3C1BD

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1bD00
1P3MD 4WU9B 3B6GD 1M18C 5B40D 4KUDD 3AYWD 2BYMB 3WTPB 1N1JB 3REJD 4ZUXD 5B32A 2HIOA 4YS3C 3AZFC 3WAAC 3KUYC 1HQ3D 3UT9C 2CV5D 5KDMB 5AV8D 1EQZD 3LJAD 5AVBC 1P3PB 1JFIA 3MGPB 2NZDB 2F8NH 5DNMB 5JA4A 4X23B 1F1EA 3W96A 3C1BD 2FJ7D 4J8WD 1P3MC 2BYKA 3V9RB 3MGRD 1S32D 3B6GC 5B40C 4KUDC 5E5AB 1P3AB 1Q9CA 3REJC 4ZUXC 3REKD 2JSSA 1ID3D 3AZMB 4CAYA 4QLCD 5C3IC 1HQ3C 2CV5C 1U35D 5AV8C 1EQZC 3LJAC 1A7WA 5B31G 2F8NK 3AZGD 2AROA 3B6FD 3AV1D 4J8VB 3AN2D 3C1BC 2FJ7C 5CPKD 4JJNA 3MGRC 1KU5A 3RELB 3REIB 5CPJA 4H9OA 4ZBJC 3AZLA 3WA9D 4NE3A 3REKC 1ID3C 4QLCC 4R8PD 5BS7C 3AZED 1U35C 3MGSB 3MVDA 4KGCD 5F99A 1M1AD 3AZGC 3B6FC 3O62D 4WU8D 3UTBA 1P3GA 5CPKC 2IO5B 5GXQD 4HGAB 5AV5A 5B2JA 5AVCD 2PYOD 3VH6A 5AV6D 2YFWA 3WA9C 5AY8D 2HIOB 3REHD 3X1SA 5GT3D 4R8PC 4KHAA 3AZEC 3R45A 3B0CW 4KGCC 1M1AC 3B0DC 3O62C 4WU8C 5JA4B 3W96B 5B24D 1TAFA 2BYKB 1BH8A 3TU4D 4AWLB 5GXQC 1ZLAC 5B0YD 3WKJD 5AVCC 2PYOC 5DNND 5AV6C 5AV9B 5AY8C 1P34A 3REHC 4CAYB 1P3LB 2BYMA 1N1JA 2F8ND 1TZYD 2AROB 3X1VD 3KXBD 3AZKD 5B24C 3MGQC 3TU4C 1P3PA 4WU9D 3MGPA 1P3FD 3WKJC 5DNMA 4H9QA 4X23A 3AV2B 5CPJB 3AZLB 4H9SA 3WTPD 3W99D 4Z5TA 4DRAA 5E5AA 1P3AA 4J8XD 5B1LB 3MVDB 5F99B 4CSRA 1TZYC 4E45A 3AZMA 3VH5A 4XZQD 3LZ1B 3UTBB 4E44A 5AV5B 1BH9A 4XUJA 4WU9C 1P3ID 1P3FC 3AZND 3AZIA 1P3OB 3WTPC 3X1SB 3RELA 5GT0A 1R4VA 1KX3B 3X1UB 1KX5D 4KHAB 3R45B 4WZSB 4J8XC 3AZFD 5JRGD 5B2ID 3LZ0A 5CP6D 4XZQC 2NZDC 5GSUD 4J8VD 1BH8B 1P3IC 3AZNC 3W97D 3REID 5B1MD 5CPID 1P3BA 1P34B 3C1CA 3AZJD 1KX5C 3MNNA 3MGSD 5JRGC 5B2IC 5CP6C 3AYWA 5GSUC 4J8VC 2RVQD 5B33B 4LD9A 4G91B 4H9QB 3W97C 5CPIC 5B1MC 3REIC 4Z5TB 5B32D 2HIOD 3AZJC 5BNXA 2YFVA 5AV9A 4WNNB 4CSRB 3MGSC 3A6NA 4J8UB 4NE5A 1S32A 1P3LA 3W96D 1BH9B 4YM6A 2RVQC 2IO5C 4XUJB 4HGAC 4H9RA 3AZIB 5B31A 3KWQB 4G92B 5GT0B 3LELB 1AOIB 5B32C 2HIOC 3X1TA 3AV1A 3AZHA 3AV2A 2HUEB 3AN2A 3UTAA 5FUGB 1M18B 2AROD 3LZ0B 4EO5B 5B1LA 3W96C 4JJND 4AWLC 3WAAB 3LZ1A 1P3BB 3UT9B 5CPJD 1ZLAD 3AZLD 3C1CB 3MNNB 4UUZB 1P3OA 1B6WA 1P3MB 3MVDD 1WWIA 5F99D 1KX3A 2AROC 3X1UA 4KUDB 3AYWB 4Z2MH 3UTBD 1P3GD 4JJNC 4LD9B 5AV5D 5GT3A 5B2JD 3MGQD 1HQ3B 2NQBA 1EQZB 5CPJC 3AZLC 5BNXB 2YFVB 3C1BB 2FJ7B 4J8WB 3A6NB 3MVDC 3MGRB 5F99C 1S32B 5B0YA 1KX4A 5DNNA 3LZ1C 3UTBC 1P3GC 4YM6B 2F8NG 3REKB 1ID3B 5AV5C 4H9RB 4QLCB 5B2JC 1U35B 5B31B 5B33A 3X1TB 1P34D 3AV1B 3X1SC 3KXBA 4NFTA 3AZHB 3AN2B 3B0CT 5CPKB 3UTAB 3W98A 3KSYA 3AFAA 4M6BA 1F66A 4WNNA 4J8UA 3WA9B 5BO0A 1P3PD 3MGPD 2NZDD 4R8PB 5DNMD 4X23D 1P3KA 4KGCB 3NQJA 5B0ZA 1P34C 4Z5TD 3B0DB 3O62B 5E5AD 1P3AD 3KWQA 3NQUB 3LELA 1AOIA 4H9PB 3AZMD 1M19A 4Z66A 5AV6B 5AY8B 5FUGA 1M18A 5GT3B 1P3PC 4XUJD 3MGPC 2NQBB 4G91C 5DNMC 2LY8A 4X23C 3AZID 4H9SC 4YS3A 4Z5TC 3RELD 3WAAA 5GT0D 3KUYA 3UT9A 5E5AC 5B24B 1P3AC 1BFMA 3TU4B 5AVBA 3WTPE 5B0YB 3AZMC 5CHLB 4NE6A 4UUZA 1KX4B 3LZ0D 5DNNB 1P3MA 3B6GA 1B67A 5B40A 4XUJC 4KUDA 3REJA 3AZIC 4ZUXA 2F8NB 3KWQC 3RELC 5GT0C 3KXBB 3C1CD 1HQ3A 3X1VB 2CV5A 3AZKB 5AV8A 3MNND 1EQZA 3LJAA 4H9NA 2HUEC 3W98B 5B32G 1P3FB 3AFAB 1F66B 3LZ0C 4EO5C 3C1BA 2FJ7A 4J8WA 3MGRA 3W99B 3VH6W 5BO0B 4LD9D 1P3KB 4J8XB 1P3BC 3NQJB 3REKA 5B0ZB 1ID3A 4QLCA 3C1CC 5BS7A 4XZQB 1U35A 5AV9D 3MNNC 3AZGA 3A6ND 3B6FA 1P3IB 1M19B 3AZNB 1P3LD 4Z66B 3AYWC 5CPKA 4YM6D 4LD9C 1KX5B 3WA9A 3AZFB 4YS3B 5JRGB 5B31D 5G49A 3KUYB 5B2IB 3X1TD 4R8PA 5CP6B 3B0BA 3AZEA 5AV9C 3AZHD 5GSUB 3AV2D 4KGCA 1M1AA 5AVBB 1ULYA 4J8WC 3A6NC 3UTAD 3O62A 3VH6T 4WU8A 1S32C 1P3LC 3W97B 5CPIB 5B1MB 5B1LD 3NQUA 5GXQA 4H9PA 1ZLAA 3B6GB 4YM6C 2CWEA 5B40B 5AVCA 3AZJB 2PYOA 5AV6A 3LZ1D 3REJB 5AY8A 4ZUXB 5B31C 3REHA 5C3IB 3X1TC 2CV5B 1H3OB 3AV1C 5AV8B 3LJAB 3AZHC 3AV2C 1P3OD 4H9NB 3AN2C 3VH5W 3UTAC 3X1SD 5BNVA 1KX3D 3X1UD 5B24A 3MGQA 5B1LC 3TU4A 3WKJA 5B32B 4ZBJB 2NQBD 1JFIB 1P3OC 2F8NA 3AZGB 1TZYA 3B6FB 3X1VA 3AZKA 1KX3C 3X1UC 1KX4D 4WU9A 1P3FA 5GT3C 2NQBC 3WTPA 3W99A 5G49B 3VH5T 5B33D 3AZEB 4J8XA 5KDMA 1M1AB 4JJNB 4WU8B 3W98D 4XZQA 5B0YC 2NZDA 3AFAD 1KX4C 1F66D 5DNNC 5GXQB 1ZLAB 4H9OB 4J8UD 3V9RA 1P3IA 5AVCB 3AZNA 2PYOB 1P3KD 3REHB 5B33C 5B0ZD 4DRBA 1KX5A 3X1VC 3KXBC 3AZKC 3AZFA 5BT1D 5JRGA 3KWQD 1P3GB 3LELD 1AOID 5B2IA 5BNVB 5CP6A 3W98C 1HTAA 5B2JB 1M19D 3MGQB 3AFAC 5GSUA 1F66C 4J8VA 4Z66D 2YFWB 4J8UC 3W99C 3WKJB 4Z2MG 1M18D 3W97A 3REIA 5B1MA 5CPIA 1P3KC 1WWSA 4YS3D 3AZJA 5B0ZC 4WV4B 3WAAD 3KUYD 1P3BD 3UT9D 3MGSA 1TAFB 5BT1C 1TZYB 4G92C 2L5AA 3LELC 1AOIC 5AVBD 1H3OA 1M19C 4Z66C
