3C1BD

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1bD00
1P3MA 4H9PA 1M19A 1S32C 3AZEC 3UTBA 1P3OD 1P3OB 3MVDA 3AZJD 2JSSA 4M6BA 5B1LD 5B1LB 3UT9D 3REIA 5F99C 3UT9B 3C1CD 5JA4A 5AY8C 1B67A 3W97B 4WU8D 4H9RA 4WU8B 5BNVA 5B40D 5B40B 4J8UC 1WWIA 5CHLB 3V9RA 1ZLAC 4J8XD 5GT3D 4J8XB 2F8NG 5GT3B 5DNNC 4JJNA 2YFWA 1JFIB 3RELA 1P3IA 4XUJA 4WU9B 1ID3B 5CP6C 1WWSA 5CPID 5B31C 3AZHB 1P3MD 1M19D 5BS7C 1P3MB 4H9PB 1M19B 3AFAC 1TZYD 5AV6A 3X1TC 3UTBD 3W98A 3MVDD 5E5AC 5GT0D 5B0YA 3REID 3REIB 4WNNA 3KXBD 3AZMB 3AN2A 3AZLA 5BO0B 5CPKA 4H9RB 4H9SC 1HQ3B 5BNVB 4XZQC 4CSRA 3W96C 1P3PB 3AV1A 2CWEA 3MGQA 3V9RB 3LZ1C 2FJ7C 4JJND 4JJNB 3AV2C 3AZNA 2CV5C 3RELD 3RELB 1P3ID 4XUJD 1P3IB 3WAAB 4EO5C 1P3KD 3LELA 5AV6D 3O62C 3MNNB 1KX5A 5B0YD 4H9QB 3LZ0A 4WNNB 3AN2D 3AZLD 1B6WA 5B2JA 5B33A 4J8WC 3X1SA 2AROA 3R45B 4H9NB 5CPKD 3A6NC 3W98B 3MGPA 4ZBJC 3AV1D 3MGQD 3AV1B 3MGQB 3KUYB 3LJAB 3B0CT 3AZND 5CPJA 2F8NK 3C1BC 1P3FC 3TU4B 3LELD 3LELB 5AV9A 4LD9C 2BYMA 1KX5D 5B31G 1KX5B 3WKJD 3LZ0D 3LZ0B 4R8PA 5B0ZA 5B2JD 3REHA 5B2JB 5B33D 5B32C 3X1SD 2AROD 3X1SB 5AV5B 3NQUA 4AWLB 1KX4D 3MGPB 4NE5A 1AOIC 2F8NA 3W99A 4Z5TC 4QLCC 4YM6B 1P3AC 5B24A 3X1VD 4WZSB 4G92B 1M1AA 2IO5B 5CPJD 3VH6T 3AZFA 5CPJB 1P3LD 5AV9D 3REJC 5B2IA 2PYOA 1BH8A 5B1MB 1BFMA 2NZDC 4R8PD 5B0ZD 4R8PB 5B0ZB 3REHD 3REHB 1P3GC 3B6GA 5C3IB 4X23C 3NQUB 3MGRA 1F66A 1P3BB 2F8ND 2F8NB 3MGSB 3W99D 3W99B 4KUDA 5B24D 1P3OC 5AVCA 3AZJC 4WU9A 5B1LC 3B0BA 1M1AB 5DNMB 5JRGA 3AZFD 5BT1D 3C1CC 3AZFB 3AZHA 5B2ID 4WU8C 5B2IB 2PYOB 1BH8B 4E45A 1N1JA 5B40C 1EQZA 2NQBB 1ULYA 1U35B 3B0DB 3AZMA 4J8XC 5GT3C 5BO0A 5KDMB 3W97D 5F99A 3AYWA 2BYKB 2RVQD 4NE3A 1HQ3A 3B6GB 5AY8A 5CPIC 1P3PA 3MGRD 4HGAB 1P3MC 3MGRB 1M19C 1F66D 1F66B 1TZYC 3UTBC 4KUDD 4KGCB 4KUDB 5AVCD 3MVDC 4YS3B 5AVCB 4WV4B 5GT0C 4WU9D 3WAAA 3X1UB 3REIC 1ID3D 1P34B 5JRGD 3KXBC 5JRGB 3AZHD 3REKA 5GXQA 3MNNA 3B6FA 5B31A 3NQJA 1EQZD 1N1JB 4G91C 1EQZB 4H9QA 3AZMD 4JJNC 3R45A 4H9NA 4ZUXA 3RELC 5F99B 1A7WA 3AYWD 1P3IC 4XUJC 3AYWB 1HQ3D 5AY8D 5AY8B 1P3PD 1P3KC 1KU5A 4H9SA 5AV6C 3KUYA 1M18A 3LJAA 4J8UB 5G49A 5B0YC 1ZLAB 3LZ1A 3WAAD 5DNNB 3AN2C 3TU4A 3AZLC 5AVBA 3REKD 3REKB 5GXQD 3MNND 5CPKC 5GXQB 3B6FB 5CP6B 3KWQA 3B6FD 5B31B 3NQJB 3AV1C 3WTPA 3O62A 3MGQC 3X1TB 5E5AB 3AZNC 3W98D 4ZUXD 4ZUXB 5AV5A 3VH5T 4Z66A 4NE6A 3LELC 4YM6A 3KUYD 1M18D 3LJAD 2HIOA 1M18B 1TAFA 4CAYA 1KX5C 4UUZB 3WKJC 5G49B 2HUEB 3LZ1B 3LZ0C 3TU4D 5AVBD 5B2JC 5AVBB 5B33C 3X1SC 2AROC 3KWQD 5B1MA 3KWQB 3UTAA 1KX4C 4LD9A 3WTPD 3WA9A 3WTPB 3O62B 3X1VC 4G92C 1H3OB 5AV5D 4Z66D 4Z66B 5CPJC 1P3BA 3MGPD 4J8WB 3MGSA 1P3LC 5AV9C 3AZIA 5GSUA 4H9OA 4YM6D 3A6NB 2HIOD 2HIOB 1TAFB 4CAYB 5DNMA 4QLCA 3B0CW 4R8PC 5B0ZC 3REHC 3AZKA 5B1MD 2NQBA 3UTAD 1P3FB 3UTAB 1U35A 4LD9B 3WA9D 3WA9B 3W99C 5KDMA 5B24C 4J8VA 2BYKA 1F1EA 3AZFC 5BT1C 5AV8A 1P3BD 1KX3A 3MGSD 3AZID 5GSUD 3AZIB 5GSUB 4H9OB 5B2IC 4KGCA 4YS3A 1M1AD 3X1UA 5DNMD 3UT9C 1P34A 4Z5TB 4QLCB 1P3AB 3AZGA 5FUGA 3W97C 3VH6W 3AZKD 2RVQC 2PYOD 3AZKB 1S32A 2NQBD 4HGAC 3MGRC 1U35D 3AZEA 1F66C 4KUDC 5AVCC 4J8VD 4J8VB 4WU9C 3B6GD 2NZDB 1ID3C 5JRGC 5AV8D 3AZHC 5AV8B 5B32G 1BH9A 1KX3D 1KX3B 4KGCD 4X23B 5CPIA 4YS3D 4J8UA 3WTPE 1ZLAA 1EQZC 3X1UD 1TZYA 1P34D 5DNNA 3AZMC 3AZGD 3AZGB 5FUGB 5GT0A 3AZJB 2YFVA 5CP6A 3KXBA 3AYWC 3C1CB 4E44A 1HQ3C 5BS7A 1S32D 1R4VA 1S32B 3AFAA 1P3PC 3AZED 3X1TA 3AZEB 5E5AA 4KHAB 5F99D 3WAAC 1BH9B 3REKC 5GXQC 4XZQA 3KSYA 3MNNC 3B6FC 5CPIB 4J8UD 3W96A 1P3KA 4UUZA 1ZLAD 2FJ7A 1TZYB 5DNND 3AV2A 1Q9CA 3UTBB 3MVDB 2CV5A 5GT0B 3W98C 4ZUXC 2YFVB 5CP6D 5B31D 3KXBB 5JA4B 3AFAD 3AFAB 3X1TD 2F8NH 5E5AD 3KUYC 1M18C 3LJAC 4G91B 1H3OA 2HUEC 2YFWB 4J8WA 3TU4C 4DRAA 5AVBC 3A6NA 4XUJB 4XZQD 4XZQB 3KWQC 3W96D 3VH5A 1P3KB 3W96B 4DRBA 3LZ1D 2FJ7D 2FJ7B 5AV6B 3WTPC 3AV2D 3AV2B 2CV5D 2CV5B 3WKJA 5B0YB 4NFTA 4EO5B 5AV5C 4Z66C 4AWLC 3C1BA 3AN2B 1P3FA 5BNXA 3AZLB 3MGPC 3O62D 5CPKB 4YM6C 2HIOC 1KX4A 4CSRB 2IO5C 5B32A 3X1VA 4J8WD 3AZNB 3A6ND 3VH5W 5B1MC 4ZBJB 3UTAC 1AOIA 1P3LA 4Z5TA 1P3AA 3WA9C 3WKJB 5C3IC 3C1BD 1P3FD 3C1BB 5BNXB 3VH6A 3REJA 1P3BC 4LD9D 5B33B 3MGSC 2AROB 3AZIC 5GSUC 4Z2MG 1KX4B 1M1AC 2NZDA 5DNMC 5B32D 1P3GA 5B32B 3X1VB 4X23A 3AZKC 2PYOC 2NQBC 1AOID 1AOIB 1U35C 1P3LB 3B0DC 4Z5TD 4QLCD 5AV9B 1P3AD 1P3OA 2LY8A 2BYMB 2L5AA 3AZJA 5B1LA 3UT9A 4J8VC 3C1CA 3B6GC 4Z2MH 5AV8C 3W97A 3REJD 3REJB 4WU8A 1KX3C 1HTAA 4KHAA 4KGCC 5B40A 4YS3C 2NZDD 4J8XA 3X1UC 5GT3A 1P34C 5B24B 3AZGC 1P3GD 1JFIA 1P3GB 1ID3A 4X23D
