3UTAB

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaB00
1KX4B 2CV5C 3MGRD 3AZIC 1TZYC 3MGPB 3X1VD 2FJ7D 4YM6A 5CHLB 4X23C 3LJAD 3REJB 1JFIA 3W99C 3AZFB 3AZJC 5GT0C 1M18A 2RVQD 3TU4D 1KX5C 2F8NK 3WA9A 3AZLD 1S32B 3AZIA 1KX3D 5BS7A 4X23B 1P3MA 5JRGC 4YM6C 1Q9CA 5KDMA 5GT0B 3LZ1B 1AOIC 4H9RB 4WU8B 1M19A 3AZFD 5BO0A 3MNND 3WA9C 3MGSC 3AN2D 1F66B 2LY8A 2RVQC 2BYKB 2YFVB 3MGRB 1P3BA 4CSRB 3REIC 1M19C 5B1MD 3VH6T 2NQBB 4KGCD 2HIOD 4XUJD 5JA4B 5B0YD 1M1AB 3X1TC 5B40A 3REIB 4YS3D 1HQ3D 3O62B 1P3GB 3LZ0D 3A6NC 1M1AA 2YFWA 5CPKB 4ZUXA 3B0BA 1EQZD 4WU9B 3W98C 1KU5A 5B32A 3REHA 5AV9A 3KUYD 3C1CA 5B32B 5B2IB 5E5AB 4UUZA 3MGQA 3B0DB 3W98A 1M19B 3X1UA 5E5AD 2AROB 5B2ID 4HGAC 1HQ3C 2F8NG 3VH5A 5G49B 3B0DC 3WAAA 4WU9D 3MGQC 1P3KB 5CPKD 1P3PD 5DNNA 3MVDB 5CPKC 4J8VD 3O62D 1P3GD 3REID 1F1EA 1P3FA 5AVBA 3KXBC 3AZGD 3LZ0A 1M1AD 4XUJB 2HIOB 5B0YB 3WKJC 4KUDC 5B1MB 3WTPB 2NQBD 4H9SA 4WU9A 4NE6A 4KGCA 1P3FC 5BNXB 5CPJB 4QLCD 3B6FA 3AN2B 1F66D 5GXQC 5B31C 3O62A 3UT9C 1P34A 1P3GA 2HUEC 3MNNB 5CPIA 1KX4C 5B1LC 3AZEA 4WU8D 3LZ1D 5BS7C 2BYMB 5GT0D 3W99D 5B0ZC 1BH8A 4X23D 3C1CB 4YS3C 2FJ7C 3AZLB 1S32D 1KX3B 1P34C 3TU4B 1KX4A 4Z5TD 4XUJC 3LJAB 3W97A 5DNMC 3REJD 2FJ7B 3X1VB 3MGPD 4YS3A 4NFTA 2IO5C 3LZ1C 5CP6C 1N1JA 5AVCC 5C3IB 2JSSA 1KX4D 4ZBJB 1EQZA 3WA9B 3A6NB 5F99B 1P3AD 4KHAB 2NZDC 4E44A 4XZQD 4J8VA 5CP6B 3RELB 4M6BA 1TAFA 3AZKD 2NQBC 4AWLB 3AYWC 3AZLC 1KX3C 1P34B 5CPID 1P3OA 3REHC 4JJND 3AZJD 3RELC 5B33B 3WKJA 3B0CT 3AV2C 3X1VC 5AY8B 1P3PC 3AZLA 1KX3A 5JRGA 3AZKA 1BH9A 5B31G 5GT3B 5AV5B 5FUGA 3UTAA 5E5AC 3AZMD 4WV4B 1U35D 4AWLC 3AYWB 4J8WB 2PYOD 4Z66B 3WKJB 3C1BD 3NQUA 1ID3D 3W97D 3UTAD 3MGQB 3W98D 3AV2B 4J8WC 3X1UD 5AV8A 5GXQB 5B31B 1HTAA 1P3LB 1U35A 3KXBB 1ZLAA 1H3OA 3WAAB 4J8WA 2NZDA 4R8PD 3LELD 3X1SD 5B2JB 1P3OB 4J8XA 1ULYA 5DNMD 3AZHA 4LD9C 3MVDC 5JA4A 3AN2C 3UT9B 3AV1A 3AZMA 1M18D 1AOIA 1A7WA 5JRGB 4XZQC 5AV6B 2NZDD 4H9OB 1KX5B 1P3AC 1AOIB 1WWSA 3REKD 1P3PA 4KUDB 5BNVA 3UTBB 5DNND 5B40D 5CPKA 3V9RB 5DNNC 5BO0B 3TU4C 3AZHD 3LJAA 4QLCC 1P3FD 1P3KA 5AV8D 3AZJA 3REJC 1M18C 5B1LB 1TZYD 1ZLAD 3AZID 2NQBA 4Z5TC 3C1BA 1ID3A 3A6NA 1M1AC 3W96A 3B6GB 3AZEB 5B0ZD 3O62C 5B31A 4YM6B 5GXQA 1P3GC 5B24A 4J8UC 2CV5A 4WU8C 3X1TB 3X1VA 1BFMA 3AV1D 3UTBC 2F8NA 4Z2MG 3MGSB 1F66C 1P3MB 2F8NB 5B2IC 3LELA 5AVCB 2HIOA 5B0YA 5B33C 5GSUB 5B24D 4DRAA 5AVBD 4WZSB 1P3MC 3W96B 4H9NA 5GSUC 5B32G 3AFAA 3AV1C 5F99A 2AROC 3B6FB 1TZYA 5G49A 5AV9B 4J8UD 1P3ID 3REKA 3AZNB 4E45A 3B6FD 1B67A 1P3AA 4H9PA 1P3IC 5AVBB 1ZLAC 4KGCC 4G92B 1P3OC 5GSUD 3RELA 4LD9B 2F8ND 4J8XC 1P3MD 3REHD 3AFAB 3KUYC 3WTPC 3MGSD 3WTPE 2YFVA 2YFWB 3AZKC 3MGPA 1P3BC 5AV9C 4J8XB 5B2JA 4YM6D 4H9PB 5B0ZB 3KWQD 4H9RA 4WU8A 3AZED 4H9QB 5E5AA 3UTBA 5B1MA 1P3BB 3AZIB 1TZYB 3MGPC 3LJAC 3LELC 2CV5B 1HQ3A 5AV8B 4ZUXB 4H9NB 3VH5T 1P3FB 5AV6C 3WAAC 3REJA 1JFIB 3AZHB 4ZUXD 2CV5D 3AZEC 5B40B 3AZFC 5BT1C 5GSUA 3REKB 3AZNA 1AOID 5F99C 4X23A 1P3BD 2NZDB 4WNNA 5JRGD 4ZBJC 1M18B 3KWQB 5B40C 3UT9D 4XUJA 4J8XD 4H9SC 4UUZB 1F66A 5AV5A 5GT3A 5DNMB 1P3OD 3X1SB 3LELB 3MVDA 3LZ1A 3AFAD 3REHB 3NQUB 3WAAD 4LD9D 3MGSA 3MGRC 3KXBD 4WNNB 3KUYA 5GT3C 5AV5C 3X1SC 4EO5B 4J8VC 5AY8C 3REIA 1TAFB 3VH6A 3X1UB 3AV2D 1R4VA 3MGQD 4WU9C 3W98B 3KWQC 4G91C 5BNVB 3C1BB 3AZND 1P3KC 1ID3B 4Z66D 1P3IB 2F8NH 5AV9D 4J8UB 5CPIC 5AY8A 1P3LA 4CAYA 4J8WD 3AYWD 2PYOB 4R8PA 3AZMB 3W96D 1WWIA 5B32C 5B0ZA 3W99A 5B24B 5GT0A 1P3LC 4KUDA 5AVCD 4H9OA 4EO5C 1KX5A 3AYWA 1S32A 5AY8D 1BH8B 3NQJA 4NE3A 4LD9A 5B2JC 3UT9A 3AV1B 2BYKA 3X1TD 3AZJB 1N1JB 3MNNA 5CPIB 1P34D 1S32C 3B6GD 5B1MC 3AZKB 5AV8C 3LZ0C 3RELD 3R45A 4XZQB 1H3OB 5AVBC 3KXBA 5B1LD 1ZLAB 3TU4A 5AV6A 3WA9D 2HUEB 3MNNC 3REKC 3X1TA 5DNMA 4DRBA 3B0CW 5CPJC 3AZFA 3B6GA 5CP6A 4JJNA 5DNNB 3UTBD 4KUDD 4ZUXC 1KX5D 3AN2A 5AV6D 4Z5TB 5B1LA 5BNXA 5CPJA 3C1CC 3C1CD 4XZQA 3B6GC 4R8PC 3WTPA 3W99B 2FJ7A 3V9RA 5FUGB 5C3IC 5B2JD 4R8PB 4CAYB 2PYOA 2CWEA 2IO5B 4QLCB 5CPJD 1B6WA 3AZHC 4KHAA 1P3LD 3WTPD 4G91B 2BYMA 4Z5TA 3C1BC 5GXQD 5B31D 1ID3C 2PYOC 3W96C 3AZGB 2AROA 1U35C 3UTAB 3W97B 4J8VB 3WKJD 3MVDD 1P3PB 3AZNC 1P3KD 3AZGC 1U35B 3KSYA 3VH5W 4QLCA 1P3IA 3B6FC 2HIOC 5B33A 4H9QA 5B0YC 3AV2A 2AROD 3VH6W 1M19D 4NE5A 5GT3D 5AV5D 3AZGA 4JJNC 5B32D 4G92C 3AFAC 3X1UC 3KUYB 5B24C 4J8UA 3UTAC 5B33D 3NQJB 4CSRA 3MGRA 3W97C 4JJNB 1EQZB 4Z66C 4Z2MH 3X1SA 4HGAB 3LZ0B 1HQ3B 4YS3B 5B2IA 1BH9B 3AZMC 5CP6D 5AVCA 1EQZC 3KWQA 5F99D 1P3AB 4KGCB 5KDMB 4Z66A 5BT1D 3A6ND 2L5AA 3R45B