chains in the Genus database with same CATH superfamily
1P3MD 4WU9B 3B6GD 1M18C 5B40D 4KUDD 3AYWD 2BYMB 3WTPB 1N1JB 3REJD 4ZUXD 5B32A 2HIOA 4YS3C 3AZFC 3WAAC 3KUYC 1HQ3D 3UT9C 2CV5D 5KDMB 5AV8D 1EQZD 3LJAD 5AVBC 1P3PB 1JFIA 3MGPB 2NZDB 2F8NH 5DNMB 5JA4A 4X23B 1F1EA 3W96A 3C1BD 2FJ7D 4J8WD 1P3MC 3EPLA 2BYKA 3V9RB 3MGRD 1S32D 3B6GC 5B40C 4KUDC 5E5AB 1P3AB 1Q9CA 3REJC 4ZUXC 3REKD 2JSSA 1ID3D 3AZMB 4CAYA 4QLCD 5C3IC 1HQ3C 2CV5C 1U35D 5AV8C 1EQZC 2VQRA 3LJAC 1A7WA 5B31G 2F8NK 3AZGD 2AROA 3B6FD 3AV1D 4J8VB 2DF4C 3AN2D 3C1BC 2FJ7C 5CPKD 4JJNA 3H0LC 3MGRC 1KU5A 3RELB 3REIB 5CPJA 4H9OA 4ZBJC 3AZLA 3WA9D 4NE3A 3REKC 1ID3C 4QLCC 4R8PD 5BS7C 3AZED 1U35C 3MGSB 3MVDA 4KGCD 5F99A 1M1AD 3AZGC 2ZY5A 3B6FC 3O62D 4WU8D 3UTBA 1P3GA 5CPKC 2IO5B 5GXQD 4HGAB 5AV5A 5B2JA 5AVCD 2PYOD 3VH6A 5AV6D 2YFWA 3WA9C 5AY8D 2HIOB 3REHD 3X1SA 5GT3D 4R8PC 4KHAA 3AZEC 3R45A 3B0CW 4KGCC 1M1AC 1W2EA 2ZY4A 3B0DC 3P5JB 3O62C 4WU8C 5JA4B 3W96B 5B24D 1TAFA 2BYKB 1BH8A 3TU4D 4AWLB 2G5IC 5GXQC 1ZLAC 5B0YD 3WKJD 5AVCC 2PYOC 3EG5B 5DNND 5AV6C 5AV9B 3H0MC 4DQYB 5AY8C 1P34A 3REHC 4CAYB 1P3LB 2BYMA 1N1JA 2W8SA 2F8ND 1TZYD 2AROB 3X1VD 3KXBD 1PZRA 3AZKD 5B24C 3MGQC 3TU4C 1P3PA 4WU9D 3MGPA 1P3FD 3WKJC 5DNMA 4H9QA 4X23A 3AV2B 5CPJB 3AZLB 4H9SA 3WTPD 3W99D 4Z5TA 4DRAA 3A1KA 5E5AA 1P3AA 4J8XD 5B1LB 3MVDB 5F99B 4CSRA 1TZYC 4E45A 3AZMA 2Y2GA 3VH5A 4XZQD 3LZ1B 3UTBB 4E44A 5AV5B 1BH9A 4XUJA 4WU9C 1P3ID 1P3FC 3AZND 3AZIA 1P3OB 3WTPC 3X1SB 3RELA 5GT0A 3EPJA 1R4VA 1KX3B 3X1UB 1KX5D 4KHAB 3R45B 4WZSB 4J8XC 1Z2CB 3AZFD 5JRGD 5B2ID 3LZ0A 5CP6D 4XZQC 2NZDC 5GSUD 2BG1A 4J8VD 1BH8B 3IP4C 1P3IC 3AZNC 3W97D 2JE5A 5B1MD 3REID 5CPID 1P3BA 1P34B 3C1CA 3AZJD 2J8PA 1KX5C 3MNNA 3MGSD 5JRGC 5B2IC 5CP6C 3AYWA 5GSUC 4J8VC 2RVQD 5B33B 2Y2JA 4G91B 4LD9A 4H9QB 3W97C 5CPIC 5B1MC 3REIC 4Z5TB 5B32D 2HIOD 3AZJC 2Y2LA 5BNXA 2YFVA 5AV9A 4WNNB 4CSRB 3MGSC 3A6NA 4J8UB 4NE5A 1S32A 1P3LA 2Y2MA 3W96D 1BH9B 4YM6A 2RVQC 2IO5C 4XUJB 4HGAC 4H9RA 3AZIB 3EPKA 5B31A 3KWQB 4G92B 5GT0B 3LELB 1AOIB 5B32C 2HIOC 3X1TA 3AV1A 3AZHA 3AV2A 2HUEB 3AN2A 3UTAA 5FUGB 1M18B 2AROD 3LZ0B 4EO5B 5B1LA 3W96C 4JJND 4AWLC 3WAAB 3LZ1A 1P3BB 3UT9B 5CPJD 1ZLAD 3AZLD 3C1CB 2Y2KA 3MNNB 4UUZB 1P3OA 1B6WA 1P3MB 4UPKA 3MVDD 1WWIA 5F99D 2F2AC 1KX3A 2AROC 3X1UA 4KUDB 3AYWB 4Z2MH 3UTBD 1P3GD 4JJNC 4LD9B 5AV5D 5GT3A 5B2JD 3MGQD 1HQ3B 2NQBA 1EQZB 5CPJC 3AZLC 2Y2HA 2ZY2A 5BNXB 2YFVB 3C1BB 2FJ7B 4J8WB 3A6NB 3MVDC 3MGRB 5F99C 1S32B 2XD5A 3A1IA 5B0YA 1KX4A 5DNNA 3LZ1C 3UTBC 1P3GC 4YM6B 2F8NG 3KFUG 3REKB 2Y2NA 1ID3B 5AV5C 4H9RB 4QLCB 5B2JC 1U35B 5B31B 5B33A 3X1TB 1P34D 3AV1B 3X1SC 3KXBA 4NFTA 3AZHB 3AN2B 3B0CT 5CPKB 3UTAB 2FFFB 3W98A 3KSYA 3AFAA 4M6BA 1F66A 2XD1A 4WNNA 4J8UA 3WA9B 5BO0A 1P3PD 3MGPD 2NZDD 4R8PB 5DNMD 4X23D 1P3KA 2Y2OA 4KGCB 3NQJA 5B0ZA 1P34C 4Z5TD 3B0DB 3O62B 5E5AD 1P3AD 3KWQA 3NQUB 3LELA 1AOIA 3EPHA 4H9PB 3AZMD 1M19A 2JCHA 4Z66A 5AV6B 2Y2PA 5AY8B 5FUGA 1M18A 5GT3B 1P3PC 4XUJD 3MGPC 2NQBB 4G91C 5DNMC 2LY8A 4X23C 2ZM5A 3AZID 4H9SC 4YS3A 4Z5TC 3RELD 3WAAA 5GT0D 3KUYA 3UT9A 5E5AC 5B24B 1P3AC 1BFMA 3TU4B 5AVBA 3WTPE 5B0YB 3AZMC 5CHLB 4NE6A 4UUZA 1KX4B 3LZ0D 5DNNB 1P3MA 3B6GA 1B67A 5B40A 4XUJC 4KUDA 2UWXA 3REJA 3AZIC 4ZUXA 2F8NB 3KWQC 3RELC 5GT0C 3KXBB 3C1CD 1HQ3A 3X1VB 2CV5A 3AZKB 5AV8A 3MNND 1EQZA 3LJAA 3AL0C 4H9NA 2HUEC 3W98B 5B32G 1P3FB 3AFAB 1F66B 3LZ0C 4EO5C 3C1BA 2FJ7A 4J8WA 3MGRA 3W99B 3VH6W 5BO0B 2Y2IA 4LD9D 3FDDA 1T3UA 1P3KB 4J8XB 1P3BC 3NQJB 3REKA 5B0ZB 1ID3A 4QLCA 3C1CC 5BS7A 4XZQB 1U35A 5AV9D 3MNNC 3AZGA 3A6ND 3B6FA 1P3IB 1M19B 3AZNB 1P3LD 4Z66B 3AYWC 5CPKA 4YM6D 4LD9C 1KX5B 3WA9A 3AZFB 4YS3B 5JRGB 5B31D 5G49A 3KUYB 5B2IB 3X1TD 4R8PA 5CP6B 3B0BA 3AZEA 5AV9C 3AZHD 5GSUB 3H0RC 3AV2D 4KGCA 1M1AA 5AVBB 1ULYA 4J8WC 3A6NC 3UTAD 3O62A 3VH6T 4WU8A 1S32C 1P3LC 3W97B 5CPIB 5B1MB 5B1LD 3NQUA 5GXQA 4H9PA 1ZLAA 3F6TA 3B6GB 4YM6C 2CWEA 5B40B 5AVCA 3AZJB 2PYOA 5AV6A 3LZ1D 3REJB 5AY8A 4ZUXB 5B31C 3REHA 5C3IB 3X1TC 2CV5B 1H3OB 3AV1C 5AV8B 3LJAB 3AZHC 3AV2C 1P3OD 4H9NB 3AN2C 3VH5W 3UTAC 3X1SD 5BNVA 1KX3D 3X1UD 5B24A 3MGQA 5B1LC 3TU4A 3WKJA 5B32B 4ZBJB 2NQBD 1JFIB 2Y2QA 1P3OC 2F8NA 3AZGB 1TZYA 3B6FB 3X1VA 3AZKA 1KX3C 3X1UC 1KX4D 4WU9A 1P3FA 2ZY3A 5GT3C 2NQBC 3WTPA 3W99A 5G49B 3VH5T 5B33D 3AZEB 4J8XA 5KDMA 1M1AB 4JJNB 4WU8B 3W98D 4XZQA 5B0YC 2NZDA 3AFAD 1KX4C 1F66D 5DNNC 5GXQB 1ZLAB 4H9OB 4J8UD 3V9RA 1P3IA 5AVCB 3AZNA 2PYOB 2RIQA 1P3KD 3REHB 5B33C 5B0ZD 4DRBA 1KX5A 3X1VC 3KXBC 2DQNC 3AZKC 3AZFA 5BT1D 5JRGA 3KWQD 1P3GB 3LELD 1AOID 5B2IA 5BNVB 5CP6A 3W98C 1HTAA 5B2JB 1M19D 3MGQB 3AFAC 5GSUA 1F66C 4J8VA 4Z66D 2YFWB 4J8UC 3W99C 3WKJB 4Z2MG 1M18D 4WJ3C 3W97A 3REIA 5B1MA 5CPIA 1P3KC 1WWSA 4YS3D 3AZJA 5B0ZC 2G5HC 4WV4B 3WAAD 3KUYD 1P3BD 3UT9D 3MGSA 1TAFB 5BT1C 1TZYB 4G92C 2L5AA 3LELC 1AOIC 5AVBD 1H3OA 1M19C 4Z66C