chains in the Genus database with same CATH superfamily
1P3MA 4H9PA 1M19A 1S32C 3AZEC 3UTBA 1P3OD 1P3OB 3MVDA 2Y2GA 2JSSA 4M6BA 3AZJD 5B1LD 5B1LB 2G5IC 3REIA 3UT9D 5F99C 3UT9B 3C1CD 5JA4A 5AY8C 1B67A 3W97B 4WU8D 4H9RA 4WU8B 5BNVA 5B40D 5B40B 4J8UC 1WWIA 5CHLB 3V9RA 1ZLAC 4J8XD 5GT3D 4J8XB 2F8NG 5GT3B 5DNNC 4JJNA 2YFWA 1JFIB 2Y2IA 3RELA 1P3IA 4XUJA 4WU9B 1ID3B 5CP6C 1WWSA 5CPID 5B31C 3AZHB 1P3MD 1M19D 5BS7C 1P3MB 4H9PB 1M19B 3AFAC 1TZYD 5AV6A 3X1TC 3UTBD 3W98A 3MVDD 5E5AC 5GT0D 2XD1A 5B0YA 3REID 3REIB 4WNNA 3KXBD 3AZMB 3AN2A 3AZLA 5BO0B 5CPKA 4H9RB 4H9SC 1HQ3B 5BNVB 4XZQC 4CSRA 3W96C 1P3PB 3AV1A 2CWEA 3MGQA 3V9RB 3LZ1C 2FJ7C 4JJND 4JJNB 3AV2C 2RIQA 3AZNA 2CV5C 3RELD 3RELB 1P3ID 4XUJD 1P3IB 3WAAB 4EO5C 1P3KD 3LELA 5AV6D 3O62C 3MNNB 1KX5A 5B0YD 4H9QB 3LZ0A 4WNNB 3AN2D 3AZLD 1B6WA 5B2JA 5B33A 4J8WC 3X1SA 2AROA 3R45B 4H9NB 5CPKD 3A6NC 3W98B 3MGPA 2XD5A 4ZBJC 3AV1D 3MGQD 3AV1B 3MGQB 3KUYB 3LJAB 3B0CT 3AZND 5CPJA 2F8NK 3C1BC 1P3FC 3TU4B 3LELD 3LELB 5AV9A 4LD9C 2BYMA 1KX5D 5B31G 1KX5B 3WKJD 3LZ0D 3LZ0B 4R8PA 5B0ZA 5B2JD 3REHA 5B2JB 5B33D 5B32C 3X1SD 2AROD 3X1SB 5AV5B 3NQUA 4AWLB 3A1IA 1KX4D 3AL0C 3MGPB 4NE5A 1AOIC 2F8NA 3W99A 4Z5TC 4QLCC 4YM6B 1P3AC 5B24A 3X1VD 4WZSB 4G92B 1M1AA 2IO5B 5CPJD 3VH6T 3AZFA 5CPJB 2Y2LA 1P3LD 5AV9D 3REJC 5B2IA 2PYOA 1BH8A 5B1MB 1BFMA 2NZDC 4R8PD 5B0ZD 4R8PB 5B0ZB 3REHD 3REHB 1P3GC 3B6GA 5C3IB 4X23C 3NQUB 3MGRA 1F66A 1P3BB 2F8ND 2F8NB 3MGSB 3W99D 3W99B 4KUDA 5B24D 1P3OC 5AVCA 2DQNC 3AZJC 4WU9A 5B1LC 3B0BA 1M1AB 5DNMB 5JRGA 3AZFD 5BT1D 3C1CC 3AZFB 3AZHA 1Z2CB 5B2ID 4WU8C 5B2IB 2PYOB 1BH8B 4E45A 1N1JA 5B40C 1EQZA 2NQBB 3F6TA 1ULYA 1U35B 3B0DB 3AZMA 4J8XC 5GT3C 5BO0A 5KDMB 3W97D 5F99A 3AYWA 2BYKB 2RVQD 4NE3A 1HQ3A 3B6GB 5AY8A 5CPIC 1P3PA 3MGRD 4HGAB 1P3MC 3MGRB 1M19C 1F66D 1F66B 1TZYC 3UTBC 4KUDD 4KGCB 4KUDB 5AVCD 3MVDC 4YS3B 5AVCB 4WV4B 5GT0C 4WU9D 3WAAA 2JCHA 3X1UB 3REIC 1ID3D 1P34B 5JRGD 3KXBC 5JRGB 3AZHD 3REKA 5GXQA 3MNNA 3B6FA 5B31A 3NQJA 1EQZD 1N1JB 4G91C 1EQZB 4H9QA 3AZMD 4JJNC 3R45A 4H9NA 4ZUXA 3RELC 5F99B 1A7WA 3AYWD 1P3IC 3EG5B 4XUJC 3AYWB 1HQ3D 5AY8D 5AY8B 1P3PD 1P3KC 1KU5A 1W2EA 4H9SA 5AV6C 3KUYA 1M18A 3LJAA 4J8UB 2ZY4A 5G49A 5B0YC 3LZ1A 1ZLAB 3WAAD 5DNNB 3AN2C 3TU4A 3AZLC 5AVBA 3REKD 3REKB 5GXQD 3MNND 5CPKC 5GXQB 3EPJA 5CP6B 3KWQA 3B6FB 3B6FD 5B31B 3NQJB 2UWXA 3AV1C 3WTPA 3O62A 3MGQC 3X1TB 5E5AB 2JE5A 3AZNC 3W98D 4ZUXD 4ZUXB 5AV5A 3VH5T 4Z66A 4UPKA 4NE6A 3LELC 4YM6A 3KUYD 1M18D 3LJAD 2HIOA 1M18B 1TAFA 4CAYA 1KX5C 4UUZB 3WKJC 5G49B 2HUEB 3LZ1B 3LZ0C 3TU4D 5AVBD 5B2JC 5AVBB 5B33C 3X1SC 2AROC 3KWQD 5B1MA 3KWQB 3UTAA 1KX4C 4LD9A 3WTPD 3WA9A 3WTPB 3O62B 3X1VC 4G92C 1H3OB 5AV5D 4Z66D 4Z66B 5CPJC 2J8PA 1P3BA 3MGPD 4J8WB 3MGSA 1P3LC 5AV9C 3AZIA 5GSUA 4H9OA 4YM6D 3A6NB 3KFUG 2Y2JA 2HIOD 2HIOB 3IP4C 1TAFB 4CAYB 5DNMA 4QLCA 3B0CW 4R8PC 5B0ZC 3REHC 3AZKA 5B1MD 2NQBA 3UTAD 1P3FB 2ZY2A 3UTAB 1U35A 4LD9B 3WA9D 3WA9B 3W99C 5KDMA 5B24C 2Y2OA 4J8VA 2BYKA 1F1EA 3AZFC 5BT1C 5AV8A 1P3BD 1KX3A 3EPKA 3MGSD 3AZID 5GSUD 3AZIB 5GSUB 4H9OB 5B2IC 4KGCA 4YS3A 1M1AD 3X1UA 5DNMD 3UT9C 1P34A 1PZRA 4Z5TB 4QLCB 1P3AB 3AZGA 5FUGA 3W97C 3VH6W 3AZKD 2RVQC 2PYOD 3AZKB 3EPHA 1S32A 2NQBD 2Y2KA 4HGAC 3MGRC 1U35D 3AZEA 1F66C 4KUDC 5AVCC 4J8VD 4J8VB 3FDDA 4WU9C 3B6GD 2NZDB 1ID3C 5JRGC 5AV8D 3AZHC 5AV8B 5B32G 1BH9A 1KX3D 1KX3B 4KGCD 4X23B 5CPIA 4YS3D 4J8UA 2Y2MA 3WTPE 1ZLAA 1EQZC 3X1UD 1TZYA 1P34D 2Y2QA 5DNNA 3AZMC 3AZGD 3AZGB 5FUGB 5GT0A 3AZJB 2YFVA 5CP6A 3KXBA 3AYWC 3C1CB 4E44A 1HQ3C 5BS7A 1S32D 1R4VA 1S32B 3AFAA 1P3PC 3AZED 3X1TA 3AZEB 2ZY5A 5E5AA 2W8SA 4KHAB 2F2AC 5F99D 3WAAC 2Y2PA 1BH9B 3REKC 5GXQC 4XZQA 3KSYA 3MNNC 3B6FC 5CPIB 4J8UD 3W96A 1P3KA 4UUZA 1ZLAD 2FJ7A 1TZYB 5DNND 3AV2A 1Q9CA 3UTBB 3MVDB 2ZM5A 2CV5A 5GT0B 3W98C 4ZUXC 