3UTAB

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaB00
4E44A 4H9QA 5GSUD 2BYMA 3REHA 2PYOA 3REKA 4YM6A 5GXQB 4ZUXC 1A7WA 5DNNC 5AY8D 1P34D 3X1VD 1P3LC 1P3MA 3AN2A 5DNMD 5CPID 4HGAB 1M18C 1TAFB 5AV6D 4WZSB 3WKJC 1KX4C 5G49A 2NZDB 5AVBB 5B2JA 4CSRA 2F8NB 2FJ7C 5E5AA 3AZFB 5GT0C 5B0YB 3W98D 5B2IC 1P3GB 5F99D 1N1JB 1P3PA 5BNVB 5JRGB 3W96A 1P3KA 3B6GA 3AZLC 1S32D 1P3BD 5B1MC 3REID 4WU8C 4YM6C 3MGRD 3REJA 1BH9B 2LY8A 1HQ3D 3UT9B 2HIOA 1TZYD 1AOID 4R8PB 4NE6A 3AV2B 1ID3D 5CP6A 2CWEA 4EO5B 2F8NK 3AZMA 2AROA 3LZ1A 4YS3B 3W97D 4J8UC 3X1TA 5E5AC 3MVDB 4LD9D 1ZLAB 2HUEB 5BNXB 3MGPA 3C1CB 3B0DC 4KGCB 4KUDC 1P3PC 1P3AB 3A6NA 4X23C 3LZ0D 2YFWA 3W96C 3LJAB 4UUZA 1P3KC 3B6GC 5B24A 3RELA 5B1LA 5BS7C 1P3OB 3WTPD 3AFAB 1EQZA 1M19A 4ZBJC 3REJC 1P3FA 4J8XD 4QLCD 3WAAB 3MGSB 3WA9A 3AZKD 2HIOC 5B31C 5GT3D 1P3IB 5JA4B 4XUJB 3AZHB 3AZNB 3AZMC 1R4VA 3V9RB 2NQBA 1M1AB 3LZ1C 5B40C 5B32A 3UTAD 3X1TC 3MGPC 3B6FB 4H9SA 4H9PB 1HTAA 3AZGD 5AVCD 5AV9D 5B0ZB 5CPKA 3LELA 4JJNB 1TAFA 4XZQD 5B24C 3RELC 5B1LC 3VH6W 4ZUXD 1M19C 2NZDA 5AVBA 5DNND 1P3FC 4G92B 3UTBD 5B33B 2BYKB 2F8NA 1P3LD 3X1SB 3WA9C 3AZFA 5B0YA 4G91C 1P3GA 1N1JA 3O62C 5BNVA 5CPJA 5AY8B 5JRGA 1KX4D 1P34B 2NQBC 1ULYA 5DNMB 5CPIB 1F66C 5B32C 2CV5D 5GT0D 5AV6B 5B2ID 4H9SC 3AYWC 1BH9A 1KX3C 5CPKC 4WV4B 3LELC 4CAYB 4J8VD 3AZLD 4R8PA 3W98B 3AV2A 5B1MD 5F99B 4Z5TB 3KXBD 3R45B 4WU8D 1U35D 4NE5A 2NZDC 3KSYA 5AVBC 4YS3A 3MVDA 1P3BB 1KX5C 5BNXA 1ZLAA 4DRAA 3REIB 4KGCA 3MGRB 1P3AA 5CPJC 4E45A 5JRGC 3C1BB 1HQ3B 1TZYB 1AOIB 3AZJD 4J8UD 5BT1D 3AFAA 3AV1D 1P3OA 1ID3B 3TU4C 4KUDD 3WAAA 3MGSA 4X23D 1P3KD 3W99C 3B6GD 1P3IA 5JA4A 4XUJA 3AZHA 3AZNA 3V9RA 3REJD 3AZEC 1M1AA 3KUYC 3MVDC 5B31D 2HUEC 4NE3A 3B6FA 4KGCC 4H9PA 3WTPB 5B31G 1P3AC 5B0ZA 4J8XB 5C3IB 2F8NH 3AZMD 3KWQD 3AZKB 2YFVB 4JJNA 2IO5B 4NFTA 5B40D 4WU9B 3REHC 5GT3B 3REKC 2PYOC 1P3OC 4Z66B 5B33A 1P3MC 2BYKA 3MGQD 3MGSC 3X1SA 3AN2C 5AV5D 3X1UD 1P3IC 5FUGB 4XUJC 5B1LD 3AZHC 5KDMB 1H3OB 5AVCB 1P34A 1M19D 5B2JC 1JFIA 1P3FD 1M1AC 5DNMA 5CPIA 4J8WB 3WA9D 4XZQB 5AV6A 3VH5T 3VH5A 3B6FC 3O62D 4WNNB 5DNNB 5B0ZC 3MNND 3UTBB 4H9OB 4CAYA 2NQBD 1F66D 3W98A 5F99A 5B32D 4Z5TA 3R45A 5B32G 3NQJB 3AYWD 5B33C 3X1SC 1KX3D 1BH8B 5CPKD 3LELD 5AV8D 1P3BA 2CV5B 3REIA 5CP6C 5B2IB 3MGRA 3C1BA 2AROC 1P34C 1HQ3A 4J8VB 1TZYA 1AOIA 3AZLB 5GXQA 1KX5D 2RVQC 5B1MB 1ID3A 2F8NG 1F1EA 4WU8B 3KXBB 3A6NC 1U35B 5CPJD 5JRGD 1EQZC 4Z5TC 3TU4D 3AZIB 1B6WA 5GSUB 1P3BC 3AZJB 3W99D 4J8UB 1M18D 3REIC 3WTPA 3AV1B 3WKJD 3MGRC 4KUDB 4J8XA 3X1VB 4DRBA 3C1BC 4X23B 1HQ3C 3AZED 2YFVA 4WU9A 2FJ7D 1AOIC 3B6GB 5GT3A 3KUYD 5GXQC 1ID3C 4Z66A 4KGCD 1Q9CA 3UT9A 4HGAC 1WWSA 4Z2MH 4H9NB 5B31B 3REHD 5FUGA 2PYOD 3REKD 4YM6D 5KDMA 1H3OA 5AVCA 3B0CW 3WTPE 3KWQB 1S32B 1P3MD 4J8WA 3MGSD 3AZFC 3AN2D 5B40B 5B0YC 3C1CA 1P3GC 3B0CT 4WNNA 4XUJD 5DNNA 4J8XC 3NQUB 3LJAA 5C3IC 3UTBA 3MGQB 4H9OA 5B2JD 5AV5B 1M1AD 2IO5C 4WU9C 3X1UB 5E5AD 5GT3C 1P3PD 3B6FD 3NQJA 4Z66C 5B0ZD 3UT9C 3W96D 3W97B 1BH8A 4LD9B 2CV5A 4R8PC 3AV2C 5B2IA 4EO5C 4AWLB 3O62B 5AVCC 5BO0B 3LZ0B 3MNNB 4YS3C 1B67A 4J8VA 5B33D 4J8WC 2HIOD 3X1SD 3AZLA 1F66B 1ZLAC 3C1CC 5B1MA 5B32B 4WU8A 3KXBA 1U35A 5CP6D 2JSSA 4QLCB 3AYWB 3LJAC 3UTBC 2AROD 3B0BA 1KX3B 3LZ1D 5CPKB 3LELB 5AV8B 3X1TD 3AFAC 3MGPD 2RVQD 3A6ND 4Z2MG 3WAAC 3AZIA 5GSUA 3UTAB 1KU5A 3AZJA 4J8UA 2CV5C 3AV1A 5B24D 1KX5B 3RELD 3AZNC 5AY8A 3VH5W 3AZGB 1EQZD 4KUDA 4Z5TD 5AV9B 3X1VA 5CPJB 4X23A 4KHAB 4J8VC 5BS7A 4ZUXB 3KXBC 1U35C 3TU4B 1P3LB 3C1BD 4JJNC 4H9NA 5B31A 3W99B 1M18B 5GXQD 3WKJB 1KX4B 4G92C 3AZIC 3KWQA 1S32A 3AZEB 5GSUC 5B40A 2FJ7B 3AZJC 3KUYB 4H9RB 5GT0B 5BT1C 3AV1C 1BFMA 5AY8C 3NQUA 3X1VC 1WWIA 2NZDD 3MGQA 5AVBD 5DNMC 5CPIC 5AV5A 4M6BA 2F8ND 3X1UA 4H9QB 3AZFD 5B0YD 5AV6C 2BYMB 3REHB 1P3GD 2PYOB 3REKB 4YM6B 2L5AA 3W97A 1P3MB 4LD9A 3AN2B 3W98C 5F99C 4WU9D 3O62A 5BO0A 3LZ0A 3MNNA 4Z66D 5G49B 5B2JB 3KWQC 1S32C 3UT9D 4CSRB 1F66A 5E5AB 4R8PD 3AV2D 3B0DB 1P3PB 4QLCA 3AYWA 3MGQC 3AZKA 3W96B 1KX3A 4YS3D 1TZYC 5AV5C 1P3KB 5AV8A 3X1UC 4J8WD 3MVDD 1ZLAD 3C1CD 1P3AD 4ZBJB 3REJB 3LJAD 3UTAA 3W97C 2HIOB 4LD9C 1KX5A 3VH6A 3VH6T 4AWLC 3AFAD 3AZGA 1P3OD 5CP6B 5AV9A 3LZ0C 3MNNC 3AZMB 3WAAD 2AROB 4KHAA 1JFIB 4XZQA 3LZ1B 3X1TB 3WTPC 4ZUXA 3MGPB 1P3ID 3AZHD 3TU4A 3AZND 4QLCC 3A6NB 1P3LA 2YFWB 3AZKC 4UUZB 5AV8C 3W99A 1M18A 5B24B 3RELB 5B1LB 3WKJA 1EQZB 1KX4A 1M19B 1P3FB 3AZEA 3UTAC 2FJ7A 3WA9B 3KUYA 4JJND 4H9RA 5CHLB 5GT0A 4G91B 3AZGC 5AV9C 3AZID 2NQBB 4XZQC