chains in the Genus database with same CATH topology
1P3MD 4WU9B 3B6GD 1M18C 5B40D 4KUDD 3AYWD 2BYMB 3WTPB 1N1JB 3REJD 4ZUXD 5B32A 2HIOA 4YS3C 3AZFC 3WAAC 3KUYC 1HQ3D 3UT9C 2CV5D 5KDMB 5AV8D 1EQZD 3LJAD 5AVBC 1P3PB 1JFIA 3MGPB 2NZDB 2F8NH 5DNMB 5JA4A 4X23B 1F1EA 3W96A 3C1BD 2FJ7D 4J8WD 1P3MC 3EPLA 2BYKA 3V9RB 3MGRD 1S32D 3B6GC 5B40C 4KUDC 5E5AB 1P3AB 1Q9CA 3REJC 4ZUXC 3REKD 2JSSA 1ID3D 3AZMB 4CAYA 4QLCD 5C3IC 1HQ3C 2CV5C 1U35D 5AV8C 1EQZC 2VQRA 3LJAC 1A7WA 5B31G 2F8NK 3AZGD 2AROA 3B6FD 3AV1D 4J8VB 2DF4C 3AN2D 3C1BC 2FJ7C 5CPKD 4JJNA 3H0LC 3MGRC 1KU5A 3RELB 3REIB 5CPJA 4H9OA 4ZBJC 3AZLA 3WA9D 4NE3A 3REKC 1ID3C 4QLCC 4R8PD 5BS7C 3AZED 1U35C 3MGSB 3MVDA 4KGCD 5F99A 1M1AD 3AZGC 2ZY5A 3B6FC 3O62D 4WU8D 3UTBA 1P3GA 5CPKC 2IO5B 5GXQD 4HGAB 5AV5A 5B2JA 5AVCD 2PYOD 3VH6A 5AV6D 2YFWA 3WA9C 5AY8D 2HIOB 3REHD 3X1SA 5GT3D 4R8PC 4KHAA 3AZEC 3R45A 3B0CW 4KGCC 1M1AC 1W2EA 2ZY4A 3B0DC 3P5JB 3O62C 4WU8C 5JA4B 3W96B 5B24D 1TAFA 2BYKB 1BH8A 3TU4D 4AWLB 2G5IC 5GXQC 1ZLAC 5B0YD 3WKJD 5AVCC 2PYOC 3EG5B 5DNND 5AV6C 5AV9B 3H0MC 4DQYB 5AY8C 1P34A 3REHC 4CAYB 1P3LB 2BYMA 1N1JA 2W8SA 2F8ND 1TZYD 2AROB 3X1VD 3KXBD 1PZRA 3AZKD 5B24C 3MGQC 3TU4C 1P3PA 4WU9D 3MGPA 1P3FD 3WKJC 5DNMA 4H9QA 4X23A 3AV2B 5CPJB 3AZLB 4H9SA 3WTPD 3W99D 4Z5TA 4DRAA 3A1KA 5E5AA 1P3AA 4J8XD 5B1LB 3MVDB 5F99B 4CSRA 1TZYC 4E45A 3AZMA 2Y2GA 3VH5A 4XZQD 3LZ1B 3UTBB 4E44A 5AV5B 1BH9A 4XUJA 4WU9C 1P3ID 1P3FC 3AZND 3AZIA 1P3OB 3WTPC 3X1SB 3RELA 5GT0A 3EPJA 1R4VA 1KX3B 3X1UB 1KX5D 4KHAB 3R45B 4WZSB 4J8XC 1Z2CB 3AZFD 5JRGD 5B2ID 3LZ0A 5CP6D 4XZQC 2NZDC 5GSUD 2BG1A 4J8VD 1BH8B 3IP4C 1P3IC 3AZNC 3W97D 2JE5A 5B1MD 3REID 5CPID 1P3BA 1P34B 3C1CA 3AZJD 2J8PA 1KX5C 3MNNA 3MGSD 5JRGC 5B2IC 5CP6C 3AYWA 5GSUC 4J8VC 2RVQD 5B33B 2Y2JA 4G91B 4LD9A 4H9QB 3W97C 5CPIC 5B1MC 3REIC 4Z5TB 5B32D 2HIOD 3AZJC 2Y2LA 5BNXA 2YFVA 5AV9A 4WNNB 4CSRB 3MGSC 3A6NA 4J8UB 4NE5A 1S32A 1P3LA 2Y2MA 3W96D 1BH9B 4YM6A 2RVQC 2IO5C 4XUJB 4HGAC 4H9RA 3AZIB 3EPKA 5B31A 3KWQB 4G92B 5GT0B 3LELB 1AOIB 5B32C 2HIOC 3X1TA 3AV1A 3AZHA 3AV2A 2HUEB 3AN2A 3UTAA 5FUGB 1M18B 2AROD 3LZ0B 4EO5B 5B1LA 3W96C 4JJND 4AWLC 3WAAB 3LZ1A 1P3BB 3UT9B 5CPJD 1ZLAD 3AZLD 3C1CB 2Y2KA 3MNNB 4UUZB 1P3OA 1B6WA 1P3MB 4UPKA 3MVDD 1WWIA 5F99D 2F2AC 1KX3A 2AROC 3X1UA 4KUDB 3AYWB 4Z2MH 3UTBD 1P3GD 4JJNC 4LD9B 5AV5D 5GT3A 5B2JD 3MGQD 1HQ3B 2NQBA 1EQZB 5CPJC 3AZLC 2Y2HA 2ZY2A 5BNXB 2YFVB 3C1BB 2FJ7B 4J8WB 3A6NB 3MVDC 3MGRB 5F99C 1S32B 2XD5A 3A1IA 5B0YA 1KX4A 5DNNA 3LZ1C 3UTBC 1P3GC 4YM6B 2F8NG 3KFUG 3REKB 2Y2NA 1ID3B 5AV5C 4H9RB 4QLCB 5B2JC 1U35B 5B31B 5B33A 3X1TB 1P34D 3AV1B 3X1SC 3KXBA 4NFTA 3AZHB 3AN2B 3B0CT 5CPKB 3UTAB 2FFFB 3W98A 3KSYA 3AFAA 4M6BA 1F66A 2XD1A 4WNNA 4J8UA 3WA9B 5BO0A 1P3PD 3MGPD 2NZDD 4R8PB 5DNMD 4X23D 1P3KA 2Y2OA 4KGCB 3NQJA 5B0ZA 1P34C 4Z5TD 3B0DB 3O62B 5E5AD 1P3AD 3KWQA 3NQUB 3LELA 1AOIA 3EPHA 4H9PB 3AZMD 1M19A 2JCHA 4Z66A 5AV6B 2Y2PA 5AY8B 5FUGA 1M18A 5GT3B 1P3PC 4XUJD 3MGPC 2NQBB 4G91C 5DNMC 2LY8A 4X23C 2ZM5A 3AZID 4H9SC 4YS3A 4Z5TC 3RELD 3WAAA 5GT0D 3KUYA 3UT9A 5E5AC 5B24B 1P3AC 1BFMA 3TU4B 5AVBA 3WTPE 5B0YB 3AZMC 5CHLB 4NE6A 4UUZA 1KX4B 3LZ0D 5DNNB 1P3MA 3B6GA 1B67A 5B40A 4XUJC 4KUDA 2UWXA 3REJA 3AZIC 4ZUXA 2F8NB 3KWQC 3RELC 5GT0C 3KXBB 3C1CD 1HQ3A 3X1VB 2CV5A 3AZKB 5AV8A 3MNND 1EQZA 3LJAA 3AL0C 4H9NA 2HUEC 3W98B 5B32G 1P3FB 3AFAB 1F66B 3LZ0C 4EO5C 3C1BA 2FJ7A 4J8WA 3MGRA 3W99B 3VH6W 5BO0B 2Y2IA 4LD9D 3FDDA 1T3UA 1P3KB 4J8XB 1P3BC 3NQJB 3REKA 5B0ZB 1ID3A 4QLCA 3C1CC 5BS7A 4XZQB 1U35A 5AV9D 3MNNC 3AZGA 3A6ND 3B6FA 1P3IB 1M19B 3AZNB 1P3LD 4Z66B 3AYWC 5CPKA 4YM6D 4LD9C 1KX5B 3WA9A 3AZFB 4YS3B 5JRGB 5B31D 5G49A 3KUYB 5B2IB 3X1TD 4R8PA 5CP6B 3B0BA 3AZEA 5AV9C 3AZHD 5GSUB 3H0RC 3AV2D 4KGCA 1M1AA 5AVBB 1ULYA 4J8WC 3A6NC 3UTAD 3O62A 3VH6T 4WU8A 1S32C 1P3LC 3W97B 5CPIB 5B1MB 5B1LD 3NQUA 5GXQA 4H9PA 1ZLAA 3F6TA 3B6GB 4YM6C 2CWEA 5B40B 5AVCA 3AZJB 2PYOA 5AV6A 