2YFVB 5CP6D 4DQYB 5B31D 3KXBB 5JA4B 3AFAD 3AFAB 3X1TD 2F8NH 3H0LC 5E5AD 3KUYC 1M18C 3LJAC 4G91B 1H3OA 2HUEC 2YFWB 4J8WA 3TU4C 4DRAA 5AVBC 3A6NA 4XUJB 4XZQD 4XZQB 3KWQC 3W96D 3VH5A 1P3KB 3W96B 4DRBA 3LZ1D 2FJ7D 2FJ7B 5AV6B 3WTPC 3AV2D 3AV2B 3P5JB 2CV5D 2CV5B 3WKJA 5B0YB 4NFTA 4EO5B 5AV5C 4Z66C 4AWLC 3C1BA 3AN2B 1P3FA 5BNXA 3AZLB 3MGPC 3O62D 5CPKB 4YM6C 2HIOC 1KX4A 4CSRB 2IO5C 3A1KA 5B32A 3X1VA 4J8WD 3AZNB 3A6ND 3VH5W 1T3UA 3H0MC 5B1MC 4ZBJB 3UTAC 1AOIA 1P3LA 4Z5TA 1P3AA 3WA9C 3EPLA 3WKJB 5C3IC 3C1BD 1P3FD 3C1BB 5BNXB 3VH6A 3REJA 3H0RC 1P3BC 5B33B 4LD9D 2ZY3A 3MGSC 2AROB 3AZIC 5GSUC 4Z2MG 1KX4B 1M1AC 2NZDA 2DF4C 5DNMC 2VQRA 2G5HC 5B32D 1P3GA 2BG1A 5B32B 3X1VB 4X23A 3AZKC 2PYOC 2NQBC 1AOID 1AOIB 1U35C 1P3LB 3B0DC 4Z5TD 4QLCD 5AV9B 1P3AD 1P3OA 2LY8A 2BYMB 2L5AA 4WJ3C 3AZJA 5B1LA 3UT9A 2Y2HA 4J8VC 3C1CA 3B6GC 4Z2MH 5AV8C 3W97A 3REJD 3REJB 4WU8A 1KX3C 1HTAA 4KHAA 4KGCC 5B40A 4YS3C 2NZDD 4J8XA 3X1UC 2Y2NA 5GT3A 1P34C 2FFFB 5B24B 3AZGC 1P3GD 1JFIA 1P3GB 1ID3A 4X23D
chains in the Genus database with same CATH topology
1P3MA 4H9PA 1M19A 1S32C 3AZEC 3UTBA 1P3OD 1P3OB 3MVDA 2Y2GA 2JSSA 4M6BA 3AZJD 5B1LD 5B1LB 2G5IC 3REIA 3UT9D 5F99C 3UT9B 3C1CD 5JA4A 5AY8C 1B67A 3W97B 4WU8D 4H9RA 4WU8B 5BNVA 5B40D 5B40B 4J8UC 1WWIA 5CHLB 3V9RA 1ZLAC 4J8XD 5GT3D 4J8XB 2F8NG 5GT3B 5DNNC 4JJNA 2YFWA 1JFIB 2Y2IA 3RELA 1P3IA 4XUJA 4WU9B 1ID3B 5CP6C 1WWSA 5CPID 5B31C 3AZHB 1P3MD 1M19D 5BS7C 1P3MB 4H9PB 1M19B 3AFAC 1TZYD 5AV6A 3X1TC 3UTBD 3W98A 3MVDD 5E5AC 5GT0D 2XD1A 5B0YA 3REID 3REIB 4WNNA 3KXBD 3AZMB 3AN2A 3AZLA 5BO0B 5CPKA 4H9RB 4H9SC 1HQ3B 5BNVB 4XZQC 4CSRA 3W96C 1P3PB 3AV1A 2CWEA 3MGQA 3V9RB 3LZ1C 2FJ7C 4JJND 4JJNB 3AV2C 2RIQA 3AZNA 2CV5C 3RELD 3RELB 1P3ID 4XUJD 1P3IB 3WAAB 4EO5C 1P3KD 3LELA 5AV6D 3O62C 3MNNB 1KX5A 5B0YD 4H9QB 3LZ0A 4WNNB 3AN2D 3AZLD 1B6WA 5B2JA 5B33A 4J8WC 3X1SA 2AROA 3R45B 4H9NB 5CPKD 3A6NC 3W98B 3MGPA 2XD5A 4ZBJC 3AV1D 3MGQD 3AV1B 3MGQB 3KUYB 3LJAB 3B0CT 3AZND 5CPJA 2F8NK 3C1BC 1P3FC 3TU4B 3LELD 3LELB 5AV9A 4LD9C 2BYMA 1KX5D 5B31G 1KX5B 3WKJD 3LZ0D 3LZ0B 4R8PA 5B0ZA 5B2JD 3REHA 5B2JB 5B33D 5B32C 3X1SD 2AROD 3X1SB 5AV5B 3NQUA 4AWLB 3A1IA 1KX4D 3AL0C 3MGPB 4NE5A 1AOIC 2F8NA 3W99A 4Z5TC 4QLCC 4YM6B 1P3AC 5B24A 3X1VD 4WZSB 4G92B 1M1AA 2IO5B 5CPJD 3VH6T 3AZFA 5CPJB 2Y2LA 1P3LD 5AV9D 3REJC 5B2IA 2PYOA 1BH8A 5B1MB 1BFMA 2NZDC 4R8PD 5B0ZD 4R8PB 5B0ZB 3REHD 3REHB 1P3GC 3B6GA 5C3IB 4X23C 3NQUB 3MGRA 1F66A 1P3BB 2F8ND 2F8NB 3MGSB 3W99D 3W99B 4KUDA 5B24D 1P3OC 5AVCA 2DQNC 3AZJC 4WU9A 5B1LC 3B0BA 1M1AB 5DNMB 5JRGA 3AZFD 5BT1D 3C1CC 3AZFB 3AZHA 1Z2CB 5B2ID 4WU8C 5B2IB 2PYOB 1BH8B 4E45A 1N1JA 5B40C 1EQZA 2NQBB 3F6TA 1ULYA 1U35B 3B0DB 3AZMA 4J8XC 5GT3C 5BO0A 5KDMB 3W97D 5F99A 3AYWA 2BYKB 2RVQD 4NE3A 1HQ3A 3B6GB 5AY8A 5CPIC 1P3PA 3MGRD 4HGAB 1P3MC 3MGRB 1M19C 1F66D 1F66B 1TZYC 3UTBC 4KUDD 4KGCB 4KUDB 5AVCD 3MVDC 4YS3B 5AVCB 4WV4B 5GT0C 4WU9D 3WAAA 2JCHA 3X1UB 3REIC 1ID3D 1P34B 5JRGD 3KXBC 5JRGB 3AZHD 3REKA 5GXQA 3MNNA 3B6FA 5B31A 3NQJA 1EQZD 1N1JB 4G91C 1EQZB 4H9QA 3AZMD 4JJNC 3R45A 4H9NA 4ZUXA 3RELC 5F99B 1A7WA 3AYWD 1P3IC 3EG5B 4XUJC 3AYWB 1HQ3D 5AY8D 5AY8B 1P3PD 1P3KC 1KU5A 1W2EA 4H9SA 5AV6C 3KUYA 1M18A 3LJAA 4J8UB 2ZY4A 5G49A 5B0YC 3LZ1A 1ZLAB 3WAAD 5DNNB 3AN2C 3TU4A 3AZLC 5AVBA 3REKD 3REKB 5GXQD 3MNND 5CPKC 5GXQB 3EPJA 5CP6B 3KWQA 3B6FB 3B6FD 5B31B 3NQJB 2UWXA 3AV1C 3WTPA 3O62A 3MGQC 3X1TB 5E5AB 2JE5A 3AZNC 3W98D 4ZUXD 4ZUXB 5AV5A 3VH5T 4Z66A 4UPKA 4NE6A 3LELC 4YM6A 3KUYD 1M18D 3LJAD 2HIOA 1M18B 1TAFA 4CAYA 1KX5C 4UUZB 3WKJC 5G49B 2HUEB 3LZ1B 3LZ0C 3TU4D 5AVBD 5B2JC 5AVBB 5B33C 3X1SC 2AROC 3KWQD 5B1MA 3KWQB 3UTAA 1KX4C 4LD9A 3WTPD 3WA9A 3WTPB 3O62B 3X1VC 4G92C 1H3OB 5AV5D 4Z66D 4Z66B 5CPJC 2J8PA 1P3BA 3MGPD 4J8WB 3MGSA 1P3LC 5AV9C 3AZIA 5GSUA 4H9OA 4YM6D 3A6NB 3KFUG 2Y2JA 2HIOD 2HIOB 3IP4C 1TAFB 4CAYB 5DNMA 4QLCA 3B0CW 4R8PC 5B0ZC 3REHC 3AZKA 5B1MD 2NQBA 3UTAD 1P3FB 2ZY2A 3UTAB 1U35A 4LD9B 3WA9D 3WA9B 3W99C 5KDMA 5B24C 2Y2OA 4J8VA 2BYKA 1F1EA 3AZFC 5BT1C 5AV8A 1P3BD 1KX3A 3EPKA 3MGSD 3AZID 5GSUD 3AZIB 5GSUB 4H9OB 5B2IC 4KGCA 4YS3A 1M1AD 3X1UA 5DNMD 3UT9C 1P34A 