chains in the Genus database with same CATH superfamily
4E44A 4H9QA 5GSUD 2BYMA 3REHA 2PYOA 3REKA 4YM6A 5GXQB 4ZUXC 1A7WA 5DNNC 5AY8D 1P34D 3X1VD 1P3LC 1P3MA 3AN2A 5DNMD 5CPID 4HGAB 1M18C 1TAFB 5AV6D 4WZSB 3WKJC 1KX4C 5G49A 2NZDB 5AVBB 5B2JA 4CSRA 2F8NB 2FJ7C 5E5AA 3AZFB 5GT0C 5B0YB 3W98D 5B2IC 1P3GB 5F99D 1N1JB 1P3PA 5BNVB 5JRGB 3W96A 1P3KA 3B6GA 3AZLC 1S32D 1P3BD 5B1MC 3REID 4WU8C 4YM6C 3MGRD 3REJA 1BH9B 2LY8A 1HQ3D 3UT9B 2HIOA 3KFUG 1TZYD 3EPLA 1AOID 2JE5A 4R8PB 4NE6A 3AV2B 1ID3D 5CP6A 2CWEA 4EO5B 2F8NK 3AZMA 2AROA 3LZ1A 4YS3B 3EPKA 3W97D 4J8UC 3X1TA 5E5AC 3MVDB 4LD9D 1ZLAB 2HUEB 5BNXB 3MGPA 3C1CB 3B0DC 4KGCB 4KUDC 1P3PC 3AL0C 1P3AB 3A6NA 4X23C 3LZ0D 2YFWA 3W96C 3LJAB 4UUZA 1P3KC 3B6GC 5B24A 3RELA 5B1LA 5BS7C 1P3OB 3WTPD 3AFAB 1EQZA 1M19A 4ZBJC 3REJC 1P3FA 4J8XD 4QLCD 3WAAB 3MGSB 2XD5A 3WA9A 3AZKD 2HIOC 5B31C 5GT3D 1P3IB 5JA4B 4XUJB 3AZHB 3AZNB 3AZMC 1R4VA 3V9RB 2NQBA 1M1AB 2ZY5A 3LZ1C 5B40C 5B32A 3UTAD 3X1TC 3MGPC 3B6FB 4H9SA 4H9PB 1HTAA 3AZGD 5AVCD 5AV9D 5B0ZB 5CPKA 2G5HC 3LELA 4JJNB 1TAFA 4XZQD 5B24C 3RELC 5B1LC 3VH6W 4ZUXD 1M19C 2NZDA 5AVBA 5DNND 3EPJA 1P3FC 4G92B 3UTBD 5B33B 2BYKB 2F8NA 1P3LD 3X1SB 3WA9C 3P5JB 3AZFA 5B0YA 4G91C 1P3GA 1N1JA 3O62C 1T3UA 5BNVA 5CPJA 5AY8B 5JRGA 1KX4D 1P34B 2NQBC 1ULYA 5DNMB 5CPIB 1F66C 5B32C 2CV5D 3IP4C 5GT0D 5AV6B 5B2ID 4H9SC 3AYWC 1BH9A 2W8SA 1KX3C 5CPKC 4WV4B 3LELC 4CAYB 4J8VD 3A1KA 3AZLD 4R8PA 3W98B 3AV2A 5B1MD 5F99B 4Z5TB 2Y2HA 3KXBD 3R45B 4WU8D 1U35D 4NE5A 2NZDC 3KSYA 5AVBC 4YS3A 3MVDA 1P3BB 1KX5C 5BNXA 1ZLAA 4DRAA 3REIB 4KGCA 3MGRB 1P3AA 5CPJC 2Y2MA 4E45A 5JRGC 3C1BB 2XD1A 1HQ3B 2UWXA 1TZYB 1AOIB 3AZJD 4J8UD 5BT1D 3AFAA 3AV1D 1P3OA 1ID3B 3TU4C 4KUDD 2J8PA 3WAAA 3MGSA 4X23D 1P3KD 3W99C 3B6GD 1P3IA 5JA4A 4XUJA 3AZHA 3AZNA 4UPKA 3V9RA 3REJD 3AZEC 1M1AA 3KUYC 2Y2GA 3MVDC 5B31D 2HUEC 4NE3A 3B6FA 2DF4C 4H9PA 3WTPB 5B31G 4KGCC 1P3AC 5B0ZA 4J8XB 5C3IB 2F8NH 3AZMD 3KWQD 3AZKB 2YFVB 4JJNA 2IO5B 4NFTA 5B40D 4WU9B 3REHC 5GT3B 3REKC 2PYOC 1P3OC 4Z66B 5B33A 1P3MC 2BYKA 3MGQD 3MGSC 3X1SA 3AN2C 5AV5D 3X1UD 1P3IC 5FUGB 4XUJC 5B1LD 3AZHC 5KDMB 1H3OB 5AVCB 1P34A 1M19D 5B2JC 1JFIA 1P3FD 1PZRA 3H0RC 5DNMA 5CPIA 1M1AC 4J8WB 3WA9D 4XZQB 5AV6A 3VH5T 3VH5A 3B6FC 2Y2OA 3O62D 4WNNB 5DNNB 5B0ZC 3MNND 3UTBB 4H9OB 4CAYA 2NQBD 1F66D 3W98A 5F99A 5B32D 4Z5TA 3R45A 5B32G 3NQJB 3AYWD 5B33C 3X1SC 1KX3D 1BH8B 5CPKD 3LELD 5AV8D 1P3BA 2CV5B 3REIA 5CP6C 5B2IB 3MGRA 3C1BA 2AROC 1P34C 1HQ3A 4J8VB 1TZYA 1AOIA 3AZLB 5GXQA 2VQRA 2RVQC 5B1MB 1KX5D 1ID3A 2F8NG 1F1EA 4WU8B 3KXBB 3A6NC 1U35B 2JCHA 5CPJD 5JRGD 1EQZC 4Z5TC 2Y2JA 3TU4D 3AZIB 3EG5B 1B6WA 5GSUB 1P3BC 3AZJB 3W99D 4J8UB 1M18D 3REIC 3WTPA 3AV1B 2Y2KA 3WKJD 3MGRC 4KUDB 4J8XA 3X1VB 4DRBA 2Y2PA 3C1BC 4X23B 1HQ3C 3AZED 2YFVA 4WU9A 2FJ7D 1AOIC 3B6GB 5GT3A 3KUYD 5GXQC 2F2AC 1ID3C 4Z66A 4KGCD 1Q9CA 3H0LC 3UT9A 3H0MC 4HGAC 2ZY3A 1WWSA 4Z2MH 4H9NB 5B31B 3REHD 5FUGA 2PYOD 3REKD 4YM6D 5KDMA 1H3OA 5AVCA 3B0CW 3WTPE 3KWQB 1S32B 1P3MD 4J8WA 3MGSD 3AZFC 3AN2D 5B40B 5B0YC 3C1CA 1P3GC 3B0CT 4WNNA 4XUJD 5DNNA 4J8XC 3NQUB 3LJAA 5C3IC 3UTBA 3MGQB 4H9OA 5B2JD 5AV5B 1M1AD 2IO5C 4WU9C 3X1UB 5E5AD 5GT3C 1P3PD 3B6FD 3NQJA 4Z66C 5B0ZD 3UT9C 3W96D 3W97B 1BH8A 4LD9B 2CV5A 4R8PC 3AV2C 5B2IA 4EO5C 4AWLB 3O62B 5AVCC 5BO0B 3LZ0B 3MNNB 4YS3C 1B67A 4J8VA 5B33D 4J8WC 2HIOD 3X1SD 3AZLA 1F66B 1ZLAC 3C1CC 4WJ3C 5B1MA 5B32B 4WU8A 3KXBA 1U35A 5CP6D 2JSSA 4QLCB 3AYWB 2DQNC 2ZY2A 3LJAC 3UTBC 2AROD 3B0BA 1KX3B 3LZ1D 2ZY4A 5CPKB 3LELB 5AV8B 3X1TD 3AFAC 3MGPD 2RVQD 3A6ND 4Z2MG 3WAAC 3AZIA 5GSUA 3UTAB 1KU5A 3AZJA 4J8UA 2CV5C 3AV1A 5B24D 1KX5B 3RELD 3AZNC 5AY8A 1W2EA 3VH5W 3AZGB 1EQZD 4Z5TD 5AV9B 4KUDA 3X1VA 5CPJB 4X23A 4KHAB 4J8VC 4DQYB 5BS7A 4ZUXB 3KXBC 1U35C 3TU4B 1P3LB 2G5IC 3C1BD 4JJNC 4H9NA 5B31A 3W99B 1M18B 5GXQD 3WKJB 1KX4B 4G92C 3AZIC 3KWQA 1S32A 3AZEB 5GSUC 5B40A 2FJ7B 3AZJC 2Y2IA 3KUYB 4H9RB 5GT0B 5BT1C 2Y2QA 3AV1C 1BFMA 5AY8C 3NQUA 2RIQA 3X1VC 1WWIA 2NZDD 3MGQA 5AVBD 5DNMC 5CPIC 5AV5A 4M6BA 2F8ND 3X1UA 1Z2CB 4H9QB 3AZFD 5B0YD 5AV6C 2BYMB 3REHB 1P3GD 2PYOB 3REKB 4YM6B 2L5AA 3W97A 1P3MB 4LD9A 3AN2B 3W98C 5F99C 4WU9D 3O62A 5BO0A 3LZ0A 3MNNA 4Z66D 5G49B 5B2JB 3KWQC 1S32C 3UT9D 4CSRB 1F66A 5E5AB 4R8PD 3AV2D 2ZM5A 3B0DB 1P3PB 4QLCA 3AYWA 3MGQC 3AZKA 3W96B 1KX3A 4YS3D 1TZYC 5AV5C 1P3KB 5AV8A 3F6TA 3X1UC 4J8WD 3MVDD 1ZLAD 3C1CD 1P3AD 4ZBJB 3REJB 3LJAD 3A1IA 3UTAA 3W97C 2HIOB 4LD9C 3EPHA 1KX5A 3VH6A 3VH6T 4AWLC 3AFAD 3AZGA 1P3OD 5CP6B 5AV9A 3LZ0C 3MNNC 3AZMB 2FFFB 2AROB 4KHAA 3WAAD 1JFIB 4XZQA 3LZ1B 3X1TB 3WTPC 4ZUXA 3MGPB 1P3ID 3AZHD 3TU4A 3AZND 4QLCC 3A6NB 1P3LA 2YFWB 3AZKC 4UUZB 5AV8C 3W99A 1M18A 5B24B 3RELB 5B1LB 3WKJA 2BG1A 1EQZB 3FDDA 1KX4A 2Y2LA 1M19B 1P3FB 3AZEA 3UTAC 2FJ7A 3WA9B 3KUYA 4JJND 4H9RA 5CHLB 5GT0A 4G91B 2Y2NA 3AZGC 5AV9C 3AZID 2NQBB 4XZQC