chains in the Genus database with same CATH superfamily
1KX4B 3EPKA 2CV5C 3MGRD 3AZIC 1TZYC 3MGPB 3X1VD 2FJ7D 4YM6A 5CHLB 4X23C 3LJAD 3REJB 1JFIA 3W99C 3AZFB 3AZJC 5GT0C 1M18A 2RVQD 3TU4D 1KX5C 2F8NK 3WA9A 3AZLD 1S32B 3AZIA 1KX3D 5BS7A 4X23B 1P3MA 5JRGC 4YM6C 1Q9CA 2ZY4A 5KDMA 5GT0B 3LZ1B 1AOIC 4H9RB 4WU8B 1M19A 3AZFD 5BO0A 3MNND 3WA9C 3MGSC 3AN2D 1F66B 2LY8A 2RVQC 2BYKB 2YFVB 3MGRB 1P3BA 4CSRB 2ZM5A 3REIC 1M19C 5B1MD 3VH6T 2NQBB 4KGCD 2HIOD 4XUJD 5JA4B 5B0YD 1M1AB 3X1TC 5B40A 3REIB 4YS3D 1HQ3D 3O62B 1P3GB 3LZ0D 3A6NC 1M1AA 2YFWA 5CPKB 4ZUXA 3B0BA 1EQZD 4WU9B 3W98C 1KU5A 5B32A 3REHA 3EPHA 5AV9A 2DQNC 3KUYD 3C1CA 5B32B 5B2IB 5E5AB 4UUZA 3MGQA 3B0DB 3W98A 1M19B 3X1UA 5E5AD 2AROB 5B2ID 2Y2JA 4HGAC 2JE5A 2J8PA 1HQ3C 2F8NG 3VH5A 5G49B 3B0DC 3WAAA 4WU9D 3MGQC 1P3KB 5CPKD 1P3PD 5DNNA 3MVDB 5CPKC 2ZY5A 4J8VD 3O62D 1P3GD 3REID 1F1EA 1P3FA 5AVBA 3KXBC 3AZGD 3LZ0A 1M1AD 4XUJB 2HIOB 5B0YB 3H0RC 3WKJC 4KUDC 5B1MB 3WTPB 2NQBD 4H9SA 4WU9A 4NE6A 4KGCA 1P3FC 5BNXB 5CPJB 4QLCD 3B6FA 3AN2B 1F66D 5GXQC 2G5IC 5B31C 3O62A 3UT9C 1P34A 2HUEC 3MNNB 5CPIA 1P3GA 1KX4C 5B1LC 3AZEA 4WU8D 3LZ1D 5BS7C 2BYMB 5GT0D 3W99D 5B0ZC 1BH8A 4X23D 3C1CB 4YS3C 2FJ7C 3AZLB 1S32D 1KX3B 1P34C 3TU4B 1KX4A 4Z5TD 4XUJC 3LJAB 3W97A 5DNMC 3REJD 2FJ7B 3X1VB 2Y2PA 3MGPD 4YS3A 4NFTA 2IO5C 3LZ1C 5CP6C 1N1JA 5AVCC 5C3IB 2JSSA 1KX4D 4ZBJB 1EQZA 3WA9B 3A6NB 5F99B 1P3AD 4KHAB 2NZDC 4E44A 4XZQD 4J8VA 5CP6B 3RELB 4M6BA 1TAFA 3AZKD 3KFUG 2NQBC 4AWLB 3AYWC 3AZLC 1KX3C 1P34B 5CPID 1P3OA 3REHC 4JJND 3AZJD 3RELC 5B33B 2Y2KA 3WKJA 3B0CT 3AV2C 3X1VC 2ZY2A 5AY8B 1P3PC 3AZLA 1KX3A 5JRGA 3AZKA 1BH9A 5B31G 5GT3B 5AV5B 5FUGA 3UTAA 5E5AC 1W2EA 3AZMD 4WV4B 3AL0C 1U35D 4AWLC 3AYWB 4J8WB 2PYOD 4Z66B 3WKJB 3C1BD 3NQUA 1ID3D 3W97D 3A6ND 3UTAD 3MGQB 3W98D 3AV2B 4J8WC 3X1UD 5AV8A 5GXQB 5B31B 1HTAA 1P3LB 1U35A 3H0LC 3KXBB 2VQRA 1ZLAA 1H3OA 3WAAB 4J8WA 2NZDA 4R8PD 3LELD 3X1SD 5B2JB 1P3OB 4J8XA 1ULYA 5DNMD 2XD5A 3AZHA 4LD9C 4WJ3C 3MVDC 5JA4A 3AN2C 3UT9B 3AV1A 3AZMA 1M18D 1AOIA 1A7WA 5JRGB 4XZQC 2XD1A 5AV6B 2NZDD 4H9OB 1KX5B 1P3AC 1AOIB 1WWSA 3REKD 1P3PA 4KUDB 5BNVA 3UTBB 5DNND 5B40D 5CPKA 3V9RB 5DNNC 5BO0B 3TU4C 3AZHD 3LJAA 4QLCC 1P3FD 1P3KA 5AV8D 3AZJA 3REJC 1M18C 5B1LB 1TZYD 1ZLAD 3AZID 2UWXA 2NQBA 4Z5TC 3C1BA 1ID3A 3A1IA 3A6NA 1M1AC 3W96A 3B6GB 3AZEB 5B0ZD 5B31A 4YM6B 5GXQA 3O62C 1P3GC 5B24A 4J8UC 2CV5A 4WU8C 3X1TB 3X1VA 1BFMA 3AV1D 3UTBC 2F8NA 4Z2MG 3MGSB 1F66C 3P5JB 2Y2IA 1P3MB 2Y2HA 2F8NB 5B2IC 2Y2LA 3LELA 5AVCB 2HIOA 5B0YA 5B33C 5GSUB 5B24D 4DRAA 5AVBD 4WZSB 1P3MC 4UPKA 3W96B 4H9NA 5GSUC 5B32G 3AFAA 3AV1C 5F99A 2AROC 3B6FB 1TZYA 5G49A 5AV9B 4J8UD 1P3ID 3REKA 3AZNB 4E45A 3B6FD 1B67A 1P3AA 4H9PA 1P3IC 5AVBB 1ZLAC 4KGCC 4G92B 1P3OC 5GSUD 3RELA 4LD9B 2F8ND 2Y2QA 4J8XC 1P3MD 3REHD 3AFAB 3KUYC 3WTPC 3MGSD 3WTPE 2YFVA 2YFWB 3AZKC 3MGPA 1P3BC 5AV9C 4J8XB 5B2JA 4YM6D 4H9PB 5B0ZB 3KWQD 4H9RA 4WU8A 3AZED 4H9QB 5E5AA 3UTBA 2Y2NA 5B1MA 1P3BB 3AZIB 1TZYB 3MGPC 2G5HC 3LJAC 3LELC 2CV5B 1HQ3A 5AV8B 4ZUXB 4H9NB 3VH5T 1P3FB 5AV6C 3WAAC 3REJA 1JFIB 3AZHB 4ZUXD 2CV5D 3AZEC 5B40B 3AZFC 5BT1C 5GSUA 3REKB 3AZNA 1AOID 5F99C 4X23A 4DQYB 1P3BD 2NZDB 4WNNA 5JRGD 4ZBJC 1M18B 3KWQB 5B40C 2ZY3A 3UT9D 4XUJA 4J8XD 4H9SC 4UUZB 3F6TA 2W8SA 1F66A 5AV5A 2BG1A 5GT3A 5DNMB 1P3OD 3X1SB 3LELB 3A1KA 3LZ1A 3MVDA 3AFAD 3REHB 3NQUB 3WAAD 4LD9D 3MGSA 3MGRC 3KXBD 4WNNB 3KUYA 5GT3C 5AV5C 3X1SC 4EO5B 4J8VC 5AY8C 3REIA 2Y2OA 3H0MC 1TAFB 3VH6A 3X1UB 3AV2D 1R4VA 3MGQD 4WU9C 3W98B 3KWQC 4G91C 5BNVB 3C1BB 3AZND 1P3KC 1ID3B 4Z66D 1P3IB 2F8NH 5AV9D 4J8UB 5CPIC 5AY8A 1P3LA 4CAYA 4J8WD 3AYWD 2PYOB 2RIQA 4R8PA 3AZMB 3W96D 1WWIA 5B32C 5B0ZA 3W99A 5B24B 5GT0A 1P3LC 4KUDA 5AVCD 4H9OA 4EO5C 1KX5A 3AYWA 1S32A 2DF4C 5AY8D 1BH8B 3NQJA 4NE3A 2FFFB 4LD9A 5B2JC 3UT9A 3AV1B 2BYKA 3X1TD 3AZJB 1N1JB 2JCHA 3MNNA 5CPIB 1P34D 3EPLA 1S32C 3B6GD 5B1MC 3AZKB 5AV8C 3RELD 3R45A 4XZQB 1H3OB 5AVBC 3KXBA 5B1LD 1ZLAB 3TU4A 5AV6A 3FDDA 3WA9D 2HUEB 3MNNC 3REKC 3X1TA 5DNMA 4DRBA 3B0CW 5CPJC 3AZFA 3B6GA 5CP6A 4JJNA 5DNNB 3EG5B 3UTBD 4KUDD 4ZUXC 1KX5D 3AN2A 5AV6D 4Z5TB 5B1LA 5BNXA 5CPJA 1Z2CB 3C1CC 3C1CD 4XZQA 3B6GC 4R8PC 3WTPA 3W99B 2FJ7A 3V9RA 5FUGB 5C3IC 5B2JD 4R8PB 4CAYB 2PYOA 2CWEA 2IO5B 4QLCB 5CPJD 1B6WA 3AZHC 4KHAA 1P3LD 3WTPD 4G91B 2BYMA 3IP4C 4Z5TA 5GXQD 5B31D 2F2AC 3C1BC 1ID3C 2PYOC 3W96C 3AZGB 2AROA 1U35C 3UTAB 1T3UA 3W97B 4J8VB 3WKJD 3MVDD 1P3PB 1PZRA 3AZNC 1P3KD 3AZGC 1U35B 3KSYA 3VH5W 4QLCA 1P3IA 3B6FC 2HIOC 5B33A 4H9QA 5B0YC 3AV2A 2Y2MA 2AROD 3VH6W 1M19D 4NE5A 5GT3D 5AV5D 3AZGA 4JJNC 5B32D 4G92C 3AFAC 3X1UC 3KUYB 5B24C 4J8UA 3UTAC 3EPJA 5B33D 3NQJB 4CSRA 3MGRA 3W97C 4JJNB 2Y2GA 1EQZB 4Z2MH 4Z66C 3X1SA 4HGAB 3LZ0B 1HQ3B 4YS3B 5B2IA 1BH9B 3AZMC 5CP6D 5AVCA 1EQZC 3KWQA 5F99D 1P3AB 4KGCB 5KDMB 4Z66A 5BT1D 3LZ0C 2L5AA 3R45B