1PZRA 4Z5TB 4QLCB 1P3AB 3AZGA 5FUGA 3W97C 3VH6W 3AZKD 2RVQC 2PYOD 3AZKB 3EPHA 1S32A 2NQBD 2Y2KA 4HGAC 3MGRC 1U35D 3AZEA 1F66C 4KUDC 5AVCC 4J8VD 4J8VB 3FDDA 4WU9C 3B6GD 2NZDB 1ID3C 5JRGC 5AV8D 3AZHC 5AV8B 5B32G 1BH9A 1KX3D 1KX3B 4KGCD 4X23B 5CPIA 4YS3D 4J8UA 2Y2MA 3WTPE 1ZLAA 1EQZC 3X1UD 1TZYA 1P34D 2Y2QA 5DNNA 3AZMC 3AZGD 3AZGB 5FUGB 5GT0A 3AZJB 2YFVA 5CP6A 3KXBA 3AYWC 3C1CB 4E44A 1HQ3C 5BS7A 1S32D 1R4VA 1S32B 3AFAA 1P3PC 3AZED 3X1TA 3AZEB 2ZY5A 5E5AA 2W8SA 4KHAB 2F2AC 5F99D 3WAAC 2Y2PA 1BH9B 3REKC 5GXQC 4XZQA 3KSYA 3MNNC 3B6FC 5CPIB 4J8UD 3W96A 1P3KA 4UUZA 1ZLAD 2FJ7A 1TZYB 5DNND 3AV2A 1Q9CA 3UTBB 3MVDB 2ZM5A 2CV5A 5GT0B 3W98C 4ZUXC 2YFVB 5CP6D 4DQYB 5B31D 3KXBB 5JA4B 3AFAD 3AFAB 3X1TD 2F8NH 3H0LC 5E5AD 3KUYC 1M18C 3LJAC 4G91B 1H3OA 2HUEC 2YFWB 4J8WA 3TU4C 4DRAA 5AVBC 3A6NA 4XUJB 4XZQD 4XZQB 3KWQC 3W96D 3VH5A 1P3KB 3W96B 4DRBA 3LZ1D 2FJ7D 2FJ7B 5AV6B 3WTPC 3AV2D 3AV2B 3P5JB 2CV5D 2CV5B 3WKJA 5B0YB 4NFTA 4EO5B 5AV5C 4Z66C 4AWLC 3C1BA 3AN2B 1P3FA 5BNXA 3AZLB 3MGPC 3O62D 5CPKB 4YM6C 2HIOC 1KX4A 4CSRB 2IO5C 3A1KA 5B32A 3X1VA 4J8WD 3AZNB 3A6ND 3VH5W 1T3UA 3H0MC 5B1MC 4ZBJB 3UTAC 1AOIA 1P3LA 4Z5TA 1P3AA 3WA9C 3EPLA 3WKJB 5C3IC 3C1BD 1P3FD 3C1BB 5BNXB 3VH6A 3REJA 3H0RC 1P3BC 5B33B 4LD9D 2ZY3A 3MGSC 2AROB 3AZIC 5GSUC 4Z2MG 1KX4B 1M1AC 2NZDA 2DF4C 5DNMC 2VQRA 2G5HC 5B32D 1P3GA 2BG1A 5B32B 3X1VB 4X23A 3AZKC 2PYOC 2NQBC 1AOID 1AOIB 1U35C 1P3LB 3B0DC 4Z5TD 4QLCD 5AV9B 1P3AD 1P3OA 2LY8A 2BYMB 2L5AA 4WJ3C 3AZJA 5B1LA 3UT9A 2Y2HA 4J8VC 3C1CA 3B6GC 4Z2MH 5AV8C 3W97A 3REJD 3REJB 4WU8A 1KX3C 1HTAA 4KHAA 4KGCC 5B40A 4YS3C 2NZDD 4J8XA 3X1UC 2Y2NA 5GT3A 1P34C 2FFFB 5B24B 3AZGC 1P3GD 1JFIA 1P3GB 1ID3A 4X23D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M A;  4H9P A;  1M19 A;  1S32 C;  3AZE C;  3UTB A;  1P3O D;  1P3O B;  3MVD A;  3AZJ D;  2JSS A;  4M6B A;  5B1L D;  5B1L B;  3UT9 D;  3REI A;  5F99 C;  3UT9 B;  3C1C D;  5JA4 A;  5AY8 C;  1B67 A;  3W97 B;  4WU8 D;  4H9R A;  4WU8 B;  5BNV A;  5B40 D;  5B40 B;  4J8U C;  1WWI A;  5CHL B;  3V9R A;  1ZLA C;  4J8X D;  5GT3 D;  4J8X B;  2F8N G;  5GT3 B;  5DNN C;  4JJN A;  2YFW A;  1JFI B;  3REL A;  1P3I A;  4XUJ A;  4WU9 B;  1ID3 B;  5CP6 C;  1WWS A;  5CPI D;  5B31 C;  3AZH B;  1P3M D;  1M19 D;  5BS7 C;  1P3M B;  4H9P B;  1M19 B;  3AFA C;  1TZY D;  5AV6 A;  3X1T C;  3UTB D;  3W98 A;  3MVD D;  5E5A C;  5GT0 D;  5B0Y A;  3REI D;  3REI B;  4WNN A;  3KXB D;  3AZM B;  3AN2 A;  3AZL A;  5BO0 B;  5CPK A;  4H9R B;  4H9S C;  1HQ3 B;  5BNV B;  4XZQ C;  4CSR A;  3W96 C;  1P3P B;  3AV1 A;  2CWE A;  3MGQ A;  3V9R B;  3LZ1 C;  2FJ7 C;  4JJN D;  4JJN B;  3AV2 C;  3AZN A;  2CV5 C;  3REL D;  3REL B;  1P3I D;  4XUJ D;  1P3I B;  3WAA B;  4EO5 C;  1P3K D;  3LEL A;  5AV6 D;  3O62 C;  3MNN B;  1KX5 A;  5B0Y D;  4H9Q B;  3LZ0 A;  4WNN B;  3AN2 D;  3AZL D;  1B6W A;  5B2J A;  5B33 A;  4J8W C;  3X1S A;  2ARO A;  3R45 B;  4H9N B;  5CPK D;  3A6N C;  3W98 B;  3MGP A;  4ZBJ C;  3AV1 D;  3MGQ D;  3AV1 B;  3MGQ B;  3KUY B;  3LJA B;  3B0C T;  3AZN D;  5CPJ A;  2F8N K;  3C1B C;  1P3F C;  3TU4 B;  3LEL D;  3LEL B;  5AV9 A;  4LD9 C;  2BYM A;  1KX5 D;  5B31 G;  1KX5 B;  3WKJ D;  3LZ0 D;  3LZ0 B;  4R8P A;  5B0Z A;  5B2J D;  3REH A;  5B2J B;  5B33 D;  5B32 C;  3X1S D;  2ARO D;  3X1S B;  5AV5 B;  3NQU A;  4AWL B;  1KX4 D;  3MGP B;  4NE5 A;  1AOI C;  2F8N A;  3W99 A;  4Z5T C;  4QLC C;  4YM6 B;  1P3A C;  5B24 A;  3X1V D;  4WZS B;  4G92 B;  1M1A A;  2IO5 B;  5CPJ D;  3VH6 T;  3AZF A;  5CPJ B;  1P3L D;  5AV9 D;  3REJ C;  5B2I A;  2PYO A;  1BH8 A;  5B1M B;  1BFM A;  2NZD C;  4R8P D;  5B0Z D;  4R8P B;  5B0Z B;  3REH D;  3REH B;  1P3G C;  3B6G A;  5C3I B;  4X23 C;  3NQU B;  3MGR A;  1F66 A;  1P3B B;  2F8N D;  2F8N B;  3MGS B;  3W99 D;  3W99 B;  4KUD A;  5B24 D;  1P3O C;  5AVC A;  3AZJ C;  4WU9 A;  5B1L C;  3B0B A;  1M1A B;  5DNM B;  5JRG A;  3AZF D;  5BT1 D;  3C1C C;  3AZF B;  3AZH A;  5B2I D;  4WU8 C;  5B2I B;  2PYO B;  1BH8 B;  4E45 A;  1N1J A;  5B40 C;  1EQZ A;  2NQB B;  1ULY A;  1U35 B;  3B0D B;  3AZM A;  4J8X C;  5GT3 C;  5BO0 A;  5KDM B;  3W97 D;  5F99 