chains in the Genus database with same CATH topology
4E44A 4H9QA 5GSUD 2BYMA 3REHA 2PYOA 3REKA 4YM6A 5GXQB 4ZUXC 1A7WA 5DNNC 5AY8D 1P34D 3X1VD 1P3LC 1P3MA 3AN2A 5DNMD 5CPID 4HGAB 1M18C 1TAFB 5AV6D 4WZSB 3WKJC 1KX4C 5G49A 2NZDB 5AVBB 5B2JA 4CSRA 2F8NB 2FJ7C 5E5AA 3AZFB 5GT0C 5B0YB 3W98D 5B2IC 1P3GB 5F99D 1N1JB 1P3PA 5BNVB 5JRGB 3W96A 1P3KA 3B6GA 3AZLC 1S32D 1P3BD 5B1MC 3REID 4WU8C 4YM6C 3MGRD 3REJA 1BH9B 2LY8A 1HQ3D 3UT9B 2HIOA 3KFUG 1TZYD 3EPLA 1AOID 2JE5A 4R8PB 4NE6A 3AV2B 1ID3D 5CP6A 2CWEA 4EO5B 2F8NK 3AZMA 2AROA 3LZ1A 4YS3B 3EPKA 3W97D 4J8UC 3X1TA 5E5AC 3MVDB 4LD9D 1ZLAB 2HUEB 5BNXB 3MGPA 3C1CB 3B0DC 4KGCB 4KUDC 1P3PC 3AL0C 1P3AB 3A6NA 4X23C 3LZ0D 2YFWA 3W96C 3LJAB 4UUZA 1P3KC 3B6GC 5B24A 3RELA 5B1LA 5BS7C 1P3OB 3WTPD 3AFAB 1EQZA 1M19A 4ZBJC 3REJC 1P3FA 4J8XD 4QLCD 3WAAB 3MGSB 2XD5A 3WA9A 3AZKD 2HIOC 5B31C 5GT3D 1P3IB 5JA4B 4XUJB 3AZHB 3AZNB 3AZMC 1R4VA 3V9RB 2NQBA 1M1AB 2ZY5A 3LZ1C 5B40C 5B32A 3UTAD 3X1TC 3MGPC 3B6FB 4H9SA 4H9PB 1HTAA 3AZGD 5AVCD 5AV9D 5B0ZB 5CPKA 2G5HC 3LELA 4JJNB 1TAFA 4XZQD 5B24C 3RELC 5B1LC 3VH6W 4ZUXD 1M19C 2NZDA 5AVBA 5DNND 3EPJA 1P3FC 4G92B 3UTBD 5B33B 2BYKB 2F8NA 1P3LD 3X1SB 3WA9C 3P5JB 3AZFA 5B0YA 4G91C 1P3GA 1N1JA 3O62C 1T3UA 5BNVA 5CPJA 5AY8B 5JRGA 1KX4D 1P34B 2NQBC 1ULYA 5DNMB 5CPIB 1F66C 5B32C 2CV5D 3IP4C 5GT0D 5AV6B 5B2ID 4H9SC 3AYWC 1BH9A 2W8SA 1KX3C 5CPKC 4WV4B 3LELC 4CAYB 4J8VD 3A1KA 3AZLD 4R8PA 3W98B 3AV2A 5B1MD 5F99B 4Z5TB 2Y2HA 3KXBD 3R45B 4WU8D 1U35D 4NE5A 2NZDC 3KSYA 5AVBC 4YS3A 3MVDA 1P3BB 1KX5C 5BNXA 1ZLAA 4DRAA 3REIB 4KGCA 3MGRB 1P3AA 5CPJC 2Y2MA 4E45A 5JRGC 3C1BB 2XD1A 1HQ3B 2UWXA 1TZYB 1AOIB 3AZJD 4J8UD 5BT1D 3AFAA 3AV1D 1P3OA 1ID3B 3TU4C 4KUDD 2J8PA 3WAAA 3MGSA 4X23D 1P3KD 3W99C 3B6GD 1P3IA 5JA4A 4XUJA 3AZHA 3AZNA 4UPKA 3V9RA 3REJD 3AZEC 1M1AA 3KUYC 2Y2GA 3MVDC 5B31D 2HUEC 4NE3A 3B6FA 2DF4C 4H9PA 3WTPB 5B31G 4KGCC 1P3AC 5B0ZA 4J8XB 5C3IB 2F8NH 3AZMD 3KWQD 3AZKB 2YFVB 4JJNA 2IO5B 4NFTA 5B40D 4WU9B 3REHC 5GT3B 3REKC 2PYOC 1P3OC 4Z66B 5B33A 1P3MC 2BYKA 3MGQD 3MGSC 3X1SA 3AN2C 5AV5D 3X1UD 1P3IC 5FUGB 4XUJC 5B1LD 3AZHC 5KDMB 1H3OB 5AVCB 1P34A 1M19D 5B2JC 1JFIA 1P3FD 1PZRA 3H0RC 5DNMA 5CPIA 1M1AC 4J8WB 3WA9D 4XZQB 5AV6A 3VH5T 3VH5A 3B6FC 2Y2OA 3O62D 4WNNB 5DNNB 5B0ZC 3MNND 3UTBB 4H9OB 4CAYA 2NQBD 1F66D 3W98A 5F99A 5B32D 4Z5TA 3R45A 5B32G 3NQJB 3AYWD 5B33C 3X1SC 1KX3D 1BH8B 5CPKD 3LELD 5AV8D 1P3BA 2CV5B 3REIA 5CP6C 5B2IB 3MGRA 3C1BA 2AROC 1P34C 1HQ3A 4J8VB 1TZYA 1AOIA 3AZLB 5GXQA 2VQRA 2RVQC 5B1MB 1KX5D 1ID3A 2F8NG 1F1EA 4WU8B 3KXBB 3A6NC 1U35B 2JCHA 5CPJD 5JRGD 1EQZC 4Z5TC 2Y2JA 3TU4D 3AZIB 3EG5B 1B6WA 5GSUB 1P3BC 3AZJB 3W99D 4J8UB 1M18D 3REIC 3WTPA 3AV1B 2Y2KA 3WKJD 3MGRC 4KUDB 4J8XA 3X1VB 4DRBA 2Y2PA 3C1BC 4X23B 1HQ3C 3AZED 2YFVA 4WU9A 2FJ7D 1AOIC 3B6GB 5GT3A 3KUYD 5GXQC 2F2AC 1ID3C 4Z66A 4KGCD 1Q9CA 3H0LC 3UT9A 3H0MC 4HGAC 2ZY3A 1WWSA 4Z2MH 4H9NB 5B31B 3REHD 5FUGA 2PYOD 3REKD 4YM6D 5KDMA 1H3OA 5AVCA 3B0CW 3WTPE 3KWQB 1S32B 1P3MD 4J8WA 3MGSD 3AZFC 3AN2D 5B40B 5B0YC 3C1CA 1P3GC 3B0CT 4WNNA 4XUJD 5DNNA 4J8XC 3NQUB 3LJAA 5C3IC 3UTBA 3MGQB 4H9OA 5B2JD 5AV5B 1M1AD 2IO5C 4WU9C 3X1UB 5E5AD 5GT3C 1P3PD 3B6FD 3NQJA 4Z66C 5B0ZD 3UT9C 3W96D 3W97B 1BH8A 4LD9B 2CV5A 4R8PC 3AV2C 5B2IA 4EO5C 4AWLB 3O62B 5AVCC 5BO0B 3LZ0B 3MNNB 4YS3C 1B67A 4J8VA 5B33D 4J8WC 2HIOD 3X1SD 3AZLA 1F66B 1ZLAC 3C1CC 4WJ3C 5B1MA 5B32B 4WU8A 3KXBA 1U35A 5CP6D 2JSSA 4QLCB 3AYWB 2DQNC 2ZY2A 3LJAC 3UTBC 2AROD 3B0BA 1KX3B 3LZ1D 2ZY4A 5CPKB 3LELB 5AV8B 3X1TD 3AFAC 3MGPD 2RVQD 3A6ND 4Z2MG 3WAAC 3AZIA 5GSUA 3UTAB 1KU5A 3AZJA 4J8UA 2CV5C 3AV1A 5B24D 1KX5B 3RELD 3AZNC 5AY8A 1W2EA 3VH5W 3AZGB 1EQZD 4Z5TD 5AV9B 4KUDA 3X1VA 5CPJB 4X23A 4KHAB 4J8VC 4DQYB 5BS7A 4ZUXB 3KXBC 1U35C 3TU4B 1P3LB 2G5IC 3C1BD 4JJNC 4H9NA 5B31A 3W99B 1M18B 5GXQD 3WKJB 1KX4B 4G92C 3AZIC 3KWQA 1S32A 3AZEB 5GSUC 5B40A 2FJ7B 3AZJC 2Y2IA 3KUYB 4H9RB 5GT0B 5BT1C 2Y2QA 