chains in the Genus database with same CATH topology
1KX4B 3EPKA 2CV5C 3MGRD 3AZIC 1TZYC 3MGPB 3X1VD 2FJ7D 4YM6A 5CHLB 4X23C 3LJAD 3REJB 1JFIA 3W99C 3AZFB 3AZJC 5GT0C 1M18A 2RVQD 3TU4D 1KX5C 2F8NK 3WA9A 3AZLD 1S32B 3AZIA 1KX3D 5BS7A 4X23B 1P3MA 5JRGC 4YM6C 1Q9CA 2ZY4A 5KDMA 5GT0B 3LZ1B 1AOIC 4H9RB 4WU8B 1M19A 3AZFD 5BO0A 3MNND 3WA9C 3MGSC 3AN2D 1F66B 2LY8A 2RVQC 2BYKB 2YFVB 3MGRB 1P3BA 4CSRB 2ZM5A 3REIC 1M19C 5B1MD 3VH6T 2NQBB 4KGCD 2HIOD 4XUJD 5JA4B 5B0YD 1M1AB 3X1TC 5B40A 3REIB 4YS3D 1HQ3D 3O62B 1P3GB 3LZ0D 3A6NC 1M1AA 2YFWA 5CPKB 4ZUXA 3B0BA 1EQZD 4WU9B 3W98C 1KU5A 5B32A 3REHA 3EPHA 5AV9A 2DQNC 3KUYD 3C1CA 5B32B 5B2IB 5E5AB 4UUZA 3MGQA 3B0DB 3W98A 1M19B 3X1UA 5E5AD 2AROB 5B2ID 2Y2JA 4HGAC 2JE5A 2J8PA 1HQ3C 2F8NG 3VH5A 5G49B 3B0DC 3WAAA 4WU9D 3MGQC 1P3KB 5CPKD 1P3PD 5DNNA 3MVDB 5CPKC 2ZY5A 4J8VD 3O62D 1P3GD 3REID 1F1EA 1P3FA 5AVBA 3KXBC 3AZGD 3LZ0A 1M1AD 4XUJB 2HIOB 5B0YB 3H0RC 3WKJC 4KUDC 5B1MB 3WTPB 2NQBD 4H9SA 4WU9A 4NE6A 4KGCA 1P3FC 5BNXB 5CPJB 4QLCD 3B6FA 3AN2B 1F66D 5GXQC 2G5IC 5B31C 3O62A 3UT9C 1P34A 2HUEC 3MNNB 5CPIA 1P3GA 1KX4C 5B1LC 3AZEA 4WU8D 3LZ1D 5BS7C 2BYMB 5GT0D 3W99D 5B0ZC 1BH8A 4X23D 3C1CB 4YS3C 2FJ7C 3AZLB 1S32D 1KX3B 1P34C 3TU4B 1KX4A 4Z5TD 4XUJC 3LJAB 3W97A 5DNMC 3REJD 2FJ7B 3X1VB 2Y2PA 3MGPD 4YS3A 4NFTA 2IO5C 3LZ1C 5CP6C 1N1JA 5AVCC 5C3IB 2JSSA 1KX4D 4ZBJB 1EQZA 3WA9B 3A6NB 5F99B 1P3AD 4KHAB 2NZDC 4E44A 4XZQD 4J8VA 5CP6B 3RELB 4M6BA 1TAFA 3AZKD 3KFUG 2NQBC 4AWLB 3AYWC 3AZLC 1KX3C 1P34B 5CPID 1P3OA 3REHC 4JJND 3AZJD 3RELC 5B33B 2Y2KA 3WKJA 3B0CT 3AV2C 3X1VC 2ZY2A 5AY8B 1P3PC 3AZLA 1KX3A 5JRGA 3AZKA 1BH9A 5B31G 5GT3B 5AV5B 5FUGA 3UTAA 5E5AC 1W2EA 3AZMD 4WV4B 3AL0C 1U35D 4AWLC 3AYWB 4J8WB 2PYOD 4Z66B 3WKJB 3C1BD 3NQUA 1ID3D 3W97D 3A6ND 3UTAD 3MGQB 3W98D 3AV2B 4J8WC 3X1UD 5AV8A 5GXQB 5B31B 1HTAA 1P3LB 1U35A 3H0LC 3KXBB 2VQRA 1ZLAA 1H3OA 3WAAB 4J8WA 2NZDA 4R8PD 3LELD 3X1SD 5B2JB 1P3OB 4J8XA 1ULYA 5DNMD 2XD5A 3AZHA 4LD9C 4WJ3C 3MVDC 5JA4A 3AN2C 3UT9B 3AV1A 3AZMA 1M18D 1AOIA 1A7WA 5JRGB 4XZQC 2XD1A 5AV6B 2NZDD 4H9OB 1KX5B 1P3AC 1AOIB 1WWSA 3REKD 1P3PA 4KUDB 5BNVA 3UTBB 5DNND 5B40D 5CPKA 3V9RB 5DNNC 5BO0B 3TU4C 3AZHD 3LJAA 4QLCC 1P3FD 1P3KA 5AV8D 3AZJA 3REJC 1M18C 5B1LB 1TZYD 1ZLAD 3AZID 2UWXA 2NQBA 4Z5TC 3C1BA 1ID3A 3A1IA 3A6NA 1M1AC 3W96A 3B6GB 3AZEB 5B0ZD 5B31A 4YM6B 5GXQA 3O62C 1P3GC 5B24A 4J8UC 2CV5A 4WU8C 3X1TB 3X1VA 1BFMA 3AV1D 3UTBC 2F8NA 4Z2MG 3MGSB 1F66C 3P5JB 2Y2IA 1P3MB 2Y2HA 2F8NB 5B2IC 2Y2LA 3LELA 5AVCB 2HIOA 5B0YA 5B33C 5GSUB 5B24D 4DRAA 5AVBD 4WZSB 1P3MC 4UPKA 3W96B 4H9NA 5GSUC 5B32G 3AFAA 3AV1C 5F99A 2AROC 3B6FB 1TZYA 5G49A 5AV9B 4J8UD 1P3ID 3REKA 3AZNB 4E45A 3B6FD 1B67A 1P3AA 4H9PA 1P3IC 5AVBB 1ZLAC 4KGCC 4G92B 1P3OC 5GSUD 3RELA 4LD9B 2F8ND 2Y2QA 4J8XC 1P3MD 3REHD 3AFAB 3KUYC 3WTPC 3MGSD 3WTPE 2YFVA 2YFWB 3AZKC 3MGPA 1P3BC 5AV9C 4J8XB 5B2JA 4YM6D 4H9PB 5B0ZB 3KWQD 4H9RA 4WU8A 3AZED 4H9QB 5E5AA 3UTBA 2Y2NA 5B1MA 1P3BB 3AZIB 1TZYB 3MGPC 2G5HC 3LJAC 3LELC 2CV5B 1HQ3A 5AV8B 4ZUXB 4H9NB 3VH5T 1P3FB 5AV6C 3WAAC 3REJA 1JFIB 3AZHB 4ZUXD 2CV5D 3AZEC 5B40B 3AZFC 5BT1C 5GSUA 3REKB 3AZNA 1AOID 5F99C 4X23A 4DQYB 1P3BD 2NZDB 4WNNA 5JRGD 4ZBJC 1M18B 3KWQB 5B40C 2ZY3A 3UT9D 4XUJA 4J8XD 4H9SC 4UUZB 3F6TA 2W8SA 1F66A 5AV5A 2BG1A 5GT3A 5DNMB 1P3OD 3X1SB 3LELB 3A1KA 3LZ1A 3MVDA 3AFAD 3REHB 3NQUB 3WAAD 4LD9D 3MGSA 3MGRC 3KXBD 4WNNB 3KUYA 5GT3C 5AV5C 3X1SC 4EO5B 4J8VC 5AY8C 3REIA 2Y2OA 3H0MC 1TAFB 3VH6A 3X1UB 3AV2D 1R4VA 3MGQD 4WU9C 3W98B 3KWQC 4G91C 5BNVB 3C1BB 3AZND 1P3KC 1ID3B 4Z66D 1P3IB 2F8NH 5AV9D 4J8UB 5CPIC 5AY8A 1P3LA 4CAYA 4J8WD 3AYWD 2PYOB 2RIQA 4R8PA 3AZMB 3W96D 1WWIA 5B32C 5B0ZA 3W99A 5B24B 5GT0A 1P3LC 4KUDA 5AVCD 4H9OA 4EO5C 1KX5A 3AYWA 1S32A 2DF4C 5AY8D 1BH8B 3NQJA 4NE3A 2FFFB 4LD9A 5B2JC 3UT9A 3AV1B 2BYKA 3X1TD 3AZJB 1N1JB 2JCHA 3MNNA 5CPIB 1P34D 3EPLA 1S32C 3B6GD 5B1MC 3AZKB 5AV8C 3RELD 3R45A 4XZQB 1H3OB 