A;  3AYW A;  2BYK B;  2RVQ D;  4NE3 A;  1HQ3 A;  3B6G B;  5AY8 A;  5CPI C;  1P3P A;  3MGR D;  4HGA B;  1P3M C;  3MGR B;  1M19 C;  1F66 D;  1F66 B;  1TZY C;  3UTB C;  4KUD D;  4KGC B;  4KUD B;  5AVC D;  3MVD C;  4YS3 B;  5AVC B;  4WV4 B;  5GT0 C;  4WU9 D;  3WAA A;  3X1U B;  3REI C;  1ID3 D;  1P34 B;  5JRG D;  3KXB C;  5JRG B;  3AZH D;  3REK A;  5GXQ A;  3MNN A;  3B6F A;  5B31 A;  3NQJ A;  1EQZ D;  1N1J B;  4G91 C;  1EQZ B;  4H9Q A;  3AZM D;  4JJN C;  3R45 A;  4H9N A;  4ZUX A;  3REL C;  5F99 B;  1A7W A;  3AYW D;  1P3I C;  4XUJ C;  3AYW B;  1HQ3 D;  5AY8 D;  5AY8 B;  1P3P D;  1P3K C;  1KU5 A;  4H9S A;  5AV6 C;  3KUY A;  1M18 A;  3LJA A;  4J8U B;  5G49 A;  5B0Y C;  1ZLA B;  3LZ1 A;  3WAA D;  5DNN B;  3AN2 C;  3TU4 A;  3AZL C;  5AVB A;  3REK D;  3REK B;  5GXQ D;  3MNN D;  5CPK C;  5GXQ B;  3B6F B;  5CP6 B;  3KWQ A;  3B6F D;  5B31 B;  3NQJ B;  3AV1 C;  3WTP A;  3O62 A;  3MGQ C;  3X1T B;  5E5A B;  3AZN C;  3W98 D;  4ZUX D;  4ZUX B;  5AV5 A;  3VH5 T;  4Z66 A;  4NE6 A;  3LEL C;  4YM6 A;  3KUY D;  1M18 D;  3LJA D;  2HIO A;  1M18 B;  1TAF A;  4CAY A;  1KX5 C;  4UUZ B;  3WKJ C;  5G49 B;  2HUE B;  3LZ1 B;  3LZ0 C;  3TU4 D;  5AVB D;  5B2J C;  5AVB B;  5B33 C;  3X1S C;  2ARO C;  3KWQ D;  5B1M A;  3KWQ B;  3UTA A;  1KX4 C;  4LD9 A;  3WTP D;  3WA9 A;  3WTP B;  3O62 B;  3X1V C;  4G92 C;  1H3O B;  5AV5 D;  4Z66 D;  4Z66 B;  5CPJ C;  1P3B A;  3MGP D;  4J8W B;  3MGS A;  1P3L C;  5AV9 C;  3AZI A;  5GSU A;  4H9O A;  4YM6 D;  3A6N B;  2HIO D;  2HIO B;  1TAF B;  4CAY B;  5DNM A;  4QLC A;  3B0C W;  4R8P C;  5B0Z C;  3REH C;  3AZK A;  5B1M D;  2NQB A;  3UTA D;  1P3F B;  3UTA B;  1U35 A;  4LD9 B;  3WA9 D;  3WA9 B;  3W99 C;  5KDM A;  5B24 C;  4J8V A;  2BYK A;  1F1E A;  3AZF C;  5BT1 C;  5AV8 A;  1P3B D;  1KX3 A;  3MGS D;  3AZI D;  5GSU D;  3AZI B;  5GSU B;  4H9O B;  5B2I C;  4KGC A;  4YS3 A;  1M1A D;  3X1U A;  5DNM D;  3UT9 C;  1P34 A;  4Z5T B;  4QLC B;  1P3A B;  3AZG A;  5FUG A;  3W97 C;  3VH6 W;  3AZK D;  2RVQ C;  2PYO D;  3AZK B;  1S32 A;  2NQB D;  4HGA C;  3MGR C;  1U35 D;  3AZE A;  1F66 C;  4KUD C;  5AVC C;  4J8V D;  4J8V B;  4WU9 C;  3B6G D;  2NZD B;  1ID3 C;  5JRG C;  5AV8 D;  3AZH C;  5AV8 B;  5B32 G;  1BH9 A;  1KX3 D;  1KX3 B;  4KGC D;  4X23 B;  5CPI A;  4YS3 D;  4J8U A;  3WTP E;  1ZLA A;  1EQZ C;  3X1U D;  1TZY A;  1P34 D;  5DNN A;  3AZM C;  3AZG D;  3AZG B;  5FUG B;  5GT0 A;  3AZJ B;  2YFV A;  5CP6 A;  3KXB A;  3AYW C;  3C1C B;  4E44 A;  1HQ3 C;  5BS7 A;  1S32 D;  1R4V A;  1S32 B;  3AFA A;  1P3P C;  3AZE D;  3X1T A;  3AZE B;  5E5A A;  4KHA B;  5F99 D;  3WAA C;  1BH9 B;  3REK C;  5GXQ C;  4XZQ A;  3KSY A;  3MNN C;  3B6F C;  5CPI B;  4J8U D;  3W96 A;  1P3K A;  4UUZ A;  1ZLA D;  2FJ7 A;  1TZY B;  5DNN D;  3AV2 A;  1Q9C A;  3UTB B;  3MVD B;  2CV5 A;  5GT0 B;  3W98 C;  4ZUX C;  2YFV B;  5CP6 D;  5B31 D;  3KXB B;  5JA4 B;  3AFA D;  3AFA B;  3X1T D;  2F8N H;  5E5A D;  3KUY C;  1M18 C;  3LJA C;  4G91 B;  1H3O A;  2HUE C;  2YFW B;  4J8W A;  3TU4 C;  4DRA A;  5AVB C;  3A6N A;  4XUJ B;  4XZQ D;  4XZQ B;  3KWQ C;  3W96 D;  3VH5 A;  1P3K B;  3W96 B;  4DRB A;  3LZ1 D;  2FJ7 D;  2FJ7 B;  5AV6 B;  3WTP C;  3AV2 D;  3AV2 B;  2CV5 D;  2CV5 B;  3WKJ A;  5B0Y B;  4NFT A;  4EO5 B;  5AV5 C;  4Z66 C;  4AWL C;  3C1B A;  3AN2 B;  1P3F A;  5BNX A;  3AZL B;  3MGP C;  3O62 D;  5CPK B;  4YM6 C;  2HIO C;  1KX4 A;  4CSR B;  2IO5 C;  5B32 A;  3X1V A;  4J8W D;  3AZN B;  3A6N D;  3VH5 W;  5B1M C;  4ZBJ B;  3UTA C;  1AOI A;  1P3L A;  4Z5T A;  1P3A A;  3WA9 C;  3WKJ B;  5C3I C;  3C1B D;  1P3F D;  3C1B B;  5BNX B;  3VH6 A;  3REJ A;  1P3B C;  4LD9 D;  5B33 B;  3MGS C;  2ARO B;  3AZI C;  5GSU C;  4Z2M G;  1KX4 B;  1M1A C;  2NZD A;  5DNM C;  5B32 D;  1P3G A;  5B32 B;  3X1V B;  4X23 A;  3AZK C;  2PYO C;  2NQB C;  1AOI D;  1AOI B;  1U35 C;  1P3L B;  3B0D C;  4Z5T D;  4QLC D;  5AV9 B;  1P3A D;  1P3O A;  2LY8 A;  2BYM B;  2L5A A;  3AZJ A;  5B1L A;  3UT9 A;  4J8V C;  3C1C A;  3B6G C;  4Z2M H;  5AV8 C;  3W97 A;  3REJ D;  3REJ B;  4WU8 A;  1KX3 C;  1HTA A;  4KHA A;  4KGC C;  5B40 A;  4YS3 C;  2NZD D;  4J8X A;  3X1U C;  5GT3 A;  1P34 C;  5B24 B;  3AZG C;  1P3G D;  1JFI A;  1P3G B;  1ID3 A;  4X23 D; 