3AV1C 1BFMA 5AY8C 3NQUA 2RIQA 3X1VC 1WWIA 2NZDD 3MGQA 5AVBD 5DNMC 5CPIC 5AV5A 4M6BA 2F8ND 3X1UA 1Z2CB 4H9QB 3AZFD 5B0YD 5AV6C 2BYMB 3REHB 1P3GD 2PYOB 3REKB 4YM6B 2L5AA 3W97A 1P3MB 4LD9A 3AN2B 3W98C 5F99C 4WU9D 3O62A 5BO0A 3LZ0A 3MNNA 4Z66D 5G49B 5B2JB 3KWQC 1S32C 3UT9D 4CSRB 1F66A 5E5AB 4R8PD 3AV2D 2ZM5A 3B0DB 1P3PB 4QLCA 3AYWA 3MGQC 3AZKA 3W96B 1KX3A 4YS3D 1TZYC 5AV5C 1P3KB 5AV8A 3F6TA 3X1UC 4J8WD 3MVDD 1ZLAD 3C1CD 1P3AD 4ZBJB 3REJB 3LJAD 3A1IA 3UTAA 3W97C 2HIOB 4LD9C 3EPHA 1KX5A 3VH6A 3VH6T 4AWLC 3AFAD 3AZGA 1P3OD 5CP6B 5AV9A 3LZ0C 3MNNC 3AZMB 2FFFB 2AROB 4KHAA 3WAAD 1JFIB 4XZQA 3LZ1B 3X1TB 3WTPC 4ZUXA 3MGPB 1P3ID 3AZHD 3TU4A 3AZND 4QLCC 3A6NB 1P3LA 2YFWB 3AZKC 4UUZB 5AV8C 3W99A 1M18A 5B24B 3RELB 5B1LB 3WKJA 2BG1A 1EQZB 3FDDA 1KX4A 2Y2LA 1M19B 1P3FB 3AZEA 3UTAC 2FJ7A 3WA9B 3KUYA 4JJND 4H9RA 5CHLB 5GT0A 4G91B 2Y2NA 3AZGC 5AV9C 3AZID 2NQBB 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E44 A;  4H9Q A;  5GSU D;  2BYM A;  3REH A;  2PYO A;  3REK A;  4YM6 A;  5GXQ B;  4ZUX C;  1A7W A;  5DNN C;  5AY8 D;  1P34 D;  3X1V D;  1P3L C;  1P3M A;  3AN2 A;  5DNM D;  5CPI D;  4HGA B;  1M18 C;  1TAF B;  5AV6 D;  4WZS B;  3WKJ C;  1KX4 C;  5G49 A;  2NZD B;  5AVB B;  5B2J A;  4CSR A;  2F8N B;  2FJ7 C;  5E5A A;  3AZF B;  5GT0 C;  5B0Y B;  3W98 D;  5B2I C;  1P3G B;  5F99 D;  1N1J B;  1P3P A;  5BNV B;  5JRG B;  3W96 A;  1P3K A;  3B6G A;  3AZL C;  1S32 D;  1P3B D;  5B1M C;  3REI D;  4WU8 C;  4YM6 C;  3MGR D;  3REJ A;  1BH9 B;  2LY8 A;  1HQ3 D;  3UT9 B;  2HIO A;  1TZY D;  1AOI D;  4R8P B;  4NE6 A;  3AV2 B;  1ID3 D;  5CP6 A;  2CWE A;  4EO5 B;  2F8N K;  3AZM A;  2ARO A;  3LZ1 A;  4YS3 B;  3W97 D;  4J8U C;  3X1T A;  5E5A C;  3MVD B;  4LD9 D;  1ZLA B;  2HUE B;  5BNX B;  3MGP A;  3C1C B;  3B0D C;  4KGC B;  4KUD C;  1P3P C;  1P3A B;  3A6N A;  4X23 C;  3LZ0 D;  2YFW A;  3W96 C;  3LJA B;  4UUZ A;  1P3K C;  3B6G C;  5B24 A;  3REL A;  5B1L A;  5BS7 C;  1P3O B;  3WTP D;  3AFA B;  1EQZ A;  1M19 A;  4ZBJ C;  3REJ C;  1P3F A;  4J8X D;  4QLC D;  3WAA B;  3MGS B;  3WA9 A;  3AZK D;  2HIO C;  5B31 C;  5GT3 D;  1P3I B;  5JA4 B;  4XUJ B;  3AZH B;  3AZN B;  3AZM C;  1R4V A;  3V9R B;  2NQB A;  1M1A B;  3LZ1 C;  5B40 C;  5B32 A;  3UTA D;  3X1T C;  3MGP C;  3B6F B;  4H9S A;  4H9P B;  1HTA A;  3AZG D;  5AVC D;  5AV9 D;  5B0Z B;  5CPK A;  3LEL A;  4JJN B;  1TAF A;  4XZQ D;  5B24 C;  3REL C;  5B1L C;  3VH6 W;  4ZUX D;  1M19 C;  2NZD A;  5AVB A;  5DNN D;  1P3F C;  4G92 B;  3UTB D;  5B33 B;  2BYK B;  2F8N A;  1P3L D;  3X1S B;  3WA9 C;  3AZF A;  5B0Y A;  4G91 C;  1P3G A;  1N1J A;  3O62 C;  5BNV A;  5CPJ A;  5AY8 B;  5JRG A;  1KX4 D;  1P34 B;  2NQB C;  1ULY A;  5DNM B;  5CPI B;  1F66 C;  5B32 C;  2CV5 D;  5GT0 D;  5AV6 B;  5B2I D;  4H9S C;  3AYW C;  1BH9 A;  1KX3 C;  5CPK C;  4WV4 B;  3LEL C;  4CAY B;  4J8V D;  3AZL D;  4R8P A;  3W98 B;  3AV2 A;  5B1M D;  5F99 B;  4Z5T B;  3KXB D;  3R45 B;  4WU8 D;  1U35 D;  4NE5 A;  2NZD C;  3KSY A;  5AVB C;  4YS3 A;  3MVD A;  1P3B B;  1KX5 C;  5BNX A;  1ZLA A;  4DRA A;  3REI B;  4KGC A;  3MGR B;  1P3A A;  5CPJ C;  4E45 A;  5JRG C;  3C1B B;  1HQ3 B;  1TZY B;  1AOI B;  3AZJ D;  4J8U D;  5BT1 D;  3AFA A;  3AV1 D;  1P3O A;  1ID3 B;  3TU4 C;  4KUD D;  3WAA A;  3MGS A;  4X23 D;  1P3K D;  3W99 C;  3B6G D;  1P3I A;  5JA4 A;  4XUJ A;  3AZH A;  3AZN A;  3V9R A;  3REJ D;  3AZE C;  1M1A A;  3KUY C;  3MVD C;  5B31 D;  2HUE C;  4NE3 A;  3B6F A;  4KGC C;  4H9P A;  3WTP B;  5B31 G;  1P3A C;  5B0Z A;  4J8X B;  5C3I B;  2F8N H;  3AZM D;  3KWQ D;  3AZK B;  2YFV B;  4JJN A;  2IO5 B;  4NFT A;  5B40 D;  4WU9 B;  3REH C;  5GT3 B;  3REK C;  2PYO C;  1P3O C;  4Z66 B;  5B33 A;  1P3M C;  2BYK A;  3MGQ D;  3MGS C;  3X1S A;  3AN2 C;  5AV5 D;  3X1U D;  1P3I C;  5FUG B;  4XUJ C;  5B1L D;  3AZH C;  5KDM B;  1H3O B;  5AVC B;  1P34 A;  1M19 D;  5B2J C;  1JFI A;  1P3F D;  1M1A C;  5DNM A;  5CPI A;  4J8W B;  3WA9 D;  4XZQ B;  5AV6 A;  3VH5 T;  3VH5 A;  3B6F C;  3O62 D;  4WNN B;  5DNN B;  5B0Z C;  3MNN D;  3UTB B;  4H9O B;  4CAY A;  2NQB D;  1F66 D;  3W98 A;  5F99 A;  5B32 D;  4Z5T A;  3R45 A;  5B32 G;  3NQJ B;  3AYW D;  5B33 C;  3X1S C;  1KX3 D;  1BH8 B;  5CPK D;  3LEL D;  5AV8 D;  1P3B A;  2CV5 B;  3REI A;  5CP6 C;  5B2I B;  3MGR A;  3C1B A;  2ARO C;  1P34 C;  1HQ3 A;  4J8V B;  1TZY A;  1AOI A;  3AZL B;  5GXQ A;  1KX5 D;  2RVQ C;  