1KX4A 2ZY5A 5AVBD 1HQ3C 2PYOA 1P3GD 1AOIA 5E5AD 5CP6C 3MGQB 1TZYB 5B24C 3AZMD 4Z2MH 5BO0A 5CP6B 2F8NK 5B32D 3AZNB 5KDMB 5B2JC 3LZ1C 1KX4D 1WWIA 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J B;  1U35 B;  4KGC C;  3MGR A;  3W99 C;  4G91 C;  1AOI D;  3AZI D;  4WZS B;  2BYM A;  3WA9 A;  5AV8 C;  3VH6 T;  3X1U C;  3AZF C;  3LZ0 C;  4ZBJ C;  1P34 C;  3W98 B;  4ZUX C;  3WTP C;  3X1U B;  3LZ0 B;  1P34 B;  5B33 C;  5GXQ B;  3VH5 W;  3MGR D;  3MGQ A;  1TZY A;  5C3I C;  1KX3 B;  1KX5 D;  5AVC C;  4J8X C;  3WA9 D;  5C3I B;  3AN2 C;  4J8W D;  3AZN A;  5GSU D;  5B0Y C;  5KDM A;  1ZLA C;  5F99 C;  3X1V A;  5B2J A;  1U35 A;  5F99 B;  3AZE C;  3UT9 C;  3B6F C;  3KWQ D;  1TZY D;  4WU9 D;  2NQB B;  3W98 A;  3AZK C;  3REL D;  3AZN D;  1P3K B;  1P3B C;  1F66 C;  3X1U A;  5CPJ D;  5CPK B;  3X1V D;  1P34 A;  3AZK B;  2CV5 C;  3KSY A;  5G49 B;  1P3B B;  1ULY A;  5GXQ A;  3AV1 B;  2CV5 B;  1KX3 A;  1BFM A;  3UTA D;  1P3M B;  4J8V D;  1P3O C;  3W98 D;  5B31 D;  1P3O B;  5F99 A;  3KXB D;  3LEL C;  5B32 G;  3MGP A;  4XZQ C;  3W97 C;  2NQB A;  1KX3 D;  1M18 B;  1H3O B;  3KUY C;  1M19 C;  1P3K A;  1TAF B;  4NFT A;  4Z2M G;  3KUY B;  5CPK A;  3AZK A;  1P3B A;  5G49 A;  4E45 A;  1KU5 A;  5GT3 C;  3AV1 A;  2CV5 A;  4Z66 C;  2HUE B;  3AZJ C;  3MGP D;  5GT3 B;  4R8P C;  4LD9 C;  2NQB D;  1P3M A;  3AZJ B;  3REH D;  5AVB C;  2FJ7 A;  3TU4 D;  4R8P B;  1P3K D;  1P3G C;  5AVB B;  4Z5T B;  4JJN D;  5CPK D;  1P3O A;  5E5A C;  3AZM C;  3AV1 D;  4WU8 C;  4J8U D;  3B6G D;  5B32 C;  5BS7 A;  1M18 A;  1H3O A;  5B1M A;  1KX4 C;  1P3M D;  5B32 B;  2FJ7 D;  1TAF A;  1KX4 B;  1AOI C;  1P3F B;  3REI B;  5GT3 A;  3AZI B;  5B2I D;  3W96 D;  1P3A B;  5B1M D;  5BO0 B;  4R8P A;  1Q9C A;  3AZH A;  3AYW D;  5AVB A;  4Z5T A;  3MGR C;  3AV2 B;  4HGA C;  5CPI D;  3MGR B;  3REJ B;  4XUJ D;  3WA9 C;  3UTB B;  1KX5 B;  5B31 G;  5B32 A;  4J8W B;  3X1S D;  5GSU B;  2ARO B;  3AZH D;  4YM6 D;  3WAA B;  4Z5T D;  1P3F A;  3REI A;  2NZD B;  3MGQ C;  1TZY C;  4WU9 C;  3AZI A;  1BH9 B;  3KWQ B;  4WU9 B;  3MGS D;  3AZN C;  2LY8 A;  1P3A A;  3C1B D;  4WV4 B;  5CPJ C;  2BYK B;  3X1V C;  3REL B;  1U35 C;  3AV2 A;  5CPJ B;  1P3F D;  3REI D;  3AZL A;  1P3I D;  2YFV B;  5AV5 D;  1ID3 B;  3REJ A;  4G92 B;  3UTB A;  1M1A D;  1KX5 A;  4J8V C;  3W98 C;  3UTA B;  1P3A D;  4J8W A;  5GSU A;  4J8V B;  2ARO A;  3WAA A;  1B67 A;  5GXQ C;  5B31 B;  3AV2 D;  3R45 B;  2NZD A;  3KXB B;  3AZL D;  1KX3 C;  1BH9 A;  3REJ D;  3KWQ A;  2RVQ C;  4WU9 A;  3UTB D;  3VH6 A;  5BNV B;  2BYK A;  4YS3 D;  3REL A;  2ARO D;  1S32 B;  5CPJ A;  3WAA D;  5BT1 D;  2NZD