3LZ1D 3REJB 5AY8A 4ZUXB 5B31C 3REHA 5C3IB 3X1TC 2CV5B 1H3OB 3AV1C 5AV8B 3LJAB 3AZHC 3AV2C 1P3OD 4H9NB 3AN2C 3VH5W 3UTAC 3X1SD 5BNVA 1KX3D 3X1UD 5B24A 3MGQA 5B1LC 3TU4A 3WKJA 5B32B 4ZBJB 2NQBD 1JFIB 2Y2QA 1P3OC 2F8NA 3AZGB 1TZYA 3B6FB 3X1VA 3AZKA 1KX3C 3X1UC 1KX4D 4WU9A 1P3FA 2ZY3A 5GT3C 2NQBC 3WTPA 3W99A 5G49B 3VH5T 5B33D 3AZEB 4J8XA 5KDMA 1M1AB 4JJNB 4WU8B 3W98D 4XZQA 5B0YC 2NZDA 3AFAD 1KX4C 1F66D 5DNNC 5GXQB 1ZLAB 4H9OB 4J8UD 3V9RA 1P3IA 5AVCB 3AZNA 2PYOB 2RIQA 1P3KD 3REHB 5B33C 5B0ZD 4DRBA 1KX5A 3X1VC 3KXBC 2DQNC 3AZKC 3AZFA 5BT1D 5JRGA 3KWQD 1P3GB 3LELD 1AOID 5B2IA 5BNVB 5CP6A 3W98C 1HTAA 5B2JB 1M19D 3MGQB 3AFAC 5GSUA 1F66C 4J8VA 4Z66D 2YFWB 4J8UC 3W99C 3WKJB 4Z2MG 1M18D 4WJ3C 3W97A 3REIA 5B1MA 5CPIA 1P3KC 1WWSA 4YS3D 3AZJA 5B0ZC 2G5HC 4WV4B 3WAAD 3KUYD 1P3BD 3UT9D 3MGSA 1TAFB 5BT1C 1TZYB 4G92C 2L5AA 3LELC 1AOIC 5AVBD 1H3OA 1M19C 4Z66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M D;  4WU9 B;  3B6G D;  1M18 C;  5B40 D;  4KUD D;  3AYW D;  2BYM B;  3WTP B;  1N1J B;  3REJ D;  4ZUX D;  5B32 A;  2HIO A;  4YS3 C;  3AZF C;  3WAA C;  3KUY C;  1HQ3 D;  3UT9 C;  2CV5 D;  5KDM B;  5AV8 D;  1EQZ D;  3LJA D;  5AVB C;  1P3P B;  1JFI A;  3MGP B;  2NZD B;  2F8N H;  5DNM B;  5JA4 A;  4X23 B;  1F1E A;  3W96 A;  3C1B D;  2FJ7 D;  4J8W D;  1P3M C;  2BYK A;  3V9R B;  3MGR D;  1S32 D;  3B6G C;  5B40 C;  4KUD C;  5E5A B;  1P3A B;  1Q9C A;  3REJ C;  4ZUX C;  3REK D;  2JSS A;  1ID3 D;  3AZM B;  4CAY A;  4QLC D;  5C3I C;  1HQ3 C;  2CV5 C;  1U35 D;  5AV8 C;  1EQZ C;  3LJA C;  1A7W A;  5B31 G;  2F8N K;  3AZG D;  2ARO A;  3B6F D;  3AV1 D;  4J8V B;  3AN2 D;  3C1B C;  2FJ7 C;  5CPK D;  4JJN A;  3MGR C;  1KU5 A;  3REL B;  3REI B;  5CPJ A;  4H9O A;  4ZBJ C;  3AZL A;  3WA9 D;  4NE3 A;  3REK C;  1ID3 C;  4QLC C;  4R8P D;  5BS7 C;  3AZE D;  1U35 C;  3MGS B;  3MVD A;  4KGC D;  5F99 A;  1M1A D;  3AZG C;  3B6F C;  3O62 D;  4WU8 D;  3UTB A;  1P3G A;  5CPK C;  2IO5 B;  5GXQ D;  4HGA B;  5AV5 A;  5B2J A;  5AVC D;  2PYO D;  3VH6 A;  5AV6 D;  2YFW A;  3WA9 C;  5AY8 D;  2HIO B;  3REH D;  3X1S A;  5GT3 D;  4R8P C;  4KHA A;  3AZE C;  3R45 A;  3B0C W;  4KGC C;  1M1A C;  3B0D C;  3O62 C;  4WU8 C;  5JA4 B;  3W96 B;  5B24 D;  1TAF A;  2BYK B;  1BH8 A;  3TU4 D;  4AWL B;  5GXQ C;  1ZLA C;  5B0Y D;  3WKJ D;  5AVC C;  2PYO C;  5DNN D;  5AV6 C;  5AV9 B;  5AY8 C;  1P34 A;  3REH C;  4CAY B;  1P3L B;  2BYM A;  1N1J A;  2F8N D;  1TZY D;  2ARO B;  3X1V D;  3KXB D;  3AZK D;  5B24 C;  3MGQ C;  3TU4 C;  1P3P A;  4WU9 D;  3MGP A;  1P3F D;  3WKJ C;  5DNM A;  4H9Q A;  4X23 A;  3AV2 B;  5CPJ B;  3AZL B;  4H9S A;  3WTP D;  3W99 D;  4Z5T A;  4DRA A;  5E5A A;  1P3A A;  4J8X D;  5B1L B;  3MVD B;  5F99 B;  4CSR A;  1TZY C;  4E45 A;  3AZM A;  3VH5 A;  4XZQ D;  3LZ1 B;  3UTB B;  4E44 A;  5AV5 B;  1BH9 A;  4XUJ A;  4WU9 C;  1P3I D;  1P3F C;  3AZN D;  3AZI A;  1P3O B;  3WTP C;  3X1S B;  3REL A;  5GT0 A;  1R4V A;  1KX3 B;  3X1U B;  1KX5 D;  4KHA B;  3R45 B;  4WZS B;  4J8X C;  3AZF D;  5JRG D;  5B2I D;  3LZ0 A;  5CP6 D;  4XZQ C;  2NZD C;  5GSU D;  4J8V D;  1BH8 B;  1P3I C;  3AZN C;  3W97 D;  3REI D;  5B1M D;  5CPI D;  1P3B A;  1P34 B;  3C1C A;  3AZJ D;  1KX5 C;  3MNN A;  3MGS D;  5JRG C;  5B2I C;  5CP6 C;  3AYW A;  5GSU C;  4J8V C;  2RVQ D;  5B33 B;  4LD9 A;  4G91 B;  4H9Q B;  3W97 C;  5CPI C;  5B1M C;  3REI C;  4Z5T B;  5B32 D;  2HIO D;  3AZJ C;  5BNX A;  2YFV A;  5AV9 A;  4WNN B;  4CSR B;  3MGS C;  3A6N A;  4J8U B;  4NE5 A;  1S32 A;  1P3L A;  3W96 D;  1BH9 B;  4YM6 A;  2RVQ C;  2IO5 C;  4XUJ B;  4HGA C;  4H9R A;  3AZI B;  5B31 A;  3KWQ B;  4G92 B;  5GT0 B;  3LEL B;  1AOI B;  5B32 C;  2HIO C;  3X1T A;  3AV1 A;  3AZH A;  3AV2 A;  2HUE B;  3AN2 A;  3UTA A;  5FUG B;  1M18 B;  2ARO D;  3LZ0 B;  4EO5 B;  5B1L A;  3W96 C;  4JJN D;  4AWL C;  3WAA B;  3LZ1 A;  1P3B B;  3UT9 B;  5CPJ D;  1ZLA D;  3AZL D;  3C1C B;  3MNN B;  4UUZ B;  1P3O A;  1B6W A;  1P3M B;  3MVD D;  1WWI A;  5F99 D;  1KX3 A;  2ARO C;  3X1U A;  4KUD B;  3AYW B;  4Z2M H;  3UTB D;  1P3G D;  4JJN C;  4LD9 B;  5AV5 D;  5GT3 A;  5B2J D;  3MGQ D;  1HQ3 B;  2NQB A;  1EQZ B;  5CPJ C;  3AZL C;  5BNX B;  2YFV B;  3C1B B;  2FJ7 B;  4J8W B;  3A6N B;  3MVD C;  3MGR B;  5F99 C;  1S32 B;  5B0Y A;  1KX4 A;  5DNN A;  3LZ1 C;  3UTB C;  1P3G C;  4YM6 B;  2F8N G;  3REK B;  1ID3 B;  5AV5 C;  4H9R B;  4QLC B;  5B2J