5AVBC 3KXBA 5B1LD 1ZLAB 3TU4A 5AV6A 3FDDA 3WA9D 2HUEB 3MNNC 3REKC 3X1TA 5DNMA 4DRBA 3B0CW 5CPJC 3AZFA 3B6GA 5CP6A 4JJNA 5DNNB 3EG5B 3UTBD 4KUDD 4ZUXC 1KX5D 3AN2A 5AV6D 4Z5TB 5B1LA 5BNXA 5CPJA 1Z2CB 3C1CC 3C1CD 4XZQA 3B6GC 4R8PC 3WTPA 3W99B 2FJ7A 3V9RA 5FUGB 5C3IC 5B2JD 4R8PB 4CAYB 2PYOA 2CWEA 2IO5B 4QLCB 5CPJD 1B6WA 3AZHC 4KHAA 1P3LD 3WTPD 4G91B 2BYMA 3IP4C 4Z5TA 5GXQD 5B31D 2F2AC 3C1BC 1ID3C 2PYOC 3W96C 3AZGB 2AROA 1U35C 3UTAB 1T3UA 3W97B 4J8VB 3WKJD 3MVDD 1P3PB 1PZRA 3AZNC 1P3KD 3AZGC 1U35B 3KSYA 3VH5W 4QLCA 1P3IA 3B6FC 2HIOC 5B33A 4H9QA 5B0YC 3AV2A 2Y2MA 2AROD 3VH6W 1M19D 4NE5A 5GT3D 5AV5D 3AZGA 4JJNC 5B32D 4G92C 3AFAC 3X1UC 3KUYB 5B24C 4J8UA 3UTAC 3EPJA 5B33D 3NQJB 4CSRA 3MGRA 3W97C 4JJNB 2Y2GA 1EQZB 4Z2MH 4Z66C 3X1SA 4HGAB 3LZ0B 1HQ3B 4YS3B 5B2IA 1BH9B 3AZMC 5CP6D 5AVCA 1EQZC 3KWQA 5F99D 1P3AB 4KGCB 5KDMB 4Z66A 5BT1D 3LZ0C 2L5AA 3R45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX4 B;  2CV5 C;  3MGR D;  3AZI C;  1TZY C;  3MGP B;  3X1V D;  2FJ7 D;  4YM6 A;  5CHL B;  4X23 C;  3LJA D;  3REJ B;  1JFI A;  3W99 C;  3AZF B;  3AZJ C;  5GT0 C;  1M18 A;  2RVQ D;  3TU4 D;  1KX5 C;  2F8N K;  3WA9 A;  3AZL D;  1S32 B;  3AZI A;  1KX3 D;  5BS7 A;  4X23 B;  1P3M A;  5JRG C;  4YM6 C;  1Q9C A;  5KDM A;  5GT0 B;  3LZ1 B;  1AOI C;  4H9R B;  4WU8 B;  1M19 A;  3AZF D;  5BO0 A;  3MNN D;  3WA9 C;  3MGS C;  3AN2 D;  1F66 B;  2LY8 A;  2RVQ C;  2BYK B;  2YFV B;  3MGR B;  1P3B A;  4CSR B;  3REI C;  1M19 C;  5B1M D;  3VH6 T;  2NQB B;  4KGC D;  2HIO D;  4XUJ D;  5JA4 B;  5B0Y D;  1M1A B;  3X1T C;  5B40 A;  3REI B;  4YS3 D;  1HQ3 D;  3O62 B;  1P3G B;  3LZ0 D;  3A6N C;  1M1A A;  2YFW A;  5CPK B;  4ZUX A;  3B0B A;  1EQZ D;  4WU9 B;  3W98 C;  1KU5 A;  5B32 A;  3REH A;  5AV9 A;  3KUY D;  3C1C A;  5B32 B;  5B2I B;  5E5A B;  4UUZ A;  3MGQ A;  3B0D B;  3W98 A;  1M19 B;  3X1U A;  5E5A D;  2ARO B;  5B2I D;  4HGA C;  1HQ3 C;  2F8N G;  3VH5 A;  5G49 B;  3B0D C;  3WAA A;  4WU9 D;  3MGQ C;  1P3K B;  5CPK D;  1P3P D;  5DNN A;  3MVD B;  5CPK C;  4J8V D;  3O62 D;  1P3G D;  3REI D;  1F1E A;  1P3F A;  5AVB A;  3KXB C;  3AZG D;  3LZ0 A;  1M1A D;  4XUJ B;  2HIO B;  5B0Y B;  3WKJ C;  4KUD C;  5B1M B;  3WTP B;  2NQB D;  4H9S A;  4WU9 A;  4NE6 A;  4KGC A;  1P3F C;  5BNX B;  5CPJ B;  4QLC D;  3B6F A;  3AN2 B;  1F66 D;  5GXQ C;  5B31 C;  3O62 A;  3UT9 C;  1P34 A;  1P3G A;  2HUE C;  3MNN B;  5CPI A;  1KX4 C;  5B1L C;  3AZE A;  4WU8 D;  3LZ1 D;  5BS7 C;  2BYM B;  5GT0 D;  3W99 D;  5B0Z C;  1BH8 A;  4X23 D;  3C1C B;  4YS3 C;  2FJ7 C;  3AZL B;  1S32 D;  1KX3 B;  1P34 C;  3TU4 B;  1KX4 A;  4Z5T D;  4XUJ C;  3LJA B;  3W97 A;  5DNM C;  3REJ D;  2FJ7 B;  3X1V B;  3MGP D;  4YS3 A;  4NFT A;  2IO5 C;  3LZ1 C;  5CP6 C;  1N1J A;  5AVC C;  5C3I B;  2JSS A;  1KX4 D;  4ZBJ B;  1EQZ A;  3WA9 B;  3A6N B;  5F99 B;  1P3A D;  4KHA B;  2NZD C;  4E44 A;  4XZQ D;  4J8V A;  5CP6 B;  3REL B;  4M6B A;  1TAF A;  3AZK D;  2NQB C;  4AWL B;  3AYW C;  3AZL C;  1KX3 C;  1P34 B;  5CPI D;  1P3O A;  3REH C;  4JJN D;  3AZJ D;  3REL C;  5B33 B;  3WKJ A;  3B0C T;  3AV2 C;  3X1V C;  5AY8 B;  1P3P C;  3AZL A;  1KX3 A;  5JRG A;  3AZK A;  1BH9 A;  5B31 G;  5GT3 B;  5AV5 B;  5FUG A;  3UTA A;  5E5A C;  3AZM D;  4WV4 B;  1U35 D;  4AWL C;  3AYW B;  4J8W B;  2PYO D;  4Z66 B;  3WKJ B;  3C1B D;  3NQU A;  1ID3 D;  3W97 D;  3UTA D;  3MGQ B;  3W98 D;  3AV2 B;  4J8W C;  3X1U D;  5AV8 A;  5GXQ B;  5B31 B;  1HTA A;  1P3L B;  1U35 A;  3KXB B;  1ZLA A;  1H3O A;  3WAA B;  4J8W A;  2NZD A;  4R8P D;  3LEL D;  3X1S D;  5B2J B;  1P3O B;  4J8X A;  1ULY A;  5DNM D;  3AZH A;  4LD9 C;  3MVD C;  5JA4 A;  3AN2 C;  3UT9 B;  3AV1 A;  3AZM A;  1M18 D;  1AOI A;  1A7W A;  5JRG B;  4XZQ C;  5AV6 B;  2NZD D;  4H9O B;  1KX5 B;  1P3A C;  1AOI B;  1WWS A;  3REK D;  1P3P A;  4KUD B;  5BNV A;  3UTB B;  5DNN D;  5B40 D;  5CPK A;  3V9R B;  5DNN C;  5BO0 B;  3TU4 C;  3AZH D;  3LJA A;  4QLC C;  1P3F D;  1P3K A;  5AV8 D;  3AZJ A;  3REJ C;  1M18 C;  5B1L B;  1TZY D;  1ZLA D;  3AZI D;  2NQB A;  4Z5T C;  3C1B A;  1ID3 A;  3A6N A;  1M1A C;  3W96 A;  3B6G B;  3AZE B;  5B0Z D;  3O62 C;  5B31 A;  4YM6 B;  5GXQ A;  1P3G C;  5B24 A;  4J8U C;  2CV5 A;  4WU8 C;  3X1T B;  3X1V A;  1BFM A;  3AV1 D;  3UTB C;  2F8N A;  4Z2M G;  3MGS B;  1F66 C;  1P3M B;  2F8N B;  5B2I C;  3LEL A;  5AVC B;  2HIO A;  5B0Y A;  5B33 C;  5GSU B;  5B24 