D;  3MGP C;  2YFV A;  1ID3 A;  2NQB C;  3MGP B;  3TU4 C;  1P3K C;  3UTA A;  3REH B;  3TU4 B;  4J8V A;  4DRA A;  5CPK C;  1JFI B;  5B31 A;  4JJN B;  3AV1 C;  3R45 A;  1P3L B;  3KXB A;  3B6G C;  4J8U C;  1ID3 D;  1P3M C;  4J8U B;  3B6G B;  2FJ7 C;  4UUZ B;  5BNV A;  2FJ7 B;  1S32 A;  5B0Z B;  3B0D C;  5BS7 C;  1M18 C;  2F8N H;  5B1M C;  3B0D B;  5B2I B;  3W96 B;  2JSS A;  5B1M B;  3REH A;  3TU4 A;  4H9P B;  1JFI A;  5DNN B;  3AYW B;  3X1T A;  1S32 D;  4JJN A;  4EO5 B;  1P3L A;  2HUE C;  5JA4 B;  4XUJ C;  2F8N D;  3MNN D;  4H9R B;  5FUG B;  5CPI B;  3WTP E;  3B0C W;  3MVD A;  4AWL B;  4XUJ B;  5DNM B;  4J8U A;  3C1C B;  3X1V B;  3B6G A;  4UUZ A;  3AZG A;  3AZH C;  5AV6 B;  3AZF D;  4Z5T C;  3X1S B;  4ZUX D;  3AZH B;  5BNX B;  3X1T D;  4YM6 B;  2IO5 B;  5B33 D;  5B0Z A;  1P3L D;  3B0B A;  3VH5 T;  3MVD D;  5B2I A;  3W96 A;  3MGS B;  5AVC D;  4J8X D;  3AZG D;  3C1B B;  4H9P A;  5DNN A;  3AYW A;  1A7W A;  1B6W A;  3REI C;  1P3I C;  1P3F C;  4H9N B;  5AV5 C;  2L5A A;  5JA4 A;  1P3I B;  5B0Z D;  4H9R A;  5FUG A;  3AZI C;  5CPI A;  3VH5 A;  5B1L A;  5AV5 B;  4XUJ A;  5DNM A;  1P3A C;  3C1C A;  1M1A B;  4CSR B;  5AV6 A;  3X1S A;  1F1E A;  3AV2 C;  5BNX A;  5DNN D;  4YM6 A;  5GT0 D;  3AZL C;  3REJ C;  3AZL B;  3UTB C;  5B1L D;  1KX5 C;  1EQZ B;  5DNM D;  3A6N A;  5JRG B;  3C1C D;  3MGS A;  1P3P A;  4J8W C;  5AV9 B;  5GSU C;  2HIO D;  3LJA B;  2ARO C;  3C1B A;  5AV6 D;  3WAA C;  4YS3 B;  3WKJ D;  5BT1 C;  2NZD C;  4H9N A;  1P3I A;  3V9R B;  3NQU B;  3LEL D;  3NQJ B;  4NE3 A;  5AV5 A;  3KWQ C;  4DRB A;  4WNN B;  1M1A A;  3A6N D;  1P3P D;  1BH8 B;  4CSR A;  3REL C;  1M19 D;  1WWS A;  2F8N G;  4KUD B;  1ID3 C;  4G92 C;  4Z66 D;  1EQZ A;  3B0C T;  3UTA C;  5JRG A;  3AFA D;  5AV9 A;  3LJA A;  3REK B;  4YS3 A;  5B31 C;  5B40 A;  3O62 A;  1HQ3 B;  3KXB C;  3V9R A;  4H9S C;  3NQU A;  4H9O B;  3NQJ A;  4WU8 D;  5AY8 D;  4WNN A;  5B24 B;  1EQZ D;  5JRG D;  1BH8 A;  5AV9 D;  4X23 A;  3LJA D;  1S32 C;  4KUD A;  3LZ1 B;  2PYO D;  5B40 D;  3MNN C;  4QLC B;  3O62 D;  4KGC B;  3W99 B;  2F8N B;  4H9Q B;  4G91 B;  3MNN B;  3REH C;  5AV8 B;  4X23 D;  3X1T C;  3REK A;  4KHA B;  3AZF B;  4ZBJ B;  4JJN C;  3WTP B;  4ZUX B;  4KUD D;  1P3L C;  1HQ3 A;  3X1T B;  5B33 B;  4H9O A;  3MVD C;  5CP6 A;  4H9S A;  5B24 A;  3AZG C;  3MVD B;  5AVC B;  4J8X B;  3AZG B;  4NE6 A;  3AN2 B;  3REK D;  5B0Y B;  3LZ1 A;  1ZLA B;  4QLC A;  5B0Z C;  1HQ3 D;  4KGC A;  3W99 A;  2F8N A;  4H9Q A;  3MNN A;  3MGQ D;  5B2I C;  3W96 C;  3UT9 B;  3AZE B;  5CP6 D;  3B6F B;  5B24 D;  4CAY B;  4NE5 A;  5AV8 A;  1R4V A;  5DNN C;  3AYW C;  