C;  1U35 B;  5B31 B;  5B33 A;  3X1T B;  1P34 D;  3AV1 B;  3X1S C;  3KXB A;  4NFT A;  3AZH B;  3AN2 B;  3B0C T;  5CPK B;  3UTA B;  3W98 A;  3KSY A;  3AFA A;  4M6B A;  1F66 A;  4WNN A;  4J8U A;  3WA9 B;  5BO0 A;  1P3P D;  3MGP D;  2NZD D;  4R8P B;  5DNM D;  4X23 D;  1P3K A;  4KGC B;  3NQJ A;  5B0Z A;  1P34 C;  4Z5T D;  3B0D B;  3O62 B;  5E5A D;  1P3A D;  3KWQ A;  3NQU B;  3LEL A;  1AOI A;  4H9P B;  3AZM D;  1M19 A;  4Z66 A;  5AV6 B;  5AY8 B;  5FUG A;  1M18 A;  5GT3 B;  1P3P C;  4XUJ D;  3MGP C;  2NQB B;  4G91 C;  5DNM C;  2LY8 A;  4X23 C;  3AZI D;  4H9S C;  4YS3 A;  4Z5T C;  3REL D;  3WAA A;  5GT0 D;  3KUY A;  3UT9 A;  5E5A C;  5B24 B;  1P3A C;  1BFM A;  3TU4 B;  5AVB A;  3WTP E;  5B0Y B;  3AZM C;  5CHL B;  4NE6 A;  4UUZ A;  1KX4 B;  3LZ0 D;  5DNN B;  1P3M A;  3B6G A;  1B67 A;  5B40 A;  4XUJ C;  4KUD A;  3REJ A;  3AZI C;  4ZUX A;  2F8N B;  3KWQ C;  3REL C;  5GT0 C;  3KXB B;  3C1C D;  1HQ3 A;  3X1V B;  2CV5 A;  3AZK B;  5AV8 A;  3MNN D;  1EQZ A;  3LJA A;  4H9N A;  2HUE C;  3W98 B;  5B32 G;  1P3F B;  3AFA B;  1F66 B;  3LZ0 C;  4EO5 C;  3C1B A;  2FJ7 A;  4J8W A;  3MGR A;  3W99 B;  3VH6 W;  5BO0 B;  4LD9 D;  1P3K B;  4J8X B;  1P3B C;  3NQJ B;  3REK A;  5B0Z B;  1ID3 A;  4QLC A;  3C1C C;  5BS7 A;  4XZQ B;  1U35 A;  5AV9 D;  3MNN C;  3AZG A;  3A6N D;  3B6F A;  1P3I B;  1M19 B;  3AZN B;  1P3L D;  4Z66 B;  3AYW C;  5CPK A;  4YM6 D;  4LD9 C;  1KX5 B;  3WA9 A;  3AZF B;  4YS3 B;  5JRG B;  5B31 D;  5G49 A;  3KUY B;  5B2I B;  3X1T D;  4R8P A;  5CP6 B;  3B0B A;  3AZE A;  5AV9 C;  3AZH D;  5GSU B;  3AV2 D;  4KGC A;  1M1A A;  5AVB B;  1ULY A;  4J8W C;  3A6N C;  3UTA D;  3O62 A;  3VH6 T;  4WU8 A;  1S32 C;  1P3L C;  3W97 B;  5CPI B;  5B1M B;  5B1L D;  3NQU A;  5GXQ A;  4H9P A;  1ZLA A;  3B6G B;  4YM6 C;  2CWE A;  5B40 B;  5AVC A;  3AZJ B;  2PYO A;  5AV6 A;  3LZ1 D;  3REJ B;  5AY8 A;  4ZUX B;  5B31 C;  3REH A;  5C3I B;  3X1T C;  2CV5 B;  1H3O B;  3AV1 C;  5AV8 B;  3LJA B;  3AZH C;  3AV2 C;  1P3O D;  4H9N B;  3AN2 C;  3VH5 W;  3UTA C;  3X1S D;  5BNV A;  1KX3 D;  3X1U D;  5B24 A;  3MGQ A;  5B1L C;  3TU4 A;  3WKJ A;  5B32 B;  4ZBJ B;  2NQB D;  1JFI B;  1P3O C;  2F8N A;  3AZG B;  1TZY A;  3B6F B;  3X1V A;  3AZK A;  1KX3 C;  3X1U C;  1KX4 D;  4WU9 A;  1P3F A;  5GT3 C;  2NQB C;  3WTP A;  3W99 A;  5G49 B;  3VH5 T;  5B33 D;  3AZE B;  4J8X A;  5KDM A;  1M1A B;  4JJN B;  4WU8 B;  3W98 D;  4XZQ A;  5B0Y C;  2NZD A;  3AFA D;  1KX4 C;  1F66 D;  5DNN C;  5GXQ B;  1ZLA B;  4H9O B;  4J8U D;  3V9R A;  1P3I A;  5AVC B;  3AZN A;  2PYO B;  1P3K D;  3REH B;  5B33 C;  5B0Z D;  4DRB A;  1KX5 A;  3X1V C;  3KXB C;  3AZK C;  3AZF A;  5BT1 D;  5JRG A;  3KWQ D;  1P3G B;  3LEL D;  1AOI D;  5B2I A;  5BNV B;  5CP6 A;  3W98 C;  1HTA A;  5B2J B;  1M19 D;  3MGQ B;  3AFA C;  5GSU A;  1F66 C;  4J8V A;  4Z66 D;  2YFW B;  4J8U C;  3W99 C;  3WKJ B;  4Z2M G;  1M18 D;  3W97 A;  3REI A;  5B1M A;  5CPI A;  1P3K C;  1WWS A;  4YS3 D;  3AZJ A;  5B0Z C;  4WV4 B;  3WAA D;  3KUY D;  1P3B D;  3UT9 D;  3MGS A;  1TAF B;  5BT1 C;  1TZY B;  4G92 C;  2L5A A;  3LEL C;  1AOI C;  5AVB D;  1H3O A;  1M19 C;  4Z66 C; 
#chains in the Genus database with same CATH topology
 1P3M D;  4WU9 B;  3B6G D;  1M18 C;  5B40 D;  4KUD D;  3AYW D;  2BYM B;  3WTP B;  1N1J B;  3REJ D;  4ZUX D;  5B32 A;  2HIO A;  4YS3 C;  3AZF C;  3WAA C;  3KUY C;  1HQ3 D;  3UT9 C;  2CV5 D;  5KDM B;  5AV8 D;  1EQZ D;  3LJA D;  5AVB C;  1P3P B;  1JFI A;  3MGP B;  2NZD B;  2F8N H;  5DNM B;  5JA4 A;  4X23 B;  1F1E A;  3W96 A;  3C1B D;  2FJ7 D;  4J8W D;  1P3M C;  3EPL A;  2BYK A;  3V9R B;  3MGR D;  1S32 D;  3B6G C;  5B40 C;  4KUD C;  5E5A B;  1P3A B;  1Q9C A;  3REJ C;  4ZUX C;  3REK D;  2JSS A;  1ID3 D;  3AZM B;  4CAY A;  4QLC D;  5C3I C;  1HQ3 C;  2CV5 C;  1U35 D;  5AV8 C;  1EQZ C;  2VQR A;  3LJA C;  1A7W A;  5B31 G;  2F8N K;  3AZG D;  2ARO A;  3B6F D;  3AV1 D;  4J8V B;  2DF4 C;  3AN2 D;  3C1B C;  2FJ7 C;  5CPK D;  4JJN A;  3H0L C;  3MGR C;  1KU5 A;  3REL B;  3REI B;  5CPJ A;  4H9O A;  4ZBJ C;  3AZL A;  3WA9 D;  4NE3 A;  3REK C;  1ID3 C;  4QLC C;  4R8P D;  5BS7 C;  3AZE D;  1U35 C;  3MGS B;  3MVD A;  4KGC D;  5F99 A;  1M1A D;  3AZG C;  2ZY5 A;  3B6F C;  3O62 D;  4WU8 D;  3UTB A;  1P3G A;  5CPK C;  2IO5 B;  5GXQ D;  4HGA B;  5AV5 A;  5B2J A;  5AVC D;  2PYO D;  3VH6 A;  5AV6 D;  2YFW A;  3WA9 C;  5AY8 D;  