#chains in the Genus database with same CATH topology
 1P3M A;  4H9P A;  1M19 A;  1S32 C;  3AZE C;  3UTB A;  1P3O D;  1P3O B;  3MVD A;  2Y2G A;  2JSS A;  4M6B A;  3AZJ D;  5B1L D;  5B1L B;  2G5I C;  3REI A;  3UT9 D;  5F99 C;  3UT9 B;  3C1C D;  5JA4 A;  5AY8 C;  1B67 A;  3W97 B;  4WU8 D;  4H9R A;  4WU8 B;  5BNV A;  5B40 D;  5B40 B;  4J8U C;  1WWI A;  5CHL B;  3V9R A;  1ZLA C;  4J8X D;  5GT3 D;  4J8X B;  2F8N G;  5GT3 B;  5DNN C;  4JJN A;  2YFW A;  1JFI B;  2Y2I A;  3REL A;  1P3I A;  4XUJ A;  4WU9 B;  1ID3 B;  5CP6 C;  1WWS A;  5CPI D;  5B31 C;  3AZH B;  1P3M D;  1M19 D;  5BS7 C;  1P3M B;  4H9P B;  1M19 B;  3AFA C;  1TZY D;  5AV6 A;  3X1T C;  3UTB D;  3W98 A;  3MVD D;  5E5A C;  5GT0 D;  2XD1 A;  5B0Y A;  3REI D;  3REI B;  4WNN A;  3KXB D;  3AZM B;  3AN2 A;  3AZL A;  5BO0 B;  5CPK A;  4H9R B;  4H9S C;  1HQ3 B;  5BNV B;  4XZQ C;  4CSR A;  3W96 C;  1P3P B;  3AV1 A;  2CWE A;  3MGQ A;  3V9R B;  3LZ1 C;  2FJ7 C;  4JJN D;  4JJN B;  3AV2 C;  2RIQ A;  3AZN A;  2CV5 C;  3REL D;  3REL B;  1P3I D;  4XUJ D;  1P3I B;  3WAA B;  4EO5 C;  1P3K D;  3LEL A;  5AV6 D;  3O62 C;  3MNN B;  1KX5 A;  5B0Y D;  4H9Q B;  3LZ0 A;  4WNN B;  3AN2 D;  3AZL D;  1B6W A;  5B2J A;  5B33 A;  4J8W C;  3X1S A;  2ARO A;  3R45 B;  4H9N B;  5CPK D;  3A6N C;  3W98 B;  3MGP A;  2XD5 A;  4ZBJ C;  3AV1 D;  3MGQ D;  3AV1 B;  3MGQ B;  3KUY B;  3LJA B;  3B0C T;  3AZN D;  5CPJ A;  2F8N K;  3C1B C;  1P3F C;  3TU4 B;  3LEL D;  3LEL B;  5AV9 A;  4LD9 C;  2BYM A;  1KX5 D;  5B31 G;  1KX5 B;  3WKJ D;  3LZ0 D;  3LZ0 B;  4R8P A;  5B0Z A;  5B2J D;  3REH A;  5B2J B;  5B33 D;  5B32 C;  3X1S D;  2ARO D;  3X1S B;  5AV5 B;  3NQU A;  4AWL B;  3A1I A;  1KX4 D;  3AL0 C;  3MGP B;  4NE5 A;  1AOI C;  2F8N A;  3W99 A;  4Z5T C;  4QLC C;  4YM6 B;  1P3A C;  5B24 A;  3X1V D;  4WZS B;  4G92 B;  1M1A A;  2IO5 B;  5CPJ D;  3VH6 T;  3AZF A;  5CPJ B;  2Y2L A;  1P3L D;  5AV9 D;  3REJ C;  5B2I A;  2PYO A;  1BH8 A;  5B1M B;  1BFM A;  2NZD C;  4R8P D;  5B0Z D;  4R8P B;  5B0Z B;  3REH D;  3REH B;  1P3G C;  3B6G A;  5C3I B;  4X23 C;  3NQU B;  3MGR A;  1F66 A;  1P3B B;  2F8N D;  2F8N B;  3MGS B;  3W99 D;  3W99 B;  4KUD A;  5B24 D;  1P3O C;  5AVC A;  2DQN C;  3AZJ C;  4WU9 A;  5B1L C;  3B0B A;  1M1A B;  5DNM B;  5JRG A;  3AZF D;  5BT1 D;  3C1C C;  3AZF B;  3AZH A;  1Z2C B;  5B2I D;  4WU8 C;  5B2I B;  2PYO B;  1BH8 B;  4E45 A;  1N1J A;  5B40 C;  1EQZ A;  2NQB B;  3F6T A;  1ULY A;  1U35 B;  3B0D B;  3AZM A;  4J8X C;  5GT3 C;  5BO0 A;  5KDM B;  3W97 D;  5F99 A;  3AYW A;  2BYK B;  2RVQ D;  4NE3 A;  1HQ3 A;  3B6G B;  5AY8 A;  5CPI C;  1P3P A;  3MGR D;  4HGA B;  1P3M C;  3MGR B;  1M19 C;  1F66 D;  1F66 B;  1TZY C;  3UTB C;  4KUD D;  4KGC B;  4KUD B;  5AVC D;  3MVD C;  4YS3 B;  5AVC B;  4WV4 B;  5GT0 C;  4WU9 D;  3WAA A;  2JCH A;  3X1U B;  3REI C;  1ID3 D;  1P34 B;  5JRG D;  3KXB C;  5JRG B;  3AZH D;  3REK A;  5GXQ A;  3MNN A;  3B6F A;  5B31 A;  3NQJ A;  1EQZ D;  1N1J B;  4G91 C;  1EQZ B;  4H9Q A;  3AZM D;  4JJN C;  3R45 A;  4H9N A;  4ZUX A;  3REL C;  5F99 B;  1A7W A;  3AYW D;  1P3I C;  3EG5 B;  4XUJ C;  3AYW B;  1HQ3 D;  5AY8 D;  5AY8 B;  1P3P D;  1P3K C;  1KU5 A;  1W2E A;  4H9S A;  5AV6 C;  3KUY A;  1M18 A;  3LJA A;  4J8U B;  2ZY4 A;  5G49 A;  5B0Y C;  3LZ1 A;  1ZLA B;  3WAA D;  5DNN B;  3AN2 C;  3TU4 A;  3AZL C;  5AVB A;  3REK D;  3REK B;  5GXQ D;  3MNN D;  5CPK C;  5GXQ B;  3EPJ A;  5CP6 B;  3KWQ A;  3B6F B;  3B6F D;  5B31 B;  3NQJ B;  2UWX A;  3AV1 C;  3WTP A;  3O62 A;  3MGQ C;  3X1T B;  5E5A B;  2JE5 A;  3AZN C;  3W98 D;  4ZUX D;  4ZUX B;  5AV5 A;  3VH5 T;  4Z66 A;  4UPK A;  4NE6 A;  3LEL C;  4YM6 A;  3KUY D;  1M18 D;  3LJA D;  2HIO A;  1M18 B;  1TAF A;  4CAY A;  1KX5 C;  4UUZ B;  3WKJ C;  5G49 B;  2HUE B;  3LZ1 B;  3LZ0 C;  3TU4 D;  5AVB D;  5B2J C;  5AVB B;  5B33 C;  3X1S C;  2ARO C;  3KWQ D;  5B1M A;  3KWQ B;  3UTA A;  1KX4 C;  4LD9 A;  3WTP D;  3WA9 A;  3WTP B;  3O62 B;  3X1V C;  4G92 C;  1H3O B;  5AV5 D;  4Z66 D;  4Z66 B;  5CPJ C;  2J8P A;  1P3B A;  3MGP D;  4J8W B;  3MGS A;  1P3L C;  5AV9 C;  3AZI A;  5GSU A;  4H9O A;  4YM6 D;  3A6N B;  3KFU G;  2Y2J A;  2HIO D;  2HIO B;  3IP4 C;  1TAF B;  4CAY B;  5DNM A;  4QLC A;  3B0C W;  4R8P C;  5B0Z C;  3REH C;  3AZK A;  5B1M D;  2NQB A;  3UTA D;  1P3F B;  2ZY2 A;  3UTA B;  1U35 A;  4LD9 B;  3WA9 D;  3WA9 B;  3W99 C;  5KDM A;  5B24 C;  2Y2O A;  4J8V A;  2BYK A;  1F1E A;  3AZF C;  5BT1 C;  5AV8 A;  1P3B D;  1KX3 A;  3EPK A;  3MGS D;  3AZI D;  5GSU D;  3AZI B;  5GSU B;  4H9O B;  5B2I C;  4KGC A;  4YS3 A;  1M1A D;  3X1U A;  5DNM D;  3UT9 C;  1P34 A;  1PZR A;  4Z5T B;  4QLC B;  1P3A B;  3AZG A;  5FUG A;  3W97 C;  3VH6 W;  3AZK D;  2RVQ C;  2PYO D;  3AZK B;  3EPH A;  1S32 A;  2NQB D;  2Y2K A;  4HGA C;  3MGR C;  1U35 D;  3AZE A;  1F66 C;  4KUD C;  5AVC C;  4J8V D;  4J8V B;  3FDD A;  4WU9 C;  3B6G D;  2NZD B;  1ID3 C;  5JRG C;  5AV8 D;  3AZH C;  5AV8 B;  5B32 G;  1BH9 A;  1KX3 D;  1KX3 B;  4KGC D;  4X23 B;  5CPI A;  4YS3 D;  4J8U A;  2Y2M A;  3WTP E;  1ZLA A;  1EQZ C;  3X1U D;  1TZY A;  1P34 D;  2Y2Q A;  5DNN A;  3AZM C;  3AZG D;  3AZG B;  5FUG B;  5GT0 A;  3AZJ B;  2YFV A;  5CP6 A;  3KXB A;  3AYW C;  3C1C B;  4E44 A;  1HQ3 C;  5BS7 A;  1S32 D;  1R4V A;  1S32 B;  3AFA A;  1P3P C;  3AZE D;  3X1T A;  3AZE B;  2ZY5 A;  5E5A A;  2W8S A;  4KHA B;  2F2A C;  5F99 D;  3WAA C;  2Y2P A;  1BH9 B;  3REK C;  5GXQ C;  4XZQ A;  3KSY A;  3MNN C;  3B6F C;  5CPI B;  4J8U D;  3W96 A;  1P3K A;  4UUZ A;  1ZLA D;  2FJ7 A;  1TZY B;  5DNN D;  3AV2 A;  1Q9C A;  3UTB B;  3MVD B;  2ZM5 A;  2CV5 A;  5GT0 B;  3W98 C;  4ZUX C;  2YFV B;  5CP6 D;  4DQY B;  5B31 D;  3KXB B;  5JA4 B;  3AFA D;  3AFA B;  3X1T D;  2F8N H;  3H0L C;  5E5A D;  3KUY C;  1M18 C;  3LJA C;  4G91 B;  1H3O A;  2HUE C;  2YFW B;  4J8W A;  3TU4 C;  4DRA A;  5AVB C;  3A6N A;  4XUJ B;  4XZQ D;  4XZQ B;  3KWQ C;  3W96 D;  3VH5 A;  1P3K B;  3W96 B;  4DRB A;  3LZ1 D;  2FJ7 D;  2FJ7 B;  5AV6 B;  3WTP C;  3AV2 D;  3AV2 B;  3P5J B;  2CV5 D;  2CV5 B;  3WKJ A;  5B0Y B;  4NFT A;  4EO5 B;  5AV5 C;  4Z66 C;  4AWL C;  3C1B A;  3AN2 B;  1P3F A;  5BNX A;  3AZL B;  3MGP C;  3O62 D;  5CPK B;  4YM6 C;  2HIO C;  1KX4 A;  4CSR B;  2IO5 C;  3A1K A;  5B32 A;  3X1V A;  4J8W D;  3AZN B;  3A6N D;  3VH5 W;  1T3U A;  3H0M C;  5B1M C;  4ZBJ B;  3UTA C;  1AOI A;  1P3L A;  4Z5T A;  1P3A A;  3WA9 C;  3EPL A;  3WKJ B;  5C3I C;  3C1B D;  1P3F D;  3C1B B;  5BNX B;  3VH6 A;  3REJ A;  3H0R C;  1P3B C;  5B33 B;  4LD9 D;  2ZY3 A;  3MGS C;  2ARO B;  3AZI C;  5GSU C;  4Z2M G;  1KX4 B;  1M1A C;  2NZD A;  2DF4 C;  5DNM C;  2VQR A;  2G5H C;  5B32 D;  1P3G A;  2BG1 A;  5B32 B;  3X1V B;  4X23 A;  3AZK C;  2PYO C;  2NQB C;  1AOI D;  1AOI B;  1U35 C;  1P3L B;  3B0D C;  4Z5T D;  4QLC D;  5AV9 B;  1P3A D;  1P3O A;  2LY8 A;  2BYM B;  2L5A A;  4WJ3 C;  3AZJ A;  5B1L A;  3UT9 A;  2Y2H A;  4J8V C;  3C1C A;  3B6G C;  4Z2M H;  5AV8 C;  3W97 A;  3REJ D;  3REJ B;  4WU8 A;  1KX3 C;  1HTA A;  4KHA A;  4KGC C;  5B40 A;  4YS3 C;  2NZD D;  4J8X A;  3X1U C;  2Y2N A;  5GT3 A;  1P34 C;  2FFF B;  5B24 B;  3AZG C;  1P3G D;  1JFI A;  1P3G B;  1ID3 A;  4X23 D; 
#chains in the Genus database with same CATH homology
 1P3M A;  4H9P A;  1M19 A;  1S32 C;  3AZE C;  3UTB A;  1P3O D;  1P3O B;  3MVD A;  2Y2G A;  2JSS A;  4M6B A;  3AZJ D;  5B1L D;  5B1L B;  2G5I C;  3REI A;  3UT9 D;  5F99 C;  3UT9 B;  3C1C D;  5JA4 A;  5AY8 C;  1B67 A;  3W97 B;  4WU8 D;  4H9R A;  4WU8 B;  5BNV A;  5B40 D;  5B40 B;  4J8U C;  1WWI A;  5CHL B;  3V9R A;  1ZLA C;  4J8X D;  5GT3 D;  4J8X B;  2F8N G;  5GT3 B;  5DNN C;  4JJN A;  2YFW A;  1JFI B;  2Y2I A;  3REL A;  1P3I A;  4XUJ A;  4WU9 B;  1ID3 B;  5CP6 C;  1WWS A;  5CPI D;  5B31 C;  3AZH B;  1P3M D;  1M19 D;  5BS7 C;  1P3M B;  4H9P B;  1M19 B;  3AFA C;  1TZY D;  5AV6 A;  3X1T C;  3UTB D;  3W98 A;  3MVD D;  5E5A C;  5GT0 D;  2XD1 A;  5B0Y A;  3REI D;  3REI B;  4WNN A;  3KXB D;  3AZM B;  3AN2 A;  3AZL A;  5BO0 B;  5CPK A;  4H9R B;  4H9S C;  1HQ3 B;  5BNV B;  4XZQ C;  4CSR A;  3W96 C;  1P3P B;  3AV1 A;  2CWE A;  3MGQ A;  3V9R B;  3LZ1 C;  2FJ7 C;  