4KHA A;  5GT0 C;  3AZF A;  3LZ0 A;  4EO5 C;  4ZUX A;  3WTP A;  3LZ1 D;  5B2J D;  1U35 D;  1F66 B;  5GT0 B;  4QLC D;  5CPI C;  5B33 A;  5B1L C;  4KGC D;  4AWL C;  3W99 D;  5DNM C;  3C1C C;  5B1L B;  2HIO C;  5CHL B;  5AV6 C;  3WKJ C;  4E44 A;  5AV8 D;  5AVC A;  2HIO B;  4J8X A;  3X1S C;  3AN2 A;  4YM6 C;  5B0Y A;  3X1U D;  3WKJ B;  3LZ0 D;  2IO5 C;  1P34 D;  3WTP D;  1ZLA A;  5GXQ D;  3LEL B;  3A6N C;  3MGS C;  3UT9 A;  3AZE A;  1P3P C;  4XZQ B;  3B6F A;  3W97 B;  2RVQ D;  4CAY A;  3C1B C;  3A6N B;  1P3P B;  1M19 B;  3AN2 D;  5B0Y D;  1F66 A;  1HTA A;  4M6B A;  5GT0 A;  1ZLA D;  5F99 D;  1N1J B;  2CWE A;  4Z66 B;  3AFA C;  1M1A C;  3VH6 W;  3AZE D;  3UT9 D;  3B6F D;  4LD9 B;  3AFA B;  2HIO A;  3WKJ A;  3AZK D;  1P3B D;  1P3G B;  1F66 D;  2YFW B;  5E5A B;  2CV5 D;  5AY8 C;  1EQZ C;  3LEL A;  3AZM B;  5JRG C;  3W97 A;  4XZQ A;  5AV9 C;  4WU8 B;  3LJA C;  5AY8 B;  4YS3 C;  3KUY A;  2PYO C;  1M19 A;  5B40 C;  3O62 C;  1P3O D;  2PYO B;  1N1J A;  5B40 B;  3O62 B;  1AOI B;  4Z66 A;  3AZJ A;  1M18 D;  4XZQ D;  4X23 C;  3W97 D;  4LD9 A;  3AFA A;  4KUD C;  3KUY D;  4X23 B;  1P3G A;  2YFW A;  5E5A A;  4HGA B;  5GT3 D;  3AZM A;  2BYM B;  4WU8 A;  3WA9 B;  5AY8 A;  3AZJ D;  4R8P D;  3REK C;  4LD9 D;  1KX4 A;  5AVB D;  1HQ3 C;  2PYO A;  1P3G D;  1AOI A;  5E5A D;  5CP6 C;  3MGQ B;  1TZY B;  5B24 C;  3AZM D;  4Z2M H;  5BO0 A;  5CP6 B;  2F8N K;  5B32 D;  3AZN B;  5KDM B;  5B2J C;  3LZ1 C;  1KX4 D;  1WWI A;  4QLC C; 
#chains in the Genus database with same CATH topology
 5B2J B;  1U35 B;  4KGC C;  3MGR A;  3W99 C;  4G91 C;  1AOI D;  2XD5 A;  3AZI D;  4WZS B;  2BYM A;  3WA9 A;  5AV8 C;  3VH6 T;  3X1U C;  3AZF C;  3LZ0 C;  2W8S A;  4ZBJ C;  1P34 C;  4ZUX C;  3WTP C;  3W98 B;  3X1U B;  3LZ0 B;  1P34 B;  2DF4 C;  5B33 C;  5GXQ B;  3VH5 W;  3MGR D;  3MGQ A;  1TZY A;  5C3I C;  1KX3 B;  1KX5 D;  5AVC C;  4J8X C;  3WA9 D;  4WJ3 C;  5C3I B;  3AN2 C;  4J8W D;  3AZN A;  5GSU D;  5B0Y C;  5KDM A;  3A1I A;  1ZLA C;  5F99 C;  3X1V A;  5B2J A;  1U35 A;  5F99 B;  3AZE C;  2Y2H A;  3UT9 C;  3B6F C;  2Y2L A;  1TZY D;  3KWQ D;  4WU9 D;  2NQB B;  3W98 A;  3AZK C;  3EPK A;  3REL D;  3AZN D;  1P3K B;  1P3B C;  1F66 C;  3X1U A;  5CPJ D;  5CPK B;  3X1V D;  1P34 A;  3AZK B;  2CV5 C;  2Y2I A;  3KSY A;  5G49 B;  1ULY A;  5GXQ A;  1P3B B;  3AV1 B;  2CV5 B;  4DQY B;  1KX3 A;  3FDD A;  3UTA D;  1P3M B;  1BFM A;  4J8V D;  1P3O C;  3W98 D;  1PZR A;  5B31 D;  1P3O B;  2Y2G A;  5F99 A;  3KXB D;  3LEL C;  5B32 G;  3MGP A;  4XZQ C;  3W97 C;  2NQB A;  1KX3 D;  1M18 B;  1H3O B;  3KUY C;  1M19 C;  1P3K A;  1TAF B;  4NFT A;  4Z2M G;  3KUY B;  5CPK A;  3AZK A;  3KFU G;  1P3B A;  5G49 A;  4E45 A;  1KU5 A;  5GT3 C;  3AV1 A;  2CV5 A;  4Z66 C;  2HUE B;  3AZJ C;  3MGP D;  5GT3 B;  4R8P C;  2ZM5 A;  4LD9 C;  1T3U A;  2NQB D;  1P3M A;  3AZJ B;  3REH D;  5AVB C;  2FJ7 A;  3TU4 D;  4R8P B;  1P3K D;  1P3G C;  5AVB B;  4Z5T B;  4JJN D;  5CPK D;  1P3O A;  5E5A C;  1W2E A;  3AZM C;  3AV1 D;  4WU8 C;  4J8U D;  3B6G D;  5B32 C;  5BS7 A;  1M18 A;  1H3O A;  5B1M A;  1KX4 C;  1P3M D;  5B32 B;  2FJ7 D;  1TAF A;  1KX4 B;  1AOI C;  1P3F B;  3REI B;  5GT3 A;  3AZI B;  5B2I D;  3W96 D;  1P3A B;  5B1M D;  5BO0 B;  4R8P A;  1Q9C A;  3AZH A;  3AYW D;  5AVB A;  4Z5T A;  3MGR C;  3AV2 B;  2UWX A;  4HGA C;  5CPI D;  2ZY2 A;  3MGR B;  3REJ B;  4XUJ D;  3WA9 C;  3UTB B;  1KX5 B;  5B31 G;  5B32 A;  4J8W B;  3X1S D;  5GSU B;  2ARO B;  3AZH D;  4YM6 D;  3WAA B;  4Z5T D;  1P3F A;  3REI A;  2NZD B;  3MGQ C;  1TZY C;  4WU9 C;  3AZI A;  1BH9 B;  3KWQ B;  4WU9 B;  3MGS D;  3AZN C;  2LY8 A;  1P3A A;  3C1B D;  4WV4 B;  5CPJ C;  2BYK B;  3X1V C;  3REL B;  1U35 C;  3AV2 A;  2BG1 A;  5CPJ B;  3A1K A;  1P3F D;  3REI D;  3AZL A;  1P3I D;  2YFV B;  5AV5 D;  1ID3 B;  3REJ A;  4G92 B;  3UTB A;  1M1A D;  1KX5 A;  4J8V C;  3W98 C;  2JCH A;  3UTA B;  1P3A D;  4J8W A;  5GSU A;  4J8V B;  2ARO A;  3WAA A;  1B67 A;  5GXQ C;  5B31 B;  3AV2 D;  3R45 B;  2NZD A;  3KXB B;  3AZL D;  1KX3 C;  1BH9 A;  3REJ D;  3KWQ A;  2RVQ C;  4WU9 A;  3UTB D;  3VH6 A;  5BNV B;  2BYK A;  4YS3 D;  3REL A;  2ARO D;  1S32 B;  2Y2K A;  2VQR A;  5CPJ A;  3WAA D;  5BT1 D;  2NZD D;  3MGP C;  2YFV A;  1ID3 A;  3AL0 C;  2NQB C;  3MGP B;  3TU4 C;  1P3K C;  3UTA A;  3REH B;  3TU4 B;  4J8V A;  4DRA A;  5CPK C;  1JFI B;  5B31 A;  4JJN B;  3AV1 C;  3R45 A;  1P3L B;  3KXB A;  3B6G C;  4J8U C;  1ID3 D;  1P3M C;  4J8U B;  3B6G B;  2FJ7 C;  4UUZ B;  5BNV A;  2FJ7 B;  1S32 A;  3EG5 B;  5B0Z B;  3B0D C;  4UPK A;  5BS7 C;  1M18 C;  2F8N H;  5B1M C;  3B0D B;  5B2I B;  3W96 B;  2JSS A;  5B1M B;  3REH A;  3TU4 A;  4H9P B;  1JFI A;  5DNN B;  3AYW B;  3X1T A;  1S32 D;  4JJN A;  4EO5 B;  1P3L A;  2HUE C;  5JA4 B;  4XUJ C;  2F8N D;  3MNN D;  4H9R B;  5FUG B;  5CPI B;  3WTP E;  3B0C W;  3MVD A;  4AWL B;  4XUJ B;  5DNM B;  4J8U A;  3C1C B;  3X1V B;  3B6G A;  4UUZ A;  3AZG A;  3AZH C;  5AV6 B;  3AZF D;  4Z5T C;  3X1S B;  4ZUX D;  3AZH B;  5BNX B;  3X1T D;  4YM6 B;  2IO5 B;  5B33 D;  5B0Z A;  1P3L D;  3B0B A;  3VH5 T;  3MVD D;  5B2I A;  3W96 A;  3MGS B;  5AVC D;  4J8X D;  3AZG D;  2F2A C;  3C1B B;  4H9P A;  5DNN A;  2Y2N A;  3AYW A;  1A7W A;  1B6W A;  3REI C;  1P3I C;  1P3F C;  4H9N B;  5AV5 C;  