2HIO B;  3REH D;  3X1S A;  5GT3 D;  4R8P C;  4KHA A;  3AZE C;  3R45 A;  3B0C W;  4KGC C;  1M1A C;  1W2E A;  2ZY4 A;  3B0D C;  3P5J B;  3O62 C;  4WU8 C;  5JA4 B;  3W96 B;  5B24 D;  1TAF A;  2BYK B;  1BH8 A;  3TU4 D;  4AWL B;  2G5I C;  5GXQ C;  1ZLA C;  5B0Y D;  3WKJ D;  5AVC C;  2PYO C;  3EG5 B;  5DNN D;  5AV6 C;  5AV9 B;  3H0M C;  4DQY B;  5AY8 C;  1P34 A;  3REH C;  4CAY B;  1P3L B;  2BYM A;  1N1J A;  2W8S A;  2F8N D;  1TZY D;  2ARO B;  3X1V D;  3KXB D;  1PZR A;  3AZK D;  5B24 C;  3MGQ C;  3TU4 C;  1P3P A;  4WU9 D;  3MGP A;  1P3F D;  3WKJ C;  5DNM A;  4H9Q A;  4X23 A;  3AV2 B;  5CPJ B;  3AZL B;  4H9S A;  3WTP D;  3W99 D;  4Z5T A;  4DRA A;  3A1K A;  5E5A A;  1P3A A;  4J8X D;  5B1L B;  3MVD B;  5F99 B;  4CSR A;  1TZY C;  4E45 A;  3AZM A;  2Y2G A;  3VH5 A;  4XZQ D;  3LZ1 B;  3UTB B;  4E44 A;  5AV5 B;  1BH9 A;  4XUJ A;  4WU9 C;  1P3I D;  1P3F C;  3AZN D;  3AZI A;  1P3O B;  3WTP C;  3X1S B;  3REL A;  5GT0 A;  3EPJ A;  1R4V A;  1KX3 B;  3X1U B;  1KX5 D;  4KHA B;  3R45 B;  4WZS B;  4J8X C;  1Z2C B;  3AZF D;  5JRG D;  5B2I D;  3LZ0 A;  5CP6 D;  4XZQ C;  2NZD C;  5GSU D;  2BG1 A;  4J8V D;  1BH8 B;  3IP4 C;  1P3I C;  3AZN C;  3W97 D;  2JE5 A;  5B1M D;  3REI D;  5CPI D;  1P3B A;  1P34 B;  3C1C A;  3AZJ D;  2J8P A;  1KX5 C;  3MNN A;  3MGS D;  5JRG C;  5B2I C;  5CP6 C;  3AYW A;  5GSU C;  4J8V C;  2RVQ D;  5B33 B;  2Y2J A;  4G91 B;  4LD9 A;  4H9Q B;  3W97 C;  5CPI C;  5B1M C;  3REI C;  4Z5T B;  5B32 D;  2HIO D;  3AZJ C;  2Y2L A;  5BNX A;  2YFV A;  5AV9 A;  4WNN B;  4CSR B;  3MGS C;  3A6N A;  4J8U B;  4NE5 A;  1S32 A;  1P3L A;  2Y2M A;  3W96 D;  1BH9 B;  4YM6 A;  2RVQ C;  2IO5 C;  4XUJ B;  4HGA C;  4H9R A;  3AZI B;  3EPK A;  5B31 A;  3KWQ B;  4G92 B;  5GT0 B;  3LEL B;  1AOI B;  5B32 C;  2HIO C;  3X1T A;  3AV1 A;  3AZH A;  3AV2 A;  2HUE B;  3AN2 A;  3UTA A;  5FUG B;  1M18 B;  2ARO D;  3LZ0 B;  4EO5 B;  5B1L A;  3W96 C;  4JJN D;  4AWL C;  3WAA B;  3LZ1 A;  1P3B B;  3UT9 B;  5CPJ D;  1ZLA D;  3AZL D;  3C1C B;  2Y2K A;  3MNN B;  4UUZ B;  1P3O A;  1B6W A;  1P3M B;  4UPK A;  3MVD D;  1WWI A;  5F99 D;  2F2A C;  1KX3 A;  2ARO C;  3X1U A;  4KUD B;  3AYW B;  4Z2M H;  3UTB D;  1P3G D;  4JJN C;  4LD9 B;  5AV5 D;  5GT3 A;  5B2J D;  3MGQ D;  1HQ3 B;  2NQB A;  1EQZ B;  5CPJ C;  3AZL C;  2Y2H A;  2ZY2 A;  5BNX B;  2YFV B;  3C1B B;  2FJ7 B;  4J8W B;  3A6N B;  3MVD C;  3MGR B;  5F99 C;  1S32 B;  2XD5 A;  3A1I A;  5B0Y A;  1KX4 A;  5DNN A;  3LZ1 C;  3UTB C;  1P3G C;  4YM6 B;  2F8N G;  3KFU G;  3REK B;  2Y2N A;  1ID3 B;  5AV5 C;  4H9R B;  4QLC B;  5B2J C;  1U35 B;  5B31 B;  5B33 A;  3X1T B;  1P34 D;  3AV1 B;  3X1S C;  3KXB A;  4NFT A;  3AZH B;  3AN2 B;  3B0C T;  5CPK B;  3UTA B;  2FFF B;  3W98 A;  3KSY A;  3AFA A;  4M6B A;  1F66 A;  2XD1 A;  4WNN A;  4J8U A;  3WA9 B;  5BO0 A;  1P3P D;  3MGP D;  2NZD D;  4R8P B;  5DNM D;  4X23 D;  1P3K A;  2Y2O A;  4KGC B;  3NQJ A;  5B0Z A;  1P34 C;  4Z5T D;  3B0D B;  3O62 B;  5E5A D;  1P3A D;  3KWQ A;  3NQU B;  3LEL A;  1AOI A;  3EPH A;  4H9P B;  3AZM D;  1M19 A;  2JCH A;  4Z66 A;  5AV6 B;  2Y2P A;  5AY8 B;  5FUG A;  1M18 A;  5GT3 B;  1P3P C;  4XUJ D;  3MGP C;  2NQB B;  4G91 C;  5DNM C;  2LY8 A;  4X23 C;  2ZM5 A;  3AZI D;  4H9S C;  4YS3 A;  4Z5T C;  3REL D;  3WAA A;  5GT0 D;  3KUY A;  3UT9 A;  5E5A C;  5B24 B;  1P3A C;  1BFM A;  3TU4 B;  5AVB A;  3WTP E;  5B0Y B;  3AZM C;  5CHL B;  4NE6 A;  4UUZ A;  1KX4 B;  3LZ0 D;  5DNN B;  1P3M A;  3B6G A;  1B67 A;  5B40 A;  4XUJ C;  4KUD A;  2UWX A;  3REJ A;  3AZI C;  4ZUX A;  2F8N B;  3KWQ C;  3REL C;  5GT0 C;  3KXB B;  3C1C D;  1HQ3 A;  3X1V B;  2CV5 A;  3AZK B;  5AV8 A;  3MNN D;  1EQZ A;  3LJA A;  3AL0 C;  4H9N A;  2HUE C;  3W98 B;  5B32 G;  1P3F B;  3AFA B;  1F66 B;  3LZ0 C;  4EO5 C;  3C1B A;  2FJ7 A;  4J8W A;  3MGR A;  3W99 B;  3VH6 W;  5BO0 B;  2Y2I A;  4LD9 D;  3FDD A;  1T3U A;  1P3K B;  4J8X B;  1P3B C;  3NQJ B;  3REK A;  5B0Z B;  1ID3 A;  4QLC A;  3C1C C;  5BS7 A;  4XZQ B;  1U35 A;  5AV9 D;  3MNN C;  3AZG A;  3A6N D;  3B6F A;  1P3I B;  1M19 B;  3AZN B;  1P3L D;  4Z66 B;  3AYW C;  5CPK A;  4YM6 D;  4LD9 C;  1KX5 B;  3WA9 A;  3AZF B;  4YS3 B;  5JRG B;  5B31 D;  5G49 A;  3KUY B;  5B2I B;  3X1T D;  4R8P A;  5CP6 B;  3B0B A;  3AZE A;  5AV9 C;  3AZH D;  5GSU B;  3H0R C;  3AV2 D;  4KGC A;  1M1A A;  5AVB B;  1ULY A;  4J8W C;  3A6N C;  3UTA D;  3O62 