5B1M B;  1ID3 A;  2F8N G;  1F1E A;  4WU8 B;  3KXB B;  3A6N C;  1U35 B;  5CPJ D;  5JRG D;  1EQZ C;  4Z5T C;  3TU4 D;  3AZI B;  1B6W A;  5GSU B;  1P3B C;  3AZJ B;  3W99 D;  4J8U B;  1M18 D;  3REI C;  3WTP A;  3AV1 B;  3WKJ D;  3MGR C;  4KUD B;  4J8X A;  3X1V B;  4DRB A;  3C1B C;  4X23 B;  1HQ3 C;  3AZE D;  2YFV A;  4WU9 A;  2FJ7 D;  1AOI C;  3B6G B;  5GT3 A;  3KUY D;  5GXQ C;  1ID3 C;  4Z66 A;  4KGC D;  1Q9C A;  3UT9 A;  4HGA C;  1WWS A;  4Z2M H;  4H9N B;  5B31 B;  3REH D;  5FUG A;  2PYO D;  3REK D;  4YM6 D;  5KDM A;  1H3O A;  5AVC A;  3B0C W;  3WTP E;  3KWQ B;  1S32 B;  1P3M D;  4J8W A;  3MGS D;  3AZF C;  3AN2 D;  5B40 B;  5B0Y C;  3C1C A;  1P3G C;  3B0C T;  4WNN A;  4XUJ D;  5DNN A;  4J8X C;  3NQU B;  3LJA A;  5C3I C;  3UTB A;  3MGQ B;  4H9O A;  5B2J D;  5AV5 B;  1M1A D;  2IO5 C;  4WU9 C;  3X1U B;  5E5A D;  5GT3 C;  1P3P D;  3B6F D;  3NQJ A;  4Z66 C;  5B0Z D;  3UT9 C;  3W96 D;  3W97 B;  1BH8 A;  4LD9 B;  2CV5 A;  4R8P C;  3AV2 C;  5B2I A;  4EO5 C;  4AWL B;  3O62 B;  5AVC C;  5BO0 B;  3LZ0 B;  3MNN B;  4YS3 C;  1B67 A;  4J8V A;  5B33 D;  4J8W C;  2HIO D;  3X1S D;  3AZL A;  1F66 B;  1ZLA C;  3C1C C;  5B1M A;  5B32 B;  4WU8 A;  3KXB A;  1U35 A;  5CP6 D;  2JSS A;  4QLC B;  3AYW B;  3LJA C;  3UTB C;  2ARO D;  3B0B A;  1KX3 B;  3LZ1 D;  5CPK B;  3LEL B;  5AV8 B;  3X1T D;  3AFA C;  3MGP D;  2RVQ D;  3A6N D;  4Z2M G;  3WAA C;  3AZI A;  5GSU A;  3UTA B;  1KU5 A;  3AZJ A;  4J8U A;  2CV5 C;  3AV1 A;  5B24 D;  1KX5 B;  3REL D;  3AZN C;  5AY8 A;  3VH5 W;  3AZG B;  1EQZ D;  4KUD A;  4Z5T D;  5AV9 B;  3X1V A;  5CPJ B;  4X23 A;  4KHA B;  4J8V C;  5BS7 A;  4ZUX B;  3KXB C;  1U35 C;  3TU4 B;  1P3L B;  3C1B D;  4JJN C;  4H9N A;  5B31 A;  3W99 B;  1M18 B;  5GXQ D;  3WKJ B;  1KX4 B;  4G92 C;  3AZI C;  3KWQ A;  1S32 A;  3AZE B;  5GSU C;  5B40 A;  2FJ7 B;  3AZJ C;  3KUY B;  4H9R B;  5GT0 B;  5BT1 C;  3AV1 C;  1BFM A;  5AY8 C;  3NQU A;  3X1V C;  1WWI A;  2NZD D;  3MGQ A;  5AVB D;  5DNM C;  5CPI C;  5AV5 A;  4M6B A;  2F8N D;  3X1U A;  4H9Q B;  3AZF D;  5B0Y D;  5AV6 C;  2BYM B;  3REH B;  1P3G D;  2PYO B;  3REK B;  4YM6 B;  2L5A A;  3W97 A;  1P3M B;  4LD9 A;  3AN2 B;  3W98 C;  5F99 C;  4WU9 D;  3O62 A;  5BO0 A;  3LZ0 A;  3MNN A;  4Z66 D;  5G49 B;  5B2J B;  3KWQ C;  1S32 C;  3UT9 D;  4CSR B;  1F66 A;  5E5A B;  4R8P D;  3AV2 D;  3B0D B;  1P3P B;  4QLC A;  3AYW A;  3MGQ C;  3AZK A;  3W96 B;  1KX3 A;  4YS3 D;  1TZY C;  5AV5 C;  1P3K B;  5AV8 A;  3X1U C;  4J8W D;  3MVD D;  1ZLA D;  3C1C D;  1P3A D;  4ZBJ B;  3REJ B;  3LJA D;  3UTA A;  3W97 C;  2HIO B;  4LD9 C;  1KX5 A;  3VH6 A;  3VH6 T;  4AWL C;  3AFA D;  3AZG A;  1P3O D;  5CP6 B;  5AV9 A;  3LZ0 C;  3MNN C;  3AZM B;  3WAA D;  2ARO B;  4KHA A;  1JFI B;  4XZQ A;  3LZ1 B;  3X1T B;  3WTP C;  4ZUX A;  3MGP B;  1P3I D;  3AZH D;  3TU4 A;  3AZN D;  4QLC C;  3A6N B;  1P3L A;  2YFW B;  3AZK C;  4UUZ B;  5AV8 C;  3W99 A;  1M18 A;  5B24 B;  3REL B;  5B1L B;  3WKJ A;  1EQZ B;  1KX4 A;  1M19 B;  1P3F B;  3AZE A;  3UTA C;  2FJ7 A;  3WA9 B;  3KUY A;  4JJN D;  4H9R A;  5CHL B;  5GT0 A;  4G91 B;  3AZG C;  5AV9 C;  3AZI D;  2NQB B;  4XZQ C; 
#chains in the Genus database with same CATH topology
 4E44 A;  4H9Q A;  5GSU D;  2BYM A;  3REH A;  2PYO A;  3REK A;  4YM6 A;  5GXQ B;  4ZUX C;  1A7W A;  5DNN C;  5AY8 D;  1P34 D;  3X1V D;  1P3L C;  1P3M A;  3AN2 A;  5DNM D;  5CPI D;  4HGA B;  1M18 C;  1TAF B;  5AV6 D;  4WZS B;  3WKJ C;  1KX4 C;  5G49 A;  2NZD B;  5AVB B;  5B2J A;  4CSR A;  2F8N B;  2FJ7 C;  5E5A A;  3AZF B;  5GT0 C;  5B0Y B;  3W98 D;  5B2I C;  1P3G B;  5F99 D;  1N1J B;  1P3P A;  5BNV B;  5JRG B;  3W96 A;  1P3K A;  3B6G A;  3AZL C;  1S32 D;  1P3B D;  5B1M C;  3REI D;  4WU8 C;  4YM6 C;  3MGR D;  3REJ A;  1BH9 B;  2LY8 A;  1HQ3 D;  3UT9 B;  2HIO A;  3KFU G;  1TZY D;  3EPL A;  1AOI D;  2JE5 A;  4R8P B;  4NE6 A;  3AV2 B;  1ID3 D;  5CP6 A;  2CWE A;  4EO5 B;  2F8N K;  3AZM A;  2ARO A;  3LZ1 A;  4YS3 B;  3EPK A;  3W97 D;  4J8U C;  3X1T A;  5E5A C;  3MVD B;  4LD9 D;  1ZLA B;  2HUE B;  5BNX B;  3MGP A;  3C1C B;  3B0D C;  4KGC B;  4KUD C;  1P3P C;  3AL0 C;  1P3A B;  3A6N A;  4X23 C;  3LZ0 D;  2YFW A;  3W96 C;  3LJA B;  4UUZ A;  1P3K C;  3B6G C;  5B24 A;  3REL A;  5B1L A;  5BS7 C;  1P3O B;  3WTP D;  3AFA B;  1EQZ A;  1M19 A;  4ZBJ C;  3REJ C;  1P3F A;  4J8X D;  4QLC D;  3WAA B;  3MGS B;  2XD5 