3EPH A;  2L5A A;  5JA4 A;  1P3I B;  5B0Z D;  4H9R A;  5FUG A;  3AZI C;  5CPI A;  3VH5 A;  5B1L A;  5AV5 B;  4XUJ A;  5DNM A;  1P3A C;  3C1C A;  1M1A B;  4CSR B;  5AV6 A;  3X1S A;  1F1E A;  3AV2 C;  5BNX A;  5DNN D;  4YM6 A;  5GT0 D;  3AZL C;  3REJ C;  3AZL B;  3UTB C;  5B1L D;  1KX5 C;  1EQZ B;  5DNM D;  3A6N A;  5JRG B;  3C1C D;  3MGS A;  1P3P A;  4J8W C;  5AV9 B;  5GSU C;  2HIO D;  3LJA B;  2ARO C;  3C1B A;  5AV6 D;  3WAA C;  4YS3 B;  3WKJ D;  5BT1 C;  2NZD C;  4H9N A;  2ZY4 A;  1P3I A;  3V9R B;  3NQU B;  3LEL D;  3NQJ B;  4NE3 A;  5AV5 A;  3KWQ C;  4DRB A;  2Y2J A;  4WNN B;  1M1A A;  3A6N D;  1P3P D;  1BH8 B;  2G5I C;  4CSR A;  3P5J B;  3REL C;  1M19 D;  1WWS A;  2F8N G;  4KUD B;  1ID3 C;  4G92 C;  4Z66 D;  1EQZ A;  3B0C T;  3UTA C;  5JRG A;  3AFA D;  5AV9 A;  3LJA A;  3REK B;  4YS3 A;  5B31 C;  5B40 A;  3H0R C;  3O62 A;  1HQ3 B;  3KXB C;  3V9R A;  4H9S C;  3NQU A;  4H9O B;  3NQJ A;  2G5H C;  4WU8 D;  5AY8 D;  4WNN A;  5B24 B;  1EQZ D;  5JRG D;  1BH8 A;  5AV9 D;  4X23 A;  3LJA D;  1S32 C;  4KUD A;  3LZ1 B;  2DQN C;  2PYO D;  5B40 D;  3MNN C;  4QLC B;  3O62 D;  4KGC B;  3W99 B;  2F8N B;  4H9Q B;  4G91 B;  3MNN B;  3REH C;  2Y2P A;  5AV8 B;  4X23 D;  3X1T C;  3REK A;  4KHA B;  3AZF B;  4ZBJ B;  4JJN C;  3WTP B;  4ZUX B;  4KUD D;  1P3L C;  1HQ3 A;  3X1T B;  5B33 B;  4H9O A;  3MVD C;  5CP6 A;  4H9S A;  5B24 A;  3AZG C;  3MVD B;  5AVC B;  4J8X B;  3AZG B;  4NE6 A;  3AN2 B;  3REK D;  5B0Y B;  3LZ1 A;  1ZLA B;  4QLC A;  5B0Z C;  1HQ3 D;  4KGC A;  3W99 A;  2JE5 A;  4H9Q A;  3MNN A;  3MGQ D;  2F8N A;  5B2I C;  3W96 C;  3UT9 B;  3F6T A;  5CP6 D;  3AZE B;  5B24 D;  3B6F B;  4CAY B;  4NE5 A;  5AV8 A;  1R4V A;  5DNN C;  3AYW C;  4KHA A;  5GT0 C;  3AZF A;  3LZ0 A;  4EO5 C;  4ZUX A;  3WTP A;  3LZ1 D;  5B2J D;  1U35 D;  1F66 B;  5GT0 B;  4QLC D;  5CPI C;  5B33 A;  5B1L C;  4KGC D;  4AWL C;  3W99 D;  5DNM C;  3C1C C;  5B1L B;  2HIO C;  2Y2M A;  5CHL B;  5AV6 C;  3WKJ C;  4E44 A;  5AV8 D;  5AVC A;  2HIO B;  4J8X A;  3X1S C;  3AN2 A;  4YM6 C;  5B0Y A;  3X1U D;  3WKJ B;  3LZ0 D;  2IO5 C;  1P34 D;  1Z2C B;  3WTP D;  1ZLA A;  5GXQ D;  3LEL B;  3A6N C;  3MGS C;  3UT9 A;  3AZE A;  1P3P C;  4XZQ B;  3B6F A;  3W97 B;  2RVQ D;  4CAY A;  3C1B C;  2J8P A;  3A6N B;  1P3P B;  2ZY3 A;  1M19 B;  3AN2 D;  3EPL A;  5B0Y D;  1F66 A;  1HTA A;  4M6B A;  5GT0 A;  1ZLA D;  5F99 D;  1N1J B;  2Y2Q A;  2CWE A;  4Z66 B;  3AFA C;  1M1A C;  3VH6 W;  3AZE D;  3UT9 D;  3B6F D;  3IP4 C;  4LD9 B;  3AFA B;  2HIO A;  3WKJ A;  3AZK D;  1P3B D;  1P3G B;  1F66 D;  2YFW B;  5E5A B;  2CV5 D;  2FFF B;  5AY8 C;  2XD1 A;  3LEL