D;  4DRA A;  5AVB D;  4WZS B;  1P3M C;  3W96 B;  4H9N A;  5GSU C;  5B32 G;  3AFA A;  3AV1 C;  5F99 A;  2ARO C;  3B6F B;  1TZY A;  5G49 A;  5AV9 B;  4J8U D;  1P3I D;  3REK A;  3AZN B;  4E45 A;  3B6F D;  1B67 A;  1P3A A;  4H9P A;  1P3I C;  5AVB B;  1ZLA C;  4KGC C;  4G92 B;  1P3O C;  5GSU D;  3REL A;  4LD9 B;  2F8N D;  4J8X C;  1P3M D;  3REH D;  3AFA B;  3KUY C;  3WTP C;  3MGS D;  3WTP E;  2YFV A;  2YFW B;  3AZK C;  3MGP A;  1P3B C;  5AV9 C;  4J8X B;  5B2J A;  4YM6 D;  4H9P B;  5B0Z B;  3KWQ D;  4H9R A;  4WU8 A;  3AZE D;  4H9Q B;  5E5A A;  3UTB A;  5B1M A;  1P3B B;  3AZI B;  1TZY B;  3MGP C;  3LJA C;  3LEL C;  2CV5 B;  1HQ3 A;  5AV8 B;  4ZUX B;  4H9N B;  3VH5 T;  1P3F B;  5AV6 C;  3WAA C;  3REJ A;  1JFI B;  3AZH B;  4ZUX D;  2CV5 D;  3AZE C;  5B40 B;  3AZF C;  5BT1 C;  5GSU A;  3REK B;  3AZN A;  1AOI D;  5F99 C;  4X23 A;  1P3B D;  2NZD B;  4WNN A;  5JRG D;  4ZBJ C;  1M18 B;  3KWQ B;  5B40 C;  3UT9 D;  4XUJ A;  4J8X D;  4H9S C;  4UUZ B;  1F66 A;  5AV5 A;  5GT3 A;  5DNM B;  1P3O D;  3X1S B;  3LEL B;  3MVD A;  3LZ1 A;  3AFA D;  3REH B;  3NQU B;  3WAA D;  4LD9 D;  3MGS A;  3MGR C;  3KXB D;  4WNN B;  3KUY A;  5GT3 C;  5AV5 C;  3X1S C;  4EO5 B;  4J8V C;  5AY8 C;  3REI A;  1TAF B;  3VH6 A;  3X1U B;  3AV2 D;  1R4V A;  3MGQ D;  4WU9 C;  3W98 B;  3KWQ C;  4G91 C;  5BNV B;  3C1B B;  3AZN D;  1P3K C;  1ID3 B;  4Z66 D;  1P3I B;  2F8N H;  5AV9 D;  4J8U B;  5CPI C;  5AY8 A;  1P3L A;  4CAY A;  4J8W D;  3AYW D;  2PYO B;  4R8P A;  3AZM B;  3W96 D;  1WWI A;  5B32 C;  5B0Z A;  3W99 A;  5B24 B;  5GT0 A;  1P3L C;  4KUD A;  5AVC D;  4H9O A;  4EO5 C;  1KX5 A;  3AYW A;  1S32 A;  5AY8 D;  1BH8 B;  3NQJ A;  4NE3 A;  4LD9 A;  5B2J C;  3UT9 A;  3AV1 B;  2BYK A;  3X1T D;  3AZJ B;  1N1J B;  3MNN A;  5CPI B;  1P34 D;  1S32 C;  3B6G D;  5B1M C;  3AZK B;  5AV8 C;  3LZ0 C;  3REL D;  3R45 A;  4XZQ B;  1H3O B;  5AVB C;  3KXB A;  5B1L D;  1ZLA B;  3TU4 A;  5AV6 A;  3WA9 D;  2HUE B;  3MNN C;  3REK C;  3X1T A;  5DNM A;  4DRB A;  3B0C W;  5CPJ C;  3AZF A;  3B6G A;  5CP6 A;  4JJN A;  5DNN B;  3UTB D;  4KUD D;  4ZUX C;  1KX5 D;  3AN2 A;  5AV6 D;  4Z5T B;  5B1L A;  5BNX A;  5CPJ A;  3C1C C;  3C1C D;  4XZQ A;  3B6G C;  4R8P C;  3WTP A;  3W99 B;  2FJ7 A;  3V9R A;  5FUG B;  5C3I C;  5B2J D;  4R8P B;  4CAY B;  2PYO A;  2CWE A;  2IO5 B;  4QLC B;  5CPJ D;  1B6W A;  3AZH C;  4KHA A;  1P3L D;  3WTP D;  4G91 B;  2BYM A;  4Z5T A;  3C1B C;  5GXQ D;  5B31 D;  1ID3 C;  2PYO C;  3W96 C;  3AZG B;  2ARO A;  1U35 C;  3UTA B;  3W97 B;  4J8V B;  3WKJ D;  3MVD D;  1P3P B;  3AZN C;  1P3K D;  3AZG C;  1U35 B;  3KSY A;  3VH5 W;  4QLC A;  1P3I A;  3B6F C;  2HIO C;  5B33 A;  4H9Q A;  5B0Y C;  3AV2 A;  2ARO D;  3VH6 W;  1M19 D;  4NE5 A;  5GT3 D;  5AV5 D;  3AZG A;  4JJN C;  5B32 D;  4G92 C;  3AFA C;  3X1U C;  3KUY B;  5B24 C;  4J8U A;  3UTA C;  5B33 D;  3NQJ B;  4CSR A;  3MGR A;  3W97 C;  4JJN B;  1EQZ B;  4Z66 C;  4Z2M H;  3X1S A;  4HGA B;  3LZ0 B;  1HQ3 B;  4YS3 B;  5B2I A;  1BH9 B;  3AZM C;  5CP6 D;  5AVC A;  1EQZ C;  3KWQ A;  5F99 D;  1P3A B;  4KGC B;  5KDM B;  4Z66 A;  5BT1 D;  3A6N D;  2L5A A;  3R45 B; 
#chains in the Genus database with same CATH topology
 1KX4 B;  3EPK A;  2CV5 C;  3MGR D;  3AZI C;  1TZY C;  3MGP B;  3X1V D;  2FJ7 D;  4YM6 A;  5CHL B;  4X23 C;  3LJA D;  3REJ B;  1JFI A;  3W99 C;  3AZF B;  3AZJ C;  5GT0 C;  1M18 A;  2RVQ D;  3TU4 D;  1KX5 C;  2F8N K;  3WA9 A;  3AZL D;  1S32 B;  3AZI A;  1KX3 D;  5BS7 A;  4X23 B;  1P3M A;  5JRG C;  4YM6 C;  1Q9C A;  2ZY4 A;  5KDM A;  5GT0 B;  3LZ1 B;  1AOI C;  4H9R B;  4WU8 B;  1M19 A;  3AZF D;  5BO0 A;  3MNN D;  3WA9 C;  3MGS C;  3AN2 D;  1F66 B;  2LY8 A;  2RVQ C;  2BYK B;  2YFV B;  3MGR B;  1P3B A;  4CSR B;  2ZM5 A;  3REI C;  1M19 C;  5B1M D;  3VH6 T;  2NQB B;  4KGC D;  2HIO D;  4XUJ D;  5JA4 B;  5B0Y D;  1M1A B;  3X1T C;  5B40 A;  3REI B;  4YS3 D;  1HQ3 D;  3O62 B;  1P3G B;  3LZ0 D;  3A6N C;  1M1A A;  2YFW A;  5CPK B;  4ZUX A;  3B0B A;  1EQZ D;  4WU9 B;  3W98 C;  1KU5 A;  5B32 A;  3REH A;  3EPH A;  5AV9 A;  2DQN C;  3KUY D;  3C1C A;  5B32 B;  5B2I B;  5E5A B;  4UUZ A;  3MGQ A;  3B0D B;  3W98 A;  1M19 B;  3X1U A;  5E5A D;  2ARO B;  5B2I D;  2Y2J A;  4HGA C;  2JE5 A;  2J8P A;  1HQ3 C;  2F8N G;  3VH5 A;  5G49 B;  3B0D C;  3WAA A;  4WU9 D;  3MGQ C;  1P3K B;  5CPK D;  1P3P D;  5DNN A;  3MVD B;  5CPK C;  