A;  3WA9 A;  3AZK D;  2HIO C;  5B31 C;  5GT3 D;  1P3I B;  5JA4 B;  4XUJ B;  3AZH B;  3AZN B;  3AZM C;  1R4V A;  3V9R B;  2NQB A;  1M1A B;  2ZY5 A;  3LZ1 C;  5B40 C;  5B32 A;  3UTA D;  3X1T C;  3MGP C;  3B6F B;  4H9S A;  4H9P B;  1HTA A;  3AZG D;  5AVC D;  5AV9 D;  5B0Z B;  5CPK A;  2G5H C;  3LEL A;  4JJN B;  1TAF A;  4XZQ D;  5B24 C;  3REL C;  5B1L C;  3VH6 W;  4ZUX D;  1M19 C;  2NZD A;  5AVB A;  5DNN D;  3EPJ A;  1P3F C;  4G92 B;  3UTB D;  5B33 B;  2BYK B;  2F8N A;  1P3L D;  3X1S B;  3WA9 C;  3P5J B;  3AZF A;  5B0Y A;  4G91 C;  1P3G A;  1N1J A;  3O62 C;  1T3U A;  5BNV A;  5CPJ A;  5AY8 B;  5JRG A;  1KX4 D;  1P34 B;  2NQB C;  1ULY A;  5DNM B;  5CPI B;  1F66 C;  5B32 C;  2CV5 D;  3IP4 C;  5GT0 D;  5AV6 B;  5B2I D;  4H9S C;  3AYW C;  1BH9 A;  2W8S A;  1KX3 C;  5CPK C;  4WV4 B;  3LEL C;  4CAY B;  4J8V D;  3A1K A;  3AZL D;  4R8P A;  3W98 B;  3AV2 A;  5B1M D;  5F99 B;  4Z5T B;  2Y2H A;  3KXB D;  3R45 B;  4WU8 D;  1U35 D;  4NE5 A;  2NZD C;  3KSY A;  5AVB C;  4YS3 A;  3MVD A;  1P3B B;  1KX5 C;  5BNX A;  1ZLA A;  4DRA A;  3REI B;  4KGC A;  3MGR B;  1P3A A;  5CPJ C;  2Y2M A;  4E45 A;  5JRG C;  3C1B B;  2XD1 A;  1HQ3 B;  2UWX A;  1TZY B;  1AOI B;  3AZJ D;  4J8U D;  5BT1 D;  3AFA A;  3AV1 D;  1P3O A;  1ID3 B;  3TU4 C;  4KUD D;  2J8P A;  3WAA A;  3MGS A;  4X23 D;  1P3K D;  3W99 C;  3B6G D;  1P3I A;  5JA4 A;  4XUJ A;  3AZH A;  3AZN A;  4UPK A;  3V9R A;  3REJ D;  3AZE C;  1M1A A;  3KUY C;  2Y2G A;  3MVD C;  5B31 D;  2HUE C;  4NE3 A;  3B6F A;  2DF4 C;  4H9P A;  3WTP B;  5B31 G;  4KGC C;  1P3A C;  5B0Z A;  4J8X B;  5C3I B;  2F8N H;  3AZM D;  3KWQ D;  3AZK B;  2YFV B;  4JJN A;  2IO5 B;  4NFT A;  5B40 D;  4WU9 B;  3REH C;  5GT3 B;  3REK C;  2PYO C;  1P3O C;  4Z66 B;  5B33 A;  1P3M C;  2BYK A;  3MGQ D;  3MGS C;  3X1S A;  3AN2 C;  5AV5 D;  3X1U D;  1P3I C;  5FUG B;  4XUJ C;  5B1L D;  3AZH C;  5KDM B;  1H3O B;  5AVC B;  1P34 A;  1M19 D;  5B2J C;  1JFI A;  1P3F D;  1PZR A;  3H0R C;  5DNM A;  5CPI A;  1M1A C;  4J8W B;  3WA9 D;  4XZQ B;  5AV6 A;  3VH5 T;  3VH5 A;  3B6F C;  2Y2O A;  3O62 D;  4WNN B;  5DNN B;  5B0Z C;  3MNN D;  3UTB B;  4H9O B;  4CAY A;  2NQB D;  1F66 D;  3W98 A;  5F99 A;  5B32 D;  4Z5T A;  3R45 A;  5B32 G;  3NQJ B;  3AYW D;  5B33 C;  3X1S C;  1KX3 D;  1BH8 B;  5CPK D;  3LEL D;  5AV8 D;  1P3B A;  2CV5 B;  3REI A;  5CP6 C;  5B2I B;  3MGR A;  3C1B A;  2ARO C;  1P34 C;  1HQ3 A;  4J8V B;  1TZY A;  1AOI A;  3AZL B;  5GXQ A;  2VQR A;  2RVQ C;  5B1M B;  1KX5 D;  1ID3 A;  2F8N G;  1F1E A;  4WU8 B;  3KXB B;  3A6N C;  1U35 B;  2JCH A;  5CPJ D;  5JRG D;  1EQZ C;  4Z5T C;  2Y2J A;  3TU4 D;  3AZI B;  3EG5 B;  1B6W A;  5GSU B;  1P3B C;  3AZJ B;  3W99 D;  4J8U B;  1M18 D;  3REI C;  3WTP A;  3AV1 B;  2Y2K A;  3WKJ D;  3MGR C;  4KUD B;  4J8X A;  3X1V B;  4DRB A;  2Y2P A;  3C1B C;  4X23 B;  1HQ3 C;  3AZE D;  2YFV A;  4WU9 A;  2FJ7 D;  1AOI C;  3B6G B;  5GT3 A;  3KUY D;  5GXQ C;  2F2A C;  1ID3 C;  4Z66 A;  4KGC D;  1Q9C A;  3H0L C;  3UT9 A;  3H0M C;  4HGA C;  2ZY3 A;  1WWS A;  4Z2M H;  4H9N B;  5B31 B;  3REH D;  5FUG A;  2PYO D;  3REK D;  4YM6 D;  5KDM A;  1H3O A;  5AVC A;  3B0C W;  3WTP E;  3KWQ B;  1S32 B;  1P3M D;  4J8W A;  3MGS D;  3AZF C;  3AN2 D;  5B40 B;  5B0Y C;  3C1C A;  1P3G C;  3B0C T;  4WNN A;  4XUJ D;  5DNN A;  4J8X C;  3NQU B;  3LJA A;  5C3I C;  3UTB A;  3MGQ B;  4H9O A;  5B2J D;  5AV5 B;  1M1A D;  2IO5 C;  4WU9 C;  3X1U B;  5E5A D;  5GT3 C;  1P3P D;  3B6F D;  3NQJ A;  4Z66 C;  5B0Z D;  3UT9 C;  3W96 D;  3W97 B;  1BH8 A;  4LD9 B;  2CV5 A;  4R8P C;  3AV2 C;  5B2I A;  4EO5 C;  4AWL B;  3O62 B;  5AVC C;  5BO0 B;  3LZ0 B;  3MNN B;  4YS3 C;  1B67 A;  4J8V A;  5B33 D;  4J8W C;  2HIO D;  3X1S D;  3AZL A;  1F66 B;  1ZLA C;  3C1C C;  4WJ3 C;  5B1M A;  5B32 B;  4WU8 A;  3KXB A;  1U35 A;  5CP6 D;  2JSS A;  4QLC B;  3AYW B;  2DQN C;  2ZY2 A;  3LJA C;  3UTB C;  2ARO D;  3B0B A;  1KX3 B;  3LZ1 D;  2ZY4 A;  5CPK B;  3LEL B;  5AV8 B;  3X1T D;  3AFA C;  3MGP D;  2RVQ D;  3A6N D;  4Z2M G;  3WAA C;  3AZI A;  5GSU A;  3UTA B;  1KU5 A;  3AZJ A;  4J8U A;  2CV5 C;  3AV1 A;  5B24 D;  1KX5 B;  3REL D;  3AZN C;  5AY8 A;  1W2E A;  3VH5 W;  3AZG B;  1EQZ D;  4Z5T D;  5AV9 B;  4KUD A;  3X1V A;  5CPJ B;  4X23 A;  4KHA B;  4J8V C;  4DQY B;  5BS7 A;  4ZUX B;  3KXB C;  1U35 C;  3TU4 B;  1P3L B;  2G5I C;  3C1B D;  4JJN C;  4H9N A;  