A;  1EQZ C;  3AZM B;  5JRG C;  3W97 A;  4XZQ A;  5AV9 C;  4WU8 B;  3LJA C;  5AY8 B;  2Y2O A;  3H0M C;  4YS3 C;  3KUY A;  2PYO C;  1M19 A;  5B40 C;  3O62 C;  1P3O D;  2PYO B;  1N1J A;  5B40 B;  3O62 B;  1AOI B;  4Z66 A;  3AZJ A;  1M18 D;  4XZQ D;  4X23 C;  3W97 D;  4LD9 A;  3AFA A;  4KUD C;  3KUY D;  3EPJ A;  4X23 B;  2RIQ A;  1P3G A;  2YFW A;  5E5A A;  4HGA B;  5GT3 D;  3AZM A;  2BYM B;  4WU8 A;  3WA9 B;  5AY8 A;  3AZJ D;  4R8P D;  3H0L C;  3REK C;  4LD9 D;  1KX4 A;  2ZY5 A;  5AVB D;  1HQ3 C;  2PYO A;  1P3G D;  1AOI A;  5E5A D;  5CP6 C;  3MGQ B;  1TZY B;  5B24 C;  3AZM D;  4Z2M H;  5BO0 A;  5CP6 B;  2F8N K;  5B32 D;  3AZN B;  5KDM B;  5B2J C;  3LZ1 C;  1KX4 D;  1WWI A;  4QLC C; 
#chains in the Genus database with same CATH homology
 5B2J B;  1U35 B;  4KGC C;  3MGR A;  3W99 C;  4G91 C;  1AOI D;  2XD5 A;  3AZI D;  4WZS B;  2BYM A;  3WA9 A;  5AV8 C;  3VH6 T;  3X1U C;  3AZF C;  3LZ0 C;  2W8S A;  4ZBJ C;  1P34 C;  4ZUX C;  3WTP C;  3W98 B;  3X1U B;  3LZ0 B;  1P34 B;  2DF4 C;  5B33 C;  5GXQ B;  3VH5 W;  3MGR D;  3MGQ A;  1TZY A;  5C3I C;  1KX3 B;  1KX5 D;  5AVC C;  4J8X C;  3WA9 D;  4WJ3 C;  5C3I B;  3AN2 C;  4J8W D;  3AZN A;  5GSU D;  5B0Y C;  5KDM A;  3A1I A;  1ZLA C;  5F99 C;  3X1V A;  5B2J A;  1U35 A;  5F99 B;  3AZE C;  2Y2H A;  3UT9 C;  3B6F C;  2Y2L A;  1TZY D;  3KWQ D;  4WU9 D;  2NQB B;  3W98 A;  3AZK C;  3EPK A;  3REL D;  3AZN D;  1P3K B;  1P3B C;  1F66 C;  3X1U A;  5CPJ D;  5CPK B;  3X1V D;  1P34 A;  3AZK B;  2CV5 C;  2Y2I A;  3KSY A;  5G49 B;  1ULY A;  5GXQ A;  1P3B B;  3AV1 B;  2CV5 B;  4DQY B;  1KX3 A;  3FDD A;  3UTA D;  1P3M B;  1BFM A;  4J8V D;  1P3O C;  3W98 D;  1PZR A;  5B31 D;  1P3O B;  2Y2G A;  5F99 A;  3KXB D;  3LEL C;  5B32 G;  3MGP A;  4XZQ C;  3W97 C;  2NQB A;  1KX3 D;  1M18 B;  1H3O B;  3KUY C;  1M19 C;  1P3K A;  1TAF B;  4NFT A;  4Z2M G;  3KUY B;  5CPK A;  3AZK A;  3KFU G;  1P3B A;  5G49 A;  4E45 A;  1KU5 A;  5GT3 C;  3AV1 A;  2CV5 A;  4Z66 C;  2HUE B;  3AZJ C;  3MGP D;  5GT3 B;  4R8P C;  2ZM5 A;  4LD9 C;  1T3U A;  2NQB D;  1P3M A;  3AZJ B;  3REH D;  5AVB C;  2FJ7 A;  3TU4 D;  4R8P B;  1P3K D;  1P3G C;  5AVB B;  4Z5T B;  4JJN D;  5CPK D;  1P3O A;  5E5A C;  1W2E A;  3AZM C;  3AV1 D;  4WU8 C;  4J8U D;  3B6G D;  5B32 C;  5BS7 A;  1M18 A;  1H3O A;  5B1M A;  1KX4 C;  1P3M D;  5B32 B;  2FJ7 D;  1TAF A;  1KX4 B;  1AOI C;  1P3F B;  3REI B;  5GT3 A;  3AZI B;  5B2I D;  3W96 D;  1P3A B;  5B1M D;  5BO0 B;  4R8P A;  1Q9C A;  3AZH A;  3AYW D;  5AVB A;  4Z5T A;  3MGR C;  3AV2 B;  2UWX A;  4HGA C;  5CPI D;  2ZY2 A;  3MGR B;  3REJ B;  4XUJ D;  3WA9 C;  3UTB B;  1KX5 