A;  3VH6 T;  4WU8 A;  1S32 C;  1P3L C;  3W97 B;  5CPI B;  5B1M B;  5B1L D;  3NQU A;  5GXQ A;  4H9P A;  1ZLA A;  3F6T A;  3B6G B;  4YM6 C;  2CWE A;  5B40 B;  5AVC A;  3AZJ B;  2PYO A;  5AV6 A;  3LZ1 D;  3REJ B;  5AY8 A;  4ZUX B;  5B31 C;  3REH A;  5C3I B;  3X1T C;  2CV5 B;  1H3O B;  3AV1 C;  5AV8 B;  3LJA B;  3AZH C;  3AV2 C;  1P3O D;  4H9N B;  3AN2 C;  3VH5 W;  3UTA C;  3X1S D;  5BNV A;  1KX3 D;  3X1U D;  5B24 A;  3MGQ A;  5B1L C;  3TU4 A;  3WKJ A;  5B32 B;  4ZBJ B;  2NQB D;  1JFI B;  2Y2Q A;  1P3O C;  2F8N A;  3AZG B;  1TZY A;  3B6F B;  3X1V A;  3AZK A;  1KX3 C;  3X1U C;  1KX4 D;  4WU9 A;  1P3F A;  2ZY3 A;  5GT3 C;  2NQB C;  3WTP A;  3W99 A;  5G49 B;  3VH5 T;  5B33 D;  3AZE B;  4J8X A;  5KDM A;  1M1A B;  4JJN B;  4WU8 B;  3W98 D;  4XZQ A;  5B0Y C;  2NZD A;  3AFA D;  1KX4 C;  1F66 D;  5DNN C;  5GXQ B;  1ZLA B;  4H9O B;  4J8U D;  3V9R A;  1P3I A;  5AVC B;  3AZN A;  2PYO B;  2RIQ A;  1P3K D;  3REH B;  5B33 C;  5B0Z D;  4DRB A;  1KX5 A;  3X1V C;  3KXB C;  2DQN C;  3AZK C;  3AZF A;  5BT1 D;  5JRG A;  3KWQ D;  1P3G B;  3LEL D;  1AOI D;  5B2I A;  5BNV B;  5CP6 A;  3W98 C;  1HTA A;  5B2J B;  1M19 D;  3MGQ B;  3AFA C;  5GSU A;  1F66 C;  4J8V A;  4Z66 D;  2YFW B;  4J8U C;  3W99 C;  3WKJ B;  4Z2M G;  1M18 D;  4WJ3 C;  3W97 A;  3REI A;  5B1M A;  5CPI A;  1P3K C;  1WWS A;  4YS3 D;  3AZJ A;  5B0Z C;  2G5H C;  4WV4 B;  3WAA D;  3KUY D;  1P3B D;  3UT9 D;  3MGS A;  1TAF B;  5BT1 C;  1TZY B;  4G92 C;  2L5A A;  3LEL C;  1AOI C;  5AVB D;  1H3O A;  1M19 C;  4Z66 C; 
#chains in the Genus database with same CATH homology
 1P3M D;  4WU9 B;  3B6G D;  1M18 C;  5B40 D;  4KUD D;  3AYW D;  2BYM B;  3WTP B;  1N1J B;  3REJ D;  4ZUX D;  5B32 A;  2HIO A;  4YS3 C;  3AZF C;  3WAA C;  3KUY C;  1HQ3 D;  3UT9 C;  2CV5 D;  5KDM B;  5AV8 D;  1EQZ D;  3LJA D;  5AVB C;  1P3P B;  1JFI A;  3MGP B;  2NZD B;  2F8N H;  5DNM B;  5JA4 A;  4X23 B;  1F1E A;  3W96 A;  3C1B D;  2FJ7 D;  4J8W D;  1P3M C;  3EPL A;  2BYK A;  3V9R B;  3MGR D;  1S32 D;  3B6G C;  5B40 C;  4KUD C;  5E5A B;  1P3A B;  1Q9C A;  3REJ C;  4ZUX C;  3REK D;  2JSS A;  1ID3 D;  3AZM B;  4CAY A;  4QLC D;  5C3I C;  1HQ3 C;  2CV5 C;  1U35 D;  5AV8 C;  1EQZ C;  2VQR A;  3LJA C;  1A7W A;  5B31 G;  2F8N K;  3AZG D;  2ARO A;  3B6F D;  3AV1 D;  4J8V B;  2DF4 C;  3AN2 D;  3C1B C;  2FJ7 C;  5CPK D;  4JJN A;  3H0L C;  3MGR C;  1KU5 A;  3REL B;  3REI B;  5CPJ A;  4H9O A;  4ZBJ C;  3AZL A;  3WA9 D;  4NE3 A;  3REK C;  1ID3 C;  4QLC C;  4R8P D;  5BS7 C;  3AZE D;  1U35 C;  3MGS B;  3MVD A;  4KGC D;  5F99 A;  1M1A D;  3AZG C;  2ZY5 A;  3B6F C;  3O62 D;  4WU8 D;  3UTB A;  1P3G A;  5CPK C;  2IO5 B;  5GXQ D;  4HGA B;  5AV5 A;  5B2J A;  5AVC D;  2PYO D;  3VH6 A;  5AV6 D;  2YFW A;  3WA9 C;  5AY8 D;  2HIO B;  3REH D;  3X1S A;  5GT3 D;  4R8P C;  4KHA A;  3AZE C;  3R45 A;  3B0C W;  4KGC C;  1M1A C;  1W2E A;  2ZY4 A;  3B0D C;  3P5J B;  3O62 C;  4WU8 C;  5JA4 B;  3W96 B;  5B24 D;  1TAF A;  2BYK B;  1BH8 A;  3TU4 D;  4AWL B;  2G5I C;  5GXQ C;  1ZLA C;  5B0Y D;  3WKJ D;  5AVC C;  2PYO C;  3EG5 B;  5DNN D;  5AV6 C;  5AV9 B;  3H0M C;  4DQY B;  5AY8 C;  1P34 A;  3REH C;  4CAY B;  1P3L B;  2BYM A;  1N1J A;  2W8S A;  2F8N D;  1TZY D;  2ARO B;  3X1V D;  3KXB D;  1PZR A;  3AZK D;  5B24 C;  3MGQ C;  3TU4 C;  1P3P A;  4WU9 D;  3MGP A;  1P3F D;  3WKJ C;  5DNM A;  4H9Q A;  4X23 A;  3AV2 B;  5CPJ B;  3AZL B;  4H9S A;  3WTP D;  3W99 D;  4Z5T A;  4DRA A;  3A1K A;  5E5A A;  1P3A A;  4J8X D;  5B1L B;  3MVD B;  5F99 B;  4CSR A;  1TZY C;  4E45 A;  3AZM A;  2Y2G A;  3VH5 A;  4XZQ D;  3LZ1 B;  3UTB B;  4E44 A;  5AV5 B;  1BH9 A;  4XUJ A;  4WU9 C;  1P3I D;  1P3F C;  3AZN D;  3AZI A;  1P3O B;  3WTP C;  3X1S B;  3REL A;  5GT0 A;  3EPJ A;  1R4V A;  1KX3 B;  3X1U B;  1KX5 D;  4KHA B;  3R45 B;  4WZS B;  4J8X C;  1Z2C B;  3AZF D;  5JRG D;  5B2I D;  3LZ0 A;  5CP6 D;  4XZQ C;  2NZD C;  5GSU D;  2BG1 A;  4J8V D;  1BH8 B;  3IP4 C;  1P3I C;  3AZN C;  3W97 D;  2JE5 A;  5B1M D;  3REI D;  5CPI D;  1P3B A;  1P34 B;  3C1C A;  3AZJ D;  2J8P A;  1KX5 C;  3MNN A;  3MGS D;  5JRG C;  5B2I C;  5CP6 C;  3AYW A;  5GSU C;  4J8V C;  2RVQ D;  5B33 B;  2Y2J A;  4G91 B;  4LD9 A;  4H9Q B;  3W97 C;  5CPI C;  5B1M C;  3REI C;  4Z5T B;  5B32 D;  2HIO D;  3AZJ C;  2Y2L A;  5BNX A;  2YFV A;  5AV9 A;  4WNN B;  4CSR B;  3MGS C;  3A6N A;  4J8U B;  4NE5 A;  