2ZY5 A;  4J8V D;  3O62 D;  1P3G D;  3REI D;  1F1E A;  1P3F A;  5AVB A;  3KXB C;  3AZG D;  3LZ0 A;  1M1A D;  4XUJ B;  2HIO B;  5B0Y B;  3H0R C;  3WKJ C;  4KUD C;  5B1M B;  3WTP B;  2NQB D;  4H9S A;  4WU9 A;  4NE6 A;  4KGC A;  1P3F C;  5BNX B;  5CPJ B;  4QLC D;  3B6F A;  3AN2 B;  1F66 D;  5GXQ C;  2G5I C;  5B31 C;  3O62 A;  3UT9 C;  1P34 A;  2HUE C;  3MNN B;  5CPI A;  1P3G A;  1KX4 C;  5B1L C;  3AZE A;  4WU8 D;  3LZ1 D;  5BS7 C;  2BYM B;  5GT0 D;  3W99 D;  5B0Z C;  1BH8 A;  4X23 D;  3C1C B;  4YS3 C;  2FJ7 C;  3AZL B;  1S32 D;  1KX3 B;  1P34 C;  3TU4 B;  1KX4 A;  4Z5T D;  4XUJ C;  3LJA B;  3W97 A;  5DNM C;  3REJ D;  2FJ7 B;  3X1V B;  2Y2P A;  3MGP D;  4YS3 A;  4NFT A;  2IO5 C;  3LZ1 C;  5CP6 C;  1N1J A;  5AVC C;  5C3I B;  2JSS A;  1KX4 D;  4ZBJ B;  1EQZ A;  3WA9 B;  3A6N B;  5F99 B;  1P3A D;  4KHA B;  2NZD C;  4E44 A;  4XZQ D;  4J8V A;  5CP6 B;  3REL B;  4M6B A;  1TAF A;  3AZK D;  3KFU G;  2NQB C;  4AWL B;  3AYW C;  3AZL C;  1KX3 C;  1P34 B;  5CPI D;  1P3O A;  3REH C;  4JJN D;  3AZJ D;  3REL C;  5B33 B;  2Y2K A;  3WKJ A;  3B0C T;  3AV2 C;  3X1V C;  2ZY2 A;  5AY8 B;  1P3P C;  3AZL A;  1KX3 A;  5JRG A;  3AZK A;  1BH9 A;  5B31 G;  5GT3 B;  5AV5 B;  5FUG A;  3UTA A;  5E5A C;  1W2E A;  3AZM D;  4WV4 B;  3AL0 C;  1U35 D;  4AWL C;  3AYW B;  4J8W B;  2PYO D;  4Z66 B;  3WKJ B;  3C1B D;  3NQU A;  1ID3 D;  3W97 D;  3A6N D;  3UTA D;  3MGQ B;  3W98 D;  3AV2 B;  4J8W C;  3X1U D;  5AV8 A;  5GXQ B;  5B31 B;  1HTA A;  1P3L B;  1U35 A;  3H0L C;  3KXB B;  2VQR A;  1ZLA A;  1H3O A;  3WAA B;  4J8W A;  2NZD A;  4R8P D;  3LEL D;  3X1S D;  5B2J B;  1P3O B;  4J8X A;  1ULY A;  5DNM D;  2XD5 A;  3AZH A;  4LD9 C;  4WJ3 C;  3MVD C;  5JA4 A;  3AN2 C;  3UT9 B;  3AV1 A;  3AZM A;  1M18 D;  1AOI A;  1A7W A;  5JRG B;  4XZQ C;  2XD1 A;  5AV6 B;  2NZD D;  4H9O B;  1KX5 B;  1P3A C;  1AOI B;  1WWS A;  3REK D;  1P3P A;  4KUD B;  5BNV A;  3UTB B;  5DNN D;  5B40 D;  5CPK A;  3V9R B;  5DNN C;  5BO0 B;  3TU4 C;  3AZH D;  3LJA A;  4QLC C;  1P3F D;  1P3K A;  5AV8 D;  3AZJ A;  3REJ C;  1M18 C;  5B1L B;  1TZY D;  1ZLA D;  3AZI D;  2UWX A;  2NQB A;  4Z5T C;  3C1B A;  1ID3 A;  3A1I A;  3A6N A;  1M1A C;  3W96 A;  3B6G B;  3AZE B;  5B0Z D;  5B31 A;  4YM6 B;  5GXQ A;  3O62 C;  1P3G C;  5B24 A;  4J8U C;  2CV5 A;  4WU8 C;  3X1T B;  3X1V A;  1BFM A;  3AV1 D;  3UTB C;  2F8N A;  4Z2M G;  3MGS B;  1F66 C;  3P5J B;  2Y2I A;  1P3M B;  2Y2H A;  2F8N B;  5B2I C;  2Y2L A;  3LEL A;  5AVC B;  2HIO A;  5B0Y A;  5B33 C;  5GSU B;  5B24 D;  4DRA A;  5AVB D;  4WZS B;  1P3M C;  4UPK A;  3W96 B;  4H9N A;  5GSU C;  5B32 G;  3AFA A;  3AV1 C;  5F99 A;  2ARO C;  3B6F B;  1TZY A;  5G49 A;  5AV9 B;  4J8U D;  1P3I D;  3REK A;  3AZN B;  4E45 A;  3B6F D;  1B67 A;  1P3A A;  4H9P A;  1P3I C;  5AVB B;  1ZLA C;  4KGC C;  4G92 B;  1P3O C;  5GSU D;  3REL A;  4LD9 B;  2F8N D;  2Y2Q A;  4J8X C;  1P3M D;  3REH D;  3AFA B;  3KUY C;  3WTP C;  3MGS D;  3WTP E;  2YFV A;  2YFW B;  3AZK C;  3MGP A;  1P3B C;  5AV9 C;  4J8X B;  5B2J A;  4YM6 D;  4H9P B;  5B0Z B;  3KWQ D;  4H9R A;  4WU8 A;  3AZE D;  4H9Q B;  5E5A A;  3UTB A;  2Y2N A;  5B1M A;  1P3B B;  3AZI B;  1TZY B;  3MGP C;  2G5H C;  3LJA C;  3LEL C;  2CV5 B;  1HQ3 A;  5AV8 B;  4ZUX B;  4H9N B;  3VH5 T;  1P3F B;  5AV6 C;  3WAA C;  3REJ A;  1JFI B;  3AZH B;  4ZUX D;  2CV5 D;  3AZE C;  5B40 B;  3AZF C;  5BT1 C;  5GSU A;  3REK B;  3AZN A;  1AOI D;  5F99 C;  4X23 A;  4DQY B;  1P3B D;  2NZD B;  4WNN A;  5JRG D;  4ZBJ C;  1M18 B;  3KWQ B;  5B40 C;  2ZY3 A;  3UT9 D;  4XUJ A;  4J8X D;  4H9S C;  4UUZ B;  3F6T A;  2W8S A;  1F66 A;  5AV5 A;  2BG1 A;  5GT3 A;  5DNM B;  1P3O D;  3X1S B;  3LEL B;  3A1K A;  3LZ1 A;  3MVD A;  3AFA D;  3REH B;  3NQU B;  3WAA D;  4LD9 D;  3MGS A;  3MGR C;  3KXB D;  4WNN B;  3KUY A;  5GT3 C;  5AV5 C;  3X1S C;  4EO5 B;  4J8V C;  5AY8 C;  3REI A;  2Y2O A;  3H0M C;  1TAF B;  3VH6 A;  3X1U B;  3AV2 D;  1R4V A;  3MGQ D;  4WU9 C;  3W98 B;  3KWQ C;  4G91 C;  5BNV B;  3C1B B;  3AZN D;  1P3K C;  1ID3 B;  4Z66 D;  1P3I B;  2F8N H;  5AV9 D;  4J8U B;  5CPI C;  5AY8 A;  1P3L A;  4CAY A;  4J8W D;  3AYW D;  2PYO B;  2RIQ A;  4R8P A;  3AZM B;  3W96 D;  1WWI A;  5B32 C;  5B0Z A;  3W99 A;  5B24 B;  5GT0 A;  1P3L C;  4KUD A;  5AVC D;  4H9O A;  4EO5 C;  1KX5 A;  3AYW A;  1S32 A;  2DF4 C;  5AY8 D;  1BH8 B;  3NQJ A;  4NE3 A;  2FFF B;  4LD9 