B;  5B31 G;  5B32 A;  4J8W B;  3X1S D;  5GSU B;  2ARO B;  3AZH D;  4YM6 D;  3WAA B;  4Z5T D;  1P3F A;  3REI A;  2NZD B;  3MGQ C;  1TZY C;  4WU9 C;  3AZI A;  1BH9 B;  3KWQ B;  4WU9 B;  3MGS D;  3AZN C;  2LY8 A;  1P3A A;  3C1B D;  4WV4 B;  5CPJ C;  2BYK B;  3X1V C;  3REL B;  1U35 C;  3AV2 A;  2BG1 A;  5CPJ B;  3A1K A;  1P3F D;  3REI D;  3AZL A;  1P3I D;  2YFV B;  5AV5 D;  1ID3 B;  3REJ A;  4G92 B;  3UTB A;  1M1A D;  1KX5 A;  4J8V C;  3W98 C;  2JCH A;  3UTA B;  1P3A D;  4J8W A;  5GSU A;  4J8V B;  2ARO A;  3WAA A;  1B67 A;  5GXQ C;  5B31 B;  3AV2 D;  3R45 B;  2NZD A;  3KXB B;  3AZL D;  1KX3 C;  1BH9 A;  3REJ D;  3KWQ A;  2RVQ C;  4WU9 A;  3UTB D;  3VH6 A;  5BNV B;  2BYK A;  4YS3 D;  3REL A;  2ARO D;  1S32 B;  2Y2K A;  2VQR A;  5CPJ A;  3WAA D;  5BT1 D;  2NZD D;  3MGP C;  2YFV A;  1ID3 A;  3AL0 C;  2NQB C;  3MGP B;  3TU4 C;  1P3K C;  3UTA A;  3REH B;  3TU4 B;  4J8V A;  4DRA A;  5CPK C;  1JFI B;  5B31 A;  4JJN B;  3AV1 C;  3R45 A;  1P3L B;  3KXB A;  3B6G C;  4J8U C;  1ID3 D;  1P3M C;  4J8U B;  3B6G B;  2FJ7 C;  4UUZ B;  5BNV A;  2FJ7 B;  1S32 A;  3EG5 B;  5B0Z B;  3B0D C;  4UPK A;  5BS7 C;  1M18 C;  2F8N H;  5B1M C;  3B0D B;  5B2I B;  3W96 B;  2JSS A;  5B1M B;  3REH A;  3TU4 A;  4H9P B;  1JFI A;  5DNN B;  3AYW B;  3X1T A;  1S32 D;  4JJN A;  4EO5 B;  1P3L A;  2HUE C;  5JA4 B;  4XUJ C;  2F8N D;  3MNN D;  4H9R B;  5FUG B;  5CPI B;  3WTP E;  3B0C W;  3MVD A;  4AWL B;  4XUJ B;  5DNM B;  4J8U A;  3C1C B;  3X1V B;  3B6G A;  4UUZ A;  3AZG A;  3AZH C;  5AV6 B;  3AZF D;  4Z5T C;  3X1S B;  4ZUX D;  3AZH B;  5BNX B;  3X1T D;  4YM6 B;  2IO5 B;  5B33 D;  5B0Z A;  1P3L D;  3B0B A;  3VH5 T;  3MVD D;  5B2I A;  3W96 A;  3MGS B;  5AVC D;  4J8X D;  3AZG D;  2F2A C;  3C1B B;  4H9P A;  5DNN A;  2Y2N A;  3AYW A;  1A7W A;  1B6W A;  3REI C;  1P3I C;  1P3F C;  4H9N B;  5AV5 C;  3EPH A;  2L5A A;  5JA4 A;  1P3I B;  5B0Z D;  4H9R A;  5FUG A;  3AZI C;  5CPI A;  3VH5 A;  5B1L A;  5AV5 B;  4XUJ A;  5DNM A;  1P3A C;  3C1C A;  1M1A B;  4CSR B;  5AV6 A;  3X1S A;  1F1E A;  3AV2 C;  5BNX A;  5DNN D;  4YM6 A;  5GT0 D;  3AZL C;  3REJ C;  3AZL B;  3UTB C;  5B1L D;  1KX5 C;  1EQZ B;  5DNM D;  3A6N A;  5JRG B;  3C1C D;  3MGS A;  1P3P A;  4J8W C;  5AV9 B;  5GSU C;  2HIO D;  3LJA B;  2ARO C;  3C1B A;  5AV6 D;  3WAA C;  4YS3 B;  3WKJ D;  5BT1 C;  2NZD C;  4H9N A;  2ZY4 A;  1P3I A;  3V9R B;  3NQU B;  3LEL D;  3NQJ B;  4NE3 A;  5AV5 A;  3KWQ C;  4DRB A;  2Y2J A;  4WNN B;  1M1A A;  3A6N D;  1P3P D;  1BH8 B;  2G5I C;  4CSR A;  3P5J B;  3REL C;  1M19 D;  1WWS A;  2F8N G;  4KUD B;  1ID3 C;  4G92 C;  4Z66 D;  1EQZ A;  3B0C