1S32 A;  1P3L A;  2Y2M A;  3W96 D;  1BH9 B;  4YM6 A;  2RVQ C;  2IO5 C;  4XUJ B;  4HGA C;  4H9R A;  3AZI B;  3EPK A;  5B31 A;  3KWQ B;  4G92 B;  5GT0 B;  3LEL B;  1AOI B;  5B32 C;  2HIO C;  3X1T A;  3AV1 A;  3AZH A;  3AV2 A;  2HUE B;  3AN2 A;  3UTA A;  5FUG B;  1M18 B;  2ARO D;  3LZ0 B;  4EO5 B;  5B1L A;  3W96 C;  4JJN D;  4AWL C;  3WAA B;  3LZ1 A;  1P3B B;  3UT9 B;  5CPJ D;  1ZLA D;  3AZL D;  3C1C B;  2Y2K A;  3MNN B;  4UUZ B;  1P3O A;  1B6W A;  1P3M B;  4UPK A;  3MVD D;  1WWI A;  5F99 D;  2F2A C;  1KX3 A;  2ARO C;  3X1U A;  4KUD B;  3AYW B;  4Z2M H;  3UTB D;  1P3G D;  4JJN C;  4LD9 B;  5AV5 D;  5GT3 A;  5B2J D;  3MGQ D;  1HQ3 B;  2NQB A;  1EQZ B;  5CPJ C;  3AZL C;  2Y2H A;  2ZY2 A;  5BNX B;  2YFV B;  3C1B B;  2FJ7 B;  4J8W B;  3A6N B;  3MVD C;  3MGR B;  5F99 C;  1S32 B;  2XD5 A;  3A1I A;  5B0Y A;  1KX4 A;  5DNN A;  3LZ1 C;  3UTB C;  1P3G C;  4YM6 B;  2F8N G;  3KFU G;  3REK B;  2Y2N A;  1ID3 B;  5AV5 C;  4H9R B;  4QLC B;  5B2J C;  1U35 B;  5B31 B;  5B33 A;  3X1T B;  1P34 D;  3AV1 B;  3X1S C;  3KXB A;  4NFT A;  3AZH B;  3AN2 B;  3B0C T;  5CPK B;  3UTA B;  2FFF B;  3W98 A;  3KSY A;  3AFA A;  4M6B A;  1F66 A;  2XD1 A;  4WNN A;  4J8U A;  3WA9 B;  5BO0 A;  1P3P D;  3MGP D;  2NZD D;  4R8P B;  5DNM D;  4X23 D;  1P3K A;  2Y2O A;  4KGC B;  3NQJ A;  5B0Z A;  1P34 C;  4Z5T D;  3B0D B;  3O62 B;  5E5A D;  1P3A D;  3KWQ A;  3NQU B;  3LEL A;  1AOI A;  3EPH A;  4H9P B;  3AZM D;  1M19 A;  2JCH A;  4Z66 A;  5AV6 B;  2Y2P A;  5AY8 B;  5FUG A;  1M18 A;  5GT3 B;  1P3P C;  4XUJ D;  3MGP C;  2NQB B;  4G91 C;  5DNM C;  2LY8 A;  4X23 C;  2ZM5 A;  3AZI D;  4H9S C;  4YS3 A;  4Z5T C;  3REL D;  3WAA A;  5GT0 D;  3KUY A;  3UT9 A;  5E5A C;  5B24 B;  1P3A C;  1BFM A;  3TU4 B;  5AVB A;  3WTP E;  5B0Y B;  3AZM C;  5CHL B;  4NE6 A;  4UUZ A;  1KX4 B;  3LZ0 D;  5DNN B;  1P3M A;  3B6G A;  1B67 A;  5B40 A;  4XUJ C;  4KUD A;  2UWX A;  3REJ A;  3AZI C;  4ZUX A;  2F8N B;  3KWQ C;  3REL C;  5GT0 C;  3KXB B;  3C1C D;  1HQ3 A;  3X1V B;  2CV5 A;  3AZK B;  5AV8 A;  3MNN D;  1EQZ A;  3LJA A;  3AL0 C;  4H9N A;  2HUE C;  3W98 B;  5B32 G;  1P3F B;  3AFA B;  1F66 B;  3LZ0 C;  4EO5 C;  3C1B A;  2FJ7 A;  4J8W A;  3MGR A;  3W99 B;  3VH6 W;  5BO0 B;  2Y2I A;  4LD9 D;  3FDD A;  1T3U A;  1P3K B;  4J8X B;  1P3B C;  3NQJ B;  3REK A;  5B0Z B;  1ID3 A;  4QLC A;  3C1C C;  5BS7 A;  4XZQ B;  1U35 A;  5AV9 D;  3MNN C;  3AZG A;  3A6N D;  3B6F A;  1P3I B;  1M19 B;  3AZN B;  1P3L D;  4Z66 B;  3AYW C;  5CPK A;  4YM6 D;  4LD9 C;  1KX5 B;  3WA9 A;  3AZF B;  4YS3 B;  5JRG B;  5B31 D;  5G49 A;  3KUY B;  5B2I B;  3X1T D;  4R8P A;  5CP6 B;  3B0B A;  3AZE A;  5AV9 C;  3AZH D;  5GSU B;  3H0R C;  3AV2 D;  4KGC A;  1M1A A;  5AVB B;  1ULY A;  4J8W C;  3A6N C;  3UTA D;  3O62 A;  3VH6 T;  4WU8 A;  1S32 C;  1P3L C;  3W97 B;  5CPI B;  5B1M B;  5B1L D;  3NQU A;  5GXQ A;  4H9P A;  1ZLA A;  3F6T A;  3B6G B;  4YM6 C;  2CWE A;  5B40 B;  5AVC A;  3AZJ B;  2PYO A;  5AV6 A;  3LZ1 D;  3REJ B;  5AY8 A;  4ZUX B;  5B31 C;  3REH A;  5C3I B;  3X1T C;  2CV5 B;  1H3O B;  3AV1 C;  5AV8 B;  3LJA B;  3AZH C;  3AV2 C;  1P3O D;  4H9N B;  3AN2 C;  3VH5 W;  3UTA C;  3X1S D;  5BNV A;  1KX3 D;  3X1U D;  5B24 A;  3MGQ A;  5B1L C;  3TU4 A;  3WKJ A;  5B32 B;  4ZBJ B;  2NQB D;  1JFI B;  2Y2Q A;  1P3O C;  2F8N A;  3AZG B;  1TZY A;  3B6F B;  3X1V A;  3AZK A;  1KX3 C;  3X1U C;  1KX4 D;  4WU9 A;  1P3F A;  2ZY3 A;  5GT3 C;  2NQB C;  3WTP A;  3W99 A;  5G49 B;  3VH5 T;  5B33 D;  3AZE B;  4J8X A;  5KDM A;  1M1A B;  4JJN B;  4WU8 B;  3W98 D;  4XZQ A;  5B0Y C;  2NZD A;  3AFA D;  1KX4 C;  1F66 D;  5DNN C;  5GXQ B;  1ZLA B;  4H9O B;  4J8U D;  3V9R A;  1P3I A;  5AVC B;  3AZN A;  2PYO B;  2RIQ A;  1P3K D;  3REH B;  5B33 C;  5B0Z D;  4DRB A;  1KX5 A;  3X1V C;  3KXB C;  2DQN C;  3AZK C;  3AZF A;  5BT1 D;  5JRG A;  3KWQ D;  1P3G B;  3LEL D;  1AOI D;  5B2I A;  5BNV B;  5CP6 A;  3W98 C;  1HTA A;  5B2J B;  1M19 D;  3MGQ B;  3AFA C;  5GSU A;  1F66 C;  4J8V A;  4Z66 D;  2YFW B;  4J8U C;  3W99 C;  3WKJ B;  4Z2M G;  1M18 D;  4WJ3 C;  3W97 A;  3REI A;  5B1M A;  5CPI A;  1P3K C;  1WWS A;  4YS3 D;  3AZJ A;  5B0Z C;  2G5H C;  4WV4 B;  3WAA D;  3KUY D;  1P3B D;  3UT9 D;  3MGS A;  1TAF B;  5BT1 C;  1TZY B;  4G92 C;  2L5A A;  3LEL C;  1AOI C;  5AVB D;  1H3O A;  1M19 C;  4Z66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...