A;  5B2J C;  3UT9 A;  3AV1 B;  2BYK A;  3X1T D;  3AZJ B;  1N1J B;  2JCH A;  3MNN A;  5CPI B;  1P34 D;  3EPL A;  1S32 C;  3B6G D;  5B1M C;  3AZK B;  5AV8 C;  3REL D;  3R45 A;  4XZQ B;  1H3O B;  5AVB C;  3KXB A;  5B1L D;  1ZLA B;  3TU4 A;  5AV6 A;  3FDD A;  3WA9 D;  2HUE B;  3MNN C;  3REK C;  3X1T A;  5DNM A;  4DRB A;  3B0C W;  5CPJ C;  3AZF A;  3B6G A;  5CP6 A;  4JJN A;  5DNN B;  3EG5 B;  3UTB D;  4KUD D;  4ZUX C;  1KX5 D;  3AN2 A;  5AV6 D;  4Z5T B;  5B1L A;  5BNX A;  5CPJ A;  1Z2C B;  3C1C C;  3C1C D;  4XZQ A;  3B6G C;  4R8P C;  3WTP A;  3W99 B;  2FJ7 A;  3V9R A;  5FUG B;  5C3I C;  5B2J D;  4R8P B;  4CAY B;  2PYO A;  2CWE A;  2IO5 B;  4QLC B;  5CPJ D;  1B6W A;  3AZH C;  4KHA A;  1P3L D;  3WTP D;  4G91 B;  2BYM A;  3IP4 C;  4Z5T A;  5GXQ D;  5B31 D;  2F2A C;  3C1B C;  1ID3 C;  2PYO C;  3W96 C;  3AZG B;  2ARO A;  1U35 C;  3UTA B;  1T3U A;  3W97 B;  4J8V B;  3WKJ D;  3MVD D;  1P3P B;  1PZR A;  3AZN C;  1P3K D;  3AZG C;  1U35 B;  3KSY A;  3VH5 W;  4QLC A;  1P3I A;  3B6F C;  2HIO C;  5B33 A;  4H9Q A;  5B0Y C;  3AV2 A;  2Y2M A;  2ARO D;  3VH6 W;  1M19 D;  4NE5 A;  5GT3 D;  5AV5 D;  3AZG A;  4JJN C;  5B32 D;  4G92 C;  3AFA C;  3X1U C;  3KUY B;  5B24 C;  4J8U A;  3UTA C;  3EPJ A;  5B33 D;  3NQJ B;  4CSR A;  3MGR A;  3W97 C;  4JJN B;  2Y2G A;  1EQZ B;  4Z2M H;  4Z66 C;  3X1S A;  4HGA B;  3LZ0 B;  1HQ3 B;  4YS3 B;  5B2I A;  1BH9 B;  3AZM C;  5CP6 D;  5AVC A;  1EQZ C;  3KWQ A;  5F99 D;  1P3A B;  4KGC B;  5KDM B;  4Z66 A;  5BT1 D;  3LZ0 C;  2L5A A;  3R45 B; 
#chains in the Genus database with same CATH homology
 1KX4 B;  3EPK A;  2CV5 C;  3MGR D;  3AZI C;  1TZY C;  3MGP B;  3X1V D;  2FJ7 D;  4YM6 A;  5CHL B;  4X23 C;  3LJA D;  3REJ B;  1JFI A;  3W99 C;  3AZF B;  3AZJ C;  5GT0 C;  1M18 A;  2RVQ D;  3TU4 D;  1KX5 C;  2F8N K;  3WA9 A;  3AZL D;  1S32 B;  3AZI A;  1KX3 D;  5BS7 A;  4X23 B;  1P3M A;  5JRG C;  4YM6 C;  1Q9C A;  2ZY4 A;  5KDM A;  5GT0 B;  3LZ1 B;  1AOI C;  4H9R B;  4WU8 B;  1M19 A;  3AZF D;  5BO0 A;  3MNN D;  3WA9 C;  3MGS C;  3AN2 D;  1F66 B;  2LY8 A;  2RVQ C;  2BYK B;  2YFV B;  3MGR B;  1P3B A;  4CSR B;  2ZM5 A;  3REI C;  1M19 C;  5B1M D;  3VH6 T;  2NQB B;  4KGC D;  2HIO D;  4XUJ D;  5JA4 B;  5B0Y D;  1M1A B;  3X1T C;  5B40 A;  3REI B;  4YS3 D;  1HQ3 D;  3O62 B;  1P3G B;  3LZ0 D;  3A6N C;  1M1A A;  2YFW A;  5CPK B;  4ZUX A;  3B0B A;  1EQZ D;  4WU9 B;  3W98 C;  1KU5 A;  5B32 A;  3REH A;  3EPH A;  5AV9 A;  2DQN C;  3KUY D;  3C1C A;  5B32 B;  5B2I B;  5E5A B;  4UUZ A;  3MGQ A;  3B0D B;  3W98 A;  1M19 B;  3X1U A;  5E5A D;  2ARO B;  5B2I D;  2Y2J A;  4HGA C;  2JE5 A;  2J8P A;  1HQ3 C;  2F8N G;  3VH5 A;  5G49 B;  3B0D C;  3WAA A;  4WU9 D;  3MGQ C;  1P3K B;  5CPK D;  1P3P D;  5DNN A;  3MVD B;  5CPK C;  2ZY5 A;  4J8V D;  3O62 D;  1P3G D;  3REI D;  1F1E A;  1P3F A;  5AVB A;  3KXB C;  3AZG D;  3LZ0 A;  1M1A D;  4XUJ B;  2HIO B;  5B0Y B;  3H0R C;  3WKJ C;  4KUD C;  5B1M B;  3WTP B;  2NQB D;  4H9S A;  4WU9 A;  4NE6 A;  4KGC A;  1P3F C;  5BNX B;  5CPJ B;  4QLC D;  3B6F A;  3AN2 B;  1F66 D;  5GXQ C;  2G5I C;  5B31 C;  3O62 A;  3UT9 C;  1P34 A;  2HUE C;  3MNN B;  5CPI A;  1P3G A;  1KX4 C;  5B1L C;  3AZE A;  4WU8 D;  3LZ1 D;  5BS7 C;  2BYM B;  5GT0 D;  3W99 D;  5B0Z C;  1BH8 A;  4X23 D;  3C1C B;  4YS3 C;  2FJ7 C;  3AZL B;  1S32 D;  1KX3 B;  1P34 C;  3TU4 B;  1KX4 A;  4Z5T D;  4XUJ C;  3LJA B;  3W97 A;  5DNM C;  3REJ D;  2FJ7 B;  3X1V B;  2Y2P A;  3MGP D;  4YS3 A;  4NFT A;  2IO5 C;  3LZ1 C;  5CP6 C;  1N1J A;  5AVC C;  5C3I B;  2JSS A;  1KX4 D;  4ZBJ B;  1EQZ A;  3WA9 B;  3A6N B;  5F99 B;  1P3A D;  4KHA B;  2NZD C;  4E44 A;  4XZQ D;  4J8V A;  5CP6 B;  3REL B;  4M6B A;  1TAF A;  3AZK D;  3KFU G;  2NQB C;  4AWL B;  3AYW C;  3AZL C;  1KX3 C;  1P34 B;  5CPI D;  1P3O A;  3REH C;  4JJN D;  3AZJ D;  3REL C;  5B33 B;  2Y2K A;  3WKJ A;  3B0C T;  3AV2 C;  3X1V C;  2ZY2 A;  5AY8 B;  1P3P C;  3AZL A;  1KX3 A;  5JRG A;  3AZK A;  1BH9 A;  5B31 G;  5GT3 B;  5AV5 B;  5FUG A;  3UTA A;  5E5A C;  1W2E A;  3AZM D;  4WV4 B;  3AL0 C;  1U35 D;  4AWL C;  3AYW B;  4J8W B;  2PYO D;  4Z66 B;  3WKJ B;  3C1B D;  3NQU A;  1ID3 D;  3W97 D;  3A6N D;  3UTA D;  3MGQ B;  3W98 D;  3AV2 B;  4J8W C;  3X1U D;  5AV8 A;  5GXQ B;  5B31 B;  1HTA A;  1P3L B;  1U35 A;  3H0L C;  3KXB B;  2VQR A;  1ZLA A;  1H3O A;  3WAA B;  4J8W A;  2NZD A;  4R8P D;  