T;  3UTA C;  5JRG A;  3AFA D;  5AV9 A;  3LJA A;  3REK B;  4YS3 A;  5B31 C;  5B40 A;  3H0R C;  3O62 A;  1HQ3 B;  3KXB C;  3V9R A;  4H9S C;  3NQU A;  4H9O B;  3NQJ A;  2G5H C;  4WU8 D;  5AY8 D;  4WNN A;  5B24 B;  1EQZ D;  5JRG D;  1BH8 A;  5AV9 D;  4X23 A;  3LJA D;  1S32 C;  4KUD A;  3LZ1 B;  2DQN C;  2PYO D;  5B40 D;  3MNN C;  4QLC B;  3O62 D;  4KGC B;  3W99 B;  2F8N B;  4H9Q B;  4G91 B;  3MNN B;  3REH C;  2Y2P A;  5AV8 B;  4X23 D;  3X1T C;  3REK A;  4KHA B;  3AZF B;  4ZBJ B;  4JJN C;  3WTP B;  4ZUX B;  4KUD D;  1P3L C;  1HQ3 A;  3X1T B;  5B33 B;  4H9O A;  3MVD C;  5CP6 A;  4H9S A;  5B24 A;  3AZG C;  3MVD B;  5AVC B;  4J8X B;  3AZG B;  4NE6 A;  3AN2 B;  3REK D;  5B0Y B;  3LZ1 A;  1ZLA B;  4QLC A;  5B0Z C;  1HQ3 D;  4KGC A;  3W99 A;  2JE5 A;  4H9Q A;  3MNN A;  3MGQ D;  2F8N A;  5B2I C;  3W96 C;  3UT9 B;  3F6T A;  5CP6 D;  3AZE B;  5B24 D;  3B6F B;  4CAY B;  4NE5 A;  5AV8 A;  1R4V A;  5DNN C;  3AYW C;  4KHA A;  5GT0 C;  3AZF A;  3LZ0 A;  4EO5 C;  4ZUX A;  3WTP A;  3LZ1 D;  5B2J D;  1U35 D;  1F66 B;  5GT0 B;  4QLC D;  5CPI C;  5B33 A;  5B1L C;  4KGC D;  4AWL C;  3W99 D;  5DNM C;  3C1C C;  5B1L B;  2HIO C;  2Y2M A;  5CHL B;  5AV6 C;  3WKJ C;  4E44 A;  5AV8 D;  5AVC A;  2HIO B;  4J8X A;  3X1S C;  3AN2 A;  4YM6 C;  5B0Y A;  3X1U D;  3WKJ B;  3LZ0 D;  2IO5 C;  1P34 D;  1Z2C B;  3WTP D;  1ZLA A;  5GXQ D;  3LEL B;  3A6N C;  3MGS C;  3UT9 A;  3AZE A;  1P3P C;  4XZQ B;  3B6F A;  3W97 B;  2RVQ D;  4CAY A;  3C1B C;  2J8P A;  3A6N B;  1P3P B;  2ZY3 A;  1M19 B;  3AN2 D;  3EPL A;  5B0Y D;  1F66 A;  1HTA A;  4M6B A;  5GT0 A;  1ZLA D;  5F99 D;  1N1J B;  2Y2Q A;  2CWE A;  4Z66 B;  3AFA C;  1M1A C;  3VH6 W;  3AZE D;  3UT9 D;  3B6F D;  3IP4 C;  4LD9 B;  3AFA B;  2HIO A;  3WKJ A;  3AZK D;  1P3B D;  1P3G B;  1F66 D;  2YFW B;  5E5A B;  2CV5 D;  2FFF B;  5AY8 C;  2XD1 A;  3LEL A;  1EQZ C;  3AZM B;  5JRG C;  3W97 A;  4XZQ A;  5AV9 C;  4WU8 B;  3LJA C;  5AY8 B;  2Y2O A;  3H0M C;  4YS3 C;  3KUY A;  2PYO C;  1M19 A;  5B40 C;  3O62 C;  1P3O D;  2PYO B;  1N1J A;  5B40 B;  3O62 B;  1AOI B;  4Z66 A;  3AZJ A;  1M18 D;  4XZQ D;  4X23 C;  3W97 D;  4LD9 A;  3AFA A;  4KUD C;  3KUY D;  3EPJ A;  4X23 B;  2RIQ A;  1P3G A;  2YFW A;  5E5A A;  4HGA B;  5GT3 D;  3AZM A;  2BYM B;  4WU8 A;  3WA9 B;  5AY8 A;  3AZJ D;  4R8P D;  3H0L C;  3REK C;  4LD9 D;  1KX4 A;  2ZY5 A;  5AVB D;  1HQ3 C;  2PYO A;  1P3G D;  1AOI A;  5E5A D;  5CP6 C;  3MGQ B;  1TZY B;  5B24 C;  3AZM D;  4Z2M H;  5BO0 A;  5CP6 B;  2F8N K;  5B32 D;  3AZN B;  5KDM B;  5B2J C;  3LZ1 C;  1KX4 D;  1WWI A;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...