5B31 A;  3W99 B;  1M18 B;  5GXQ D;  3WKJ B;  1KX4 B;  4G92 C;  3AZI C;  3KWQ A;  1S32 A;  3AZE B;  5GSU C;  5B40 A;  2FJ7 B;  3AZJ C;  2Y2I A;  3KUY B;  4H9R B;  5GT0 B;  5BT1 C;  2Y2Q A;  3AV1 C;  1BFM A;  5AY8 C;  3NQU A;  2RIQ A;  3X1V C;  1WWI A;  2NZD D;  3MGQ A;  5AVB D;  5DNM C;  5CPI C;  5AV5 A;  4M6B A;  2F8N D;  3X1U A;  1Z2C B;  4H9Q B;  3AZF D;  5B0Y D;  5AV6 C;  2BYM B;  3REH B;  1P3G D;  2PYO B;  3REK B;  4YM6 B;  2L5A A;  3W97 A;  1P3M B;  4LD9 A;  3AN2 B;  3W98 C;  5F99 C;  4WU9 D;  3O62 A;  5BO0 A;  3LZ0 A;  3MNN A;  4Z66 D;  5G49 B;  5B2J B;  3KWQ C;  1S32 C;  3UT9 D;  4CSR B;  1F66 A;  5E5A B;  4R8P D;  3AV2 D;  2ZM5 A;  3B0D B;  1P3P B;  4QLC A;  3AYW A;  3MGQ C;  3AZK A;  3W96 B;  1KX3 A;  4YS3 D;  1TZY C;  5AV5 C;  1P3K B;  5AV8 A;  3F6T A;  3X1U C;  4J8W D;  3MVD D;  1ZLA D;  3C1C D;  1P3A D;  4ZBJ B;  3REJ B;  3LJA D;  3A1I A;  3UTA A;  3W97 C;  2HIO B;  4LD9 C;  3EPH A;  1KX5 A;  3VH6 A;  3VH6 T;  4AWL C;  3AFA D;  3AZG A;  1P3O D;  5CP6 B;  5AV9 A;  3LZ0 C;  3MNN C;  3AZM B;  2FFF B;  2ARO B;  4KHA A;  3WAA D;  1JFI B;  4XZQ A;  3LZ1 B;  3X1T B;  3WTP C;  4ZUX A;  3MGP B;  1P3I D;  3AZH D;  3TU4 A;  3AZN D;  4QLC C;  3A6N B;  1P3L A;  2YFW B;  3AZK C;  4UUZ B;  5AV8 C;  3W99 A;  1M18 A;  5B24 B;  3REL B;  5B1L B;  3WKJ A;  2BG1 A;  1EQZ B;  3FDD A;  1KX4 A;  2Y2L A;  1M19 B;  1P3F B;  3AZE A;  3UTA C;  2FJ7 A;  3WA9 B;  3KUY A;  4JJN D;  4H9R A;  5CHL B;  5GT0 A;  4G91 B;  2Y2N A;  3AZG C;  5AV9 C;  3AZI D;  2NQB B;  4XZQ C; 
#chains in the Genus database with same CATH homology
 4E44 A;  4H9Q A;  5GSU D;  2BYM A;  3REH A;  2PYO A;  3REK A;  4YM6 A;  5GXQ B;  4ZUX C;  1A7W A;  5DNN C;  5AY8 D;  1P34 D;  3X1V D;  1P3L C;  1P3M A;  3AN2 A;  5DNM D;  5CPI D;  4HGA B;  1M18 C;  1TAF B;  5AV6 D;  4WZS B;  3WKJ C;  1KX4 C;  5G49 A;  2NZD B;  5AVB B;  5B2J A;  4CSR A;  2F8N B;  2FJ7 C;  5E5A A;  3AZF B;  5GT0 C;  5B0Y B;  3W98 D;  5B2I C;  1P3G B;  5F99 D;  1N1J B;  1P3P A;  5BNV B;  5JRG B;  3W96 A;  1P3K A;  3B6G A;  3AZL C;  1S32 D;  1P3B D;  5B1M C;  3REI D;  4WU8 C;  4YM6 C;  3MGR D;  3REJ A;  1BH9 B;  2LY8 A;  1HQ3 D;  3UT9 B;  2HIO A;  3KFU G;  1TZY D;  3EPL A;  1AOI D;  2JE5 A;  4R8P B;  4NE6 A;  3AV2 B;  1ID3 D;  5CP6 A;  2CWE A;  4EO5 B;  2F8N K;  3AZM A;  2ARO A;  3LZ1 A;  4YS3 B;  3EPK A;  3W97 D;  4J8U C;  3X1T A;  5E5A C;  3MVD B;  4LD9 D;  1ZLA B;  2HUE B;  5BNX B;  3MGP A;  3C1C B;  3B0D C;  4KGC B;  4KUD C;  1P3P C;  3AL0 C;  1P3A B;  3A6N A;  4X23 C;  3LZ0 D;  2YFW A;  3W96 C;  3LJA B;  4UUZ A;  1P3K C;  3B6G C;  5B24 A;  3REL A;  5B1L A;  5BS7 C;  1P3O B;  3WTP D;  3AFA B;  1EQZ A;  1M19 A;  4ZBJ C;  3REJ C;  1P3F A;  4J8X D;  4QLC D;  3WAA B;  3MGS B;  2XD5 A;  3WA9 A;  3AZK D;  2HIO C;  5B31 C;  5GT3 D;  1P3I B;  5JA4 B;  4XUJ B;  3AZH B;  3AZN B;  3AZM C;  1R4V A;  3V9R B;  2NQB A;  1M1A B;  2ZY5 A;  3LZ1 C;  5B40 C;  5B32 A;  3UTA D;  3X1T C;  3MGP C;  3B6F B;  4H9S A;  4H9P B;  1HTA A;  3AZG D;  5AVC D;  5AV9 D;  5B0Z B;  5CPK A;  2G5H C;  3LEL A;  4JJN B;  1TAF A;  4XZQ D;  5B24 C;  3REL C;  5B1L C;  3VH6 W;  4ZUX D;  1M19 C;  2NZD A;  5AVB A;  5DNN D;  3EPJ A;  1P3F C;  4G92 B;  3UTB D;  5B33 B;  2BYK B;  2F8N A;  1P3L D;  3X1S B;  3WA9 C;  3P5J B;  3AZF A;  5B0Y A;  4G91 C;  1P3G A;  1N1J A;  3O62 C;  1T3U A;  5BNV A;  5CPJ A;  5AY8 B;  5JRG A;  1KX4 D;  1P34 B;  2NQB C;  1ULY A;  5DNM B;  5CPI B;  1F66 C;  5B32 C;  2CV5 D;  3IP4 C;  5GT0 D;  5AV6 B;  5B2I D;  4H9S C;  3AYW C;  1BH9 A;  2W8S A;  1KX3 C;  5CPK C;  4WV4 B;  3LEL C;  4CAY B;  4J8V D;  3A1K A;  3AZL D;  4R8P A;  3W98 B;  3AV2 A;  5B1M D;  5F99 B;  4Z5T B;  2Y2H A;  3KXB D;  3R45 B;  4WU8 D;  1U35 D;  4NE5 A;  2NZD C;  3KSY A;  5AVB C;  4YS3 A;  3MVD A;  1P3B B;  1KX5 C;  5BNX A;  1ZLA A;  4DRA A;  3REI B;  4KGC A;  3MGR B;  1P3A A;  5CPJ C;  2Y2M A;  4E45 A;  5JRG C;  3C1B B;  2XD1 A;  1HQ3 B;  2UWX A;  1TZY B;  1AOI B;  3AZJ D;  4J8U D;  5BT1 D;  3AFA A;  3AV1 D;  1P3O A;  1ID3 B;  3TU4 C;  4KUD D;  2J8P A;  3WAA A;  3MGS A;  4X23 D;  1P3K D;  3W99 C;  3B6G D;  1P3I A;  5JA4 A;  4XUJ A;  3AZH A;  3AZN A;  4UPK A;  3V9R A;  3REJ D;  3AZE C;  1M1A A;  3KUY C;  2Y2G A;  3MVD C;  5B31 D;  2HUE C;  4NE3 A;  3B6F A;  2DF4 C;  4H9P A;  3WTP B;  5B31 G;  4KGC C;  1P3A C;  5B0Z A;  4J8X