3LEL D;  3X1S D;  5B2J B;  1P3O B;  4J8X A;  1ULY A;  5DNM D;  2XD5 A;  3AZH A;  4LD9 C;  4WJ3 C;  3MVD C;  5JA4 A;  3AN2 C;  3UT9 B;  3AV1 A;  3AZM A;  1M18 D;  1AOI A;  1A7W A;  5JRG B;  4XZQ C;  2XD1 A;  5AV6 B;  2NZD D;  4H9O B;  1KX5 B;  1P3A C;  1AOI B;  1WWS A;  3REK D;  1P3P A;  4KUD B;  5BNV A;  3UTB B;  5DNN D;  5B40 D;  5CPK A;  3V9R B;  5DNN C;  5BO0 B;  3TU4 C;  3AZH D;  3LJA A;  4QLC C;  1P3F D;  1P3K A;  5AV8 D;  3AZJ A;  3REJ C;  1M18 C;  5B1L B;  1TZY D;  1ZLA D;  3AZI D;  2UWX A;  2NQB A;  4Z5T C;  3C1B A;  1ID3 A;  3A1I A;  3A6N A;  1M1A C;  3W96 A;  3B6G B;  3AZE B;  5B0Z D;  5B31 A;  4YM6 B;  5GXQ A;  3O62 C;  1P3G C;  5B24 A;  4J8U C;  2CV5 A;  4WU8 C;  3X1T B;  3X1V A;  1BFM A;  3AV1 D;  3UTB C;  2F8N A;  4Z2M G;  3MGS B;  1F66 C;  3P5J B;  2Y2I A;  1P3M B;  2Y2H A;  2F8N B;  5B2I C;  2Y2L A;  3LEL A;  5AVC B;  2HIO A;  5B0Y A;  5B33 C;  5GSU B;  5B24 D;  4DRA A;  5AVB D;  4WZS B;  1P3M C;  4UPK A;  3W96 B;  4H9N A;  5GSU C;  5B32 G;  3AFA A;  3AV1 C;  5F99 A;  2ARO C;  3B6F B;  1TZY A;  5G49 A;  5AV9 B;  4J8U D;  1P3I D;  3REK A;  3AZN B;  4E45 A;  3B6F D;  1B67 A;  1P3A A;  4H9P A;  1P3I C;  5AVB B;  1ZLA C;  4KGC C;  4G92 B;  1P3O C;  5GSU D;  3REL A;  4LD9 B;  2F8N D;  2Y2Q A;  4J8X C;  1P3M D;  3REH D;  3AFA B;  3KUY C;  3WTP C;  3MGS D;  3WTP E;  2YFV A;  2YFW B;  3AZK C;  3MGP A;  1P3B C;  5AV9 C;  4J8X B;  5B2J A;  4YM6 D;  4H9P B;  5B0Z B;  3KWQ D;  4H9R A;  4WU8 A;  3AZE D;  4H9Q B;  5E5A A;  3UTB A;  2Y2N A;  5B1M A;  1P3B B;  3AZI B;  1TZY B;  3MGP C;  2G5H C;  3LJA C;  3LEL C;  2CV5 B;  1HQ3 A;  5AV8 B;  4ZUX B;  4H9N B;  3VH5 T;  1P3F B;  5AV6 C;  3WAA C;  3REJ A;  1JFI B;  3AZH B;  4ZUX D;  2CV5 D;  3AZE C;  5B40 B;  3AZF C;  5BT1 C;  5GSU A;  3REK B;  3AZN A;  1AOI D;  5F99 C;  4X23 A;  4DQY B;  1P3B D;  2NZD B;  4WNN A;  5JRG D;  4ZBJ C;  1M18 B;  3KWQ B;  5B40 C;  2ZY3 A;  3UT9 D;  4XUJ A;  4J8X D;  4H9S C;  4UUZ B;  3F6T A;  2W8S A;  1F66 A;  5AV5 A;  2BG1 A;  5GT3 A;  5DNM B;  1P3O D;  3X1S B;  3LEL B;  3A1K A;  3LZ1 A;  3MVD A;  3AFA D;  3REH B;  3NQU B;  3WAA D;  4LD9 D;  3MGS A;  3MGR C;  3KXB D;  4WNN B;  3KUY A;  5GT3 C;  5AV5 C;  3X1S C;  4EO5 B;  4J8V C;  5AY8 C;  3REI A;  2Y2O A;  3H0M C;  1TAF B;  3VH6 A;  3X1U B;  3AV2 D;  1R4V A;  3MGQ D;  4WU9 C;  3W98 B;  3KWQ C;  4G91 C;  5BNV B;  3C1B B;  3AZN D;  1P3K C;  1ID3 B;  4Z66 D;  1P3I B;  2F8N H;  5AV9 D;  4J8U B;  5CPI C;  5AY8 A;  1P3L A;  4CAY A;  4J8W D;  3AYW D;  2PYO B;  2RIQ A;  4R8P A;  3AZM B;  3W96 D;  1WWI A;  5B32 C;  5B0Z A;  3W99 A;  5B24 B;  5GT0 A;  1P3L C;  4KUD A;  5AVC D;  4H9O A;  4EO5 C;  1KX5 A;  3AYW A;  1S32 A;  2DF4 C;  5AY8 D;  1BH8 B;  3NQJ A;  4NE3 A;  2FFF B;  4LD9 A;  5B2J C;  3UT9 A;  3AV1 B;  2BYK A;  3X1T D;  3AZJ B;  1N1J B;  2JCH A;  3MNN A;  5CPI B;  1P34 D;  3EPL A;  1S32 C;  3B6G D;  5B1M C;  3AZK B;  5AV8 C;  3REL D;  3R45 A;  4XZQ B;  1H3O B;  5AVB C;  3KXB A;  5B1L D;  1ZLA B;  3TU4 A;  5AV6 A;  3FDD A;  3WA9 D;  2HUE B;  3MNN C;  3REK C;  3X1T A;  5DNM A;  4DRB A;  3B0C W;  5CPJ C;  3AZF A;  3B6G A;  5CP6 A;  4JJN A;  5DNN B;  3EG5 B;  3UTB D;  4KUD D;  4ZUX C;  1KX5 D;  3AN2 A;  5AV6 D;  4Z5T B;  5B1L A;  5BNX A;  5CPJ A;  1Z2C B;  3C1C C;  3C1C D;  4XZQ A;  3B6G C;  4R8P C;  3WTP A;  3W99 B;  2FJ7 A;  3V9R A;  5FUG B;  5C3I C;  5B2J D;  4R8P B;  4CAY B;  2PYO A;  2CWE A;  2IO5 B;  4QLC B;  5CPJ D;  1B6W A;  3AZH C;  4KHA A;  1P3L D;  3WTP D;  4G91 B;  2BYM A;  3IP4 C;  4Z5T A;  5GXQ D;  5B31 D;  2F2A C;  3C1B C;  1ID3 C;  2PYO C;  3W96 C;  3AZG B;  2ARO A;  1U35 C;  3UTA B;  1T3U A;  3W97 B;  4J8V B;  3WKJ D;  3MVD D;  1P3P B;  1PZR A;  3AZN C;  1P3K D;  3AZG C;  1U35 B;  3KSY A;  3VH5 W;  4QLC A;  1P3I A;  3B6F C;  2HIO C;  5B33 A;  4H9Q A;  5B0Y C;  3AV2 A;  2Y2M A;  2ARO D;  3VH6 W;  1M19 D;  4NE5 A;  5GT3 D;  5AV5 D;  3AZG A;  4JJN C;  5B32 D;  4G92 C;  3AFA C;  3X1U C;  3KUY B;  5B24 C;  4J8U A;  3UTA C;  3EPJ A;  5B33 D;  3NQJ B;  4CSR A;  3MGR A;  3W97 C;  4JJN B;  2Y2G A;  1EQZ B;  4Z2M H;  4Z66 C;  3X1S A;  4HGA B;  3LZ0 B;  1HQ3 B;  4YS3 B;  5B2I A;  1BH9 B;  3AZM C;  5CP6 D;  5AVC A;  1EQZ C;  3KWQ A;  5F99 D;  1P3A B;  4KGC B;  5KDM B;  4Z66 A;  5BT1 D;  3LZ0 C;  2L5A A;  3R45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...