B;  5C3I B;  2F8N H;  3AZM D;  3KWQ D;  3AZK B;  2YFV B;  4JJN A;  2IO5 B;  4NFT A;  5B40 D;  4WU9 B;  3REH C;  5GT3 B;  3REK C;  2PYO C;  1P3O C;  4Z66 B;  5B33 A;  1P3M C;  2BYK A;  3MGQ D;  3MGS C;  3X1S A;  3AN2 C;  5AV5 D;  3X1U D;  1P3I C;  5FUG B;  4XUJ C;  5B1L D;  3AZH C;  5KDM B;  1H3O B;  5AVC B;  1P34 A;  1M19 D;  5B2J C;  1JFI A;  1P3F D;  1PZR A;  3H0R C;  5DNM A;  5CPI A;  1M1A C;  4J8W B;  3WA9 D;  4XZQ B;  5AV6 A;  3VH5 T;  3VH5 A;  3B6F C;  2Y2O A;  3O62 D;  4WNN B;  5DNN B;  5B0Z C;  3MNN D;  3UTB B;  4H9O B;  4CAY A;  2NQB D;  1F66 D;  3W98 A;  5F99 A;  5B32 D;  4Z5T A;  3R45 A;  5B32 G;  3NQJ B;  3AYW D;  5B33 C;  3X1S C;  1KX3 D;  1BH8 B;  5CPK D;  3LEL D;  5AV8 D;  1P3B A;  2CV5 B;  3REI A;  5CP6 C;  5B2I B;  3MGR A;  3C1B A;  2ARO C;  1P34 C;  1HQ3 A;  4J8V B;  1TZY A;  1AOI A;  3AZL B;  5GXQ A;  2VQR A;  2RVQ C;  5B1M B;  1KX5 D;  1ID3 A;  2F8N G;  1F1E A;  4WU8 B;  3KXB B;  3A6N C;  1U35 B;  2JCH A;  5CPJ D;  5JRG D;  1EQZ C;  4Z5T C;  2Y2J A;  3TU4 D;  3AZI B;  3EG5 B;  1B6W A;  5GSU B;  1P3B C;  3AZJ B;  3W99 D;  4J8U B;  1M18 D;  3REI C;  3WTP A;  3AV1 B;  2Y2K A;  3WKJ D;  3MGR C;  4KUD B;  4J8X A;  3X1V B;  4DRB A;  2Y2P A;  3C1B C;  4X23 B;  1HQ3 C;  3AZE D;  2YFV A;  4WU9 A;  2FJ7 D;  1AOI C;  3B6G B;  5GT3 A;  3KUY D;  5GXQ C;  2F2A C;  1ID3 C;  4Z66 A;  4KGC D;  1Q9C A;  3H0L C;  3UT9 A;  3H0M C;  4HGA C;  2ZY3 A;  1WWS A;  4Z2M H;  4H9N B;  5B31 B;  3REH D;  5FUG A;  2PYO D;  3REK D;  4YM6 D;  5KDM A;  1H3O A;  5AVC A;  3B0C W;  3WTP E;  3KWQ B;  1S32 B;  1P3M D;  4J8W A;  3MGS D;  3AZF C;  3AN2 D;  5B40 B;  5B0Y C;  3C1C A;  1P3G C;  3B0C T;  4WNN A;  4XUJ D;  5DNN A;  4J8X C;  3NQU B;  3LJA A;  5C3I C;  3UTB A;  3MGQ B;  4H9O A;  5B2J D;  5AV5 B;  1M1A D;  2IO5 C;  4WU9 C;  3X1U B;  5E5A D;  5GT3 C;  1P3P D;  3B6F D;  3NQJ A;  4Z66 C;  5B0Z D;  3UT9 C;  3W96 D;  3W97 B;  1BH8 A;  4LD9 B;  2CV5 A;  4R8P C;  3AV2 C;  5B2I A;  4EO5 C;  4AWL B;  3O62 B;  5AVC C;  5BO0 B;  3LZ0 B;  3MNN B;  4YS3 C;  1B67 A;  4J8V A;  5B33 D;  4J8W C;  2HIO D;  3X1S D;  3AZL A;  1F66 B;  1ZLA C;  3C1C C;  4WJ3 C;  5B1M A;  5B32 B;  4WU8 A;  3KXB A;  1U35 A;  5CP6 D;  2JSS A;  4QLC B;  3AYW B;  2DQN C;  2ZY2 A;  3LJA C;  3UTB C;  2ARO D;  3B0B A;  1KX3 B;  3LZ1 D;  2ZY4 A;  5CPK B;  3LEL B;  5AV8 B;  3X1T D;  3AFA C;  3MGP D;  2RVQ D;  3A6N D;  4Z2M G;  3WAA C;  3AZI A;  5GSU A;  3UTA B;  1KU5 A;  3AZJ A;  4J8U A;  2CV5 C;  3AV1 A;  5B24 D;  1KX5 B;  3REL D;  3AZN C;  5AY8 A;  1W2E A;  3VH5 W;  3AZG B;  1EQZ D;  4Z5T D;  5AV9 B;  4KUD A;  3X1V A;  5CPJ B;  4X23 A;  4KHA B;  4J8V C;  4DQY B;  5BS7 A;  4ZUX B;  3KXB C;  1U35 C;  3TU4 B;  1P3L B;  2G5I C;  3C1B D;  4JJN C;  4H9N A;  5B31 A;  3W99 B;  1M18 B;  5GXQ D;  3WKJ B;  1KX4 B;  4G92 C;  3AZI C;  3KWQ A;  1S32 A;  3AZE B;  5GSU C;  5B40 A;  2FJ7 B;  3AZJ C;  2Y2I A;  3KUY B;  4H9R B;  5GT0 B;  5BT1 C;  2Y2Q A;  3AV1 C;  1BFM A;  5AY8 C;  3NQU A;  2RIQ A;  3X1V C;  1WWI A;  2NZD D;  3MGQ A;  5AVB D;  5DNM C;  5CPI C;  5AV5 A;  4M6B A;  2F8N D;  3X1U A;  1Z2C B;  4H9Q B;  3AZF D;  5B0Y D;  5AV6 C;  2BYM B;  3REH B;  1P3G D;  2PYO B;  3REK B;  4YM6 B;  2L5A A;  3W97 A;  1P3M B;  4LD9 A;  3AN2 B;  3W98 C;  5F99 C;  4WU9 D;  3O62 A;  5BO0 A;  3LZ0 A;  3MNN A;  4Z66 D;  5G49 B;  5B2J B;  3KWQ C;  1S32 C;  3UT9 D;  4CSR B;  1F66 A;  5E5A B;  4R8P D;  3AV2 D;  2ZM5 A;  3B0D B;  1P3P B;  4QLC A;  3AYW A;  3MGQ C;  3AZK A;  3W96 B;  1KX3 A;  4YS3 D;  1TZY C;  5AV5 C;  1P3K B;  5AV8 A;  3F6T A;  3X1U C;  4J8W D;  3MVD D;  1ZLA D;  3C1C D;  1P3A D;  4ZBJ B;  3REJ B;  3LJA D;  3A1I A;  3UTA A;  3W97 C;  2HIO B;  4LD9 C;  3EPH A;  1KX5 A;  3VH6 A;  3VH6 T;  4AWL C;  3AFA D;  3AZG A;  1P3O D;  5CP6 B;  5AV9 A;  3LZ0 C;  3MNN C;  3AZM B;  2FFF B;  2ARO B;  4KHA A;  3WAA D;  1JFI B;  4XZQ A;  3LZ1 B;  3X1T B;  3WTP C;  4ZUX A;  3MGP B;  1P3I D;  3AZH D;  3TU4 A;  3AZN D;  4QLC C;  3A6N B;  1P3L A;  2YFW B;  3AZK C;  4UUZ B;  5AV8 C;  3W99 A;  1M18 A;  5B24 B;  3REL B;  5B1L B;  3WKJ A;  2BG1 A;  1EQZ B;  3FDD A;  1KX4 A;  2Y2L A;  1M19 B;  1P3F B;  3AZE A;  3UTA C;  2FJ7 A;  3WA9 B;  3KUY A;  4JJN D;  4H9R A;  5CHL B;  5GT0 A;  4G91 B;  2Y2N A;  3AZG C;  5AV9 C;  3AZI D;  2NQB B;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...