4JJN D;  4JJN B;  3AV2 C;  2RIQ A;  3AZN A;  2CV5 C;  3REL D;  3REL B;  1P3I D;  4XUJ D;  1P3I B;  3WAA B;  4EO5 C;  1P3K D;  3LEL A;  5AV6 D;  3O62 C;  3MNN B;  1KX5 A;  5B0Y D;  4H9Q B;  3LZ0 A;  4WNN B;  3AN2 D;  3AZL D;  1B6W A;  5B2J A;  5B33 A;  4J8W C;  3X1S A;  2ARO A;  3R45 B;  4H9N B;  5CPK D;  3A6N C;  3W98 B;  3MGP A;  2XD5 A;  4ZBJ C;  3AV1 D;  3MGQ D;  3AV1 B;  3MGQ B;  3KUY B;  3LJA B;  3B0C T;  3AZN D;  5CPJ A;  2F8N K;  3C1B C;  1P3F C;  3TU4 B;  3LEL D;  3LEL B;  5AV9 A;  4LD9 C;  2BYM A;  1KX5 D;  5B31 G;  1KX5 B;  3WKJ D;  3LZ0 D;  3LZ0 B;  4R8P A;  5B0Z A;  5B2J D;  3REH A;  5B2J B;  5B33 D;  5B32 C;  3X1S D;  2ARO D;  3X1S B;  5AV5 B;  3NQU A;  4AWL B;  3A1I A;  1KX4 D;  3AL0 C;  3MGP B;  4NE5 A;  1AOI C;  2F8N A;  3W99 A;  4Z5T C;  4QLC C;  4YM6 B;  1P3A C;  5B24 A;  3X1V D;  4WZS B;  4G92 B;  1M1A A;  2IO5 B;  5CPJ D;  3VH6 T;  3AZF A;  5CPJ B;  2Y2L A;  1P3L D;  5AV9 D;  3REJ C;  5B2I A;  2PYO A;  1BH8 A;  5B1M B;  1BFM A;  2NZD C;  4R8P D;  5B0Z D;  4R8P B;  5B0Z B;  3REH D;  3REH B;  1P3G C;  3B6G A;  5C3I B;  4X23 C;  3NQU B;  3MGR A;  1F66 A;  1P3B B;  2F8N D;  2F8N B;  3MGS B;  3W99 D;  3W99 B;  4KUD A;  5B24 D;  1P3O C;  5AVC A;  2DQN C;  3AZJ C;  4WU9 A;  5B1L C;  3B0B A;  1M1A B;  5DNM B;  5JRG A;  3AZF D;  5BT1 D;  3C1C C;  3AZF B;  3AZH A;  1Z2C B;  5B2I D;  4WU8 C;  5B2I B;  2PYO B;  1BH8 B;  4E45 A;  1N1J A;  5B40 C;  1EQZ A;  2NQB B;  3F6T A;  1ULY A;  1U35 B;  3B0D B;  3AZM A;  4J8X C;  5GT3 C;  5BO0 A;  5KDM B;  3W97 D;  5F99 A;  3AYW A;  2BYK B;  2RVQ D;  4NE3 A;  1HQ3 A;  3B6G B;  5AY8 A;  5CPI C;  1P3P A;  3MGR D;  4HGA B;  1P3M C;  3MGR B;  1M19 C;  1F66 D;  1F66 B;  1TZY C;  3UTB C;  4KUD D;  4KGC B;  4KUD B;  5AVC D;  3MVD C;  4YS3 B;  5AVC B;  4WV4 B;  5GT0 C;  4WU9 D;  3WAA A;  2JCH A;  3X1U B;  3REI C;  1ID3 D;  1P34 B;  5JRG D;  3KXB C;  5JRG B;  3AZH D;  3REK A;  5GXQ A;  3MNN A;  3B6F A;  5B31 A;  3NQJ A;  1EQZ D;  1N1J B;  4G91 C;  1EQZ B;  4H9Q A;  3AZM D;  4JJN C;  3R45 A;  4H9N A;  4ZUX A;  3REL C;  5F99 B;  1A7W A;  3AYW D;  1P3I C;  3EG5 B;  4XUJ C;  3AYW B;  1HQ3 D;  5AY8 D;  5AY8 B;  1P3P D;  1P3K C;  1KU5 A;  1W2E A;  4H9S A;  5AV6 C;  3KUY A;  1M18 A;  3LJA A;  4J8U B;  2ZY4 A;  5G49 A;  5B0Y C;  3LZ1 A;  1ZLA B;  3WAA D;  5DNN B;  3AN2 C;  3TU4 A;  3AZL C;  5AVB A;  3REK D;  3REK B;  5GXQ D;  3MNN D;  5CPK C;  5GXQ B;  3EPJ A;  5CP6 B;  3KWQ A;  3B6F B;  3B6F D;  5B31 B;  3NQJ B;  2UWX A;  3AV1 C;  3WTP A;  3O62 A;  3MGQ C;  3X1T B;  5E5A B;  2JE5 A;  3AZN C;  3W98 D;  4ZUX D;  4ZUX B;  5AV5 A;  3VH5 T;  4Z66 A;  4UPK A;  4NE6 A;  3LEL C;  4YM6 A;  3KUY D;  1M18 D;  3LJA D;  2HIO A;  1M18 B;  1TAF A;  4CAY A;  1KX5 C;  4UUZ B;  3WKJ C;  5G49 B;  2HUE B;  3LZ1 B;  3LZ0 C;  3TU4 D;  5AVB D;  5B2J C;  5AVB B;  5B33 C;  3X1S C;  2ARO C;  3KWQ D;  5B1M A;  3KWQ B;  3UTA A;  1KX4 C;  4LD9 A;  3WTP D;  3WA9 A;  3WTP B;  3O62 B;  3X1V C;  4G92 C;  1H3O B;  5AV5 D;  4Z66 D;  4Z66 B;  5CPJ C;  2J8P A;  1P3B A;  3MGP D;  4J8W B;  3MGS A;  1P3L C;  5AV9 C;  3AZI A;  5GSU A;  4H9O A;  4YM6 D;  3A6N B;  3KFU G;  2Y2J A;  2HIO D;  2HIO B;  3IP4 C;  1TAF B;  4CAY B;  5DNM A;  4QLC A;  3B0C W;  4R8P C;  5B0Z C;  3REH C;  3AZK A;  5B1M D;  2NQB A;  3UTA D;  1P3F B;  2ZY2 A;  3UTA B;  1U35 A;  4LD9 B;  3WA9 D;  3WA9 B;  3W99 C;  5KDM A;  5B24 C;  2Y2O A;  4J8V A;  2BYK A;  1F1E A;  3AZF C;  5BT1 C;  5AV8 A;  1P3B D;  1KX3 A;  3EPK A;  3MGS D;  3AZI D;  5GSU D;  3AZI B;  5GSU B;  4H9O B;  5B2I C;  4KGC A;  4YS3 A;  1M1A D;  3X1U A;  5DNM D;  3UT9 C;  1P34 A;  1PZR A;  4Z5T B;  4QLC B;  1P3A B;  3AZG A;  5FUG A;  3W97 C;  3VH6 W;  3AZK D;  2RVQ C;  2PYO D;  3AZK B;  3EPH A;  1S32 A;  2NQB D;  2Y2K A;  4HGA C;  3MGR C;  1U35 D;  3AZE A;  1F66 C;  4KUD C;  5AVC C;  4J8V D;  4J8V B;  3FDD A;  4WU9 C;  3B6G D;  2NZD B;  1ID3 C;  5JRG C;  5AV8 D;  3AZH C;  5AV8 B;  5B32 G;  1BH9 A;  1KX3 D;  1KX3 B;  4KGC D;  4X23 B;  5CPI A;  4YS3 D;  4J8U A;  2Y2M A;  3WTP E;  1ZLA A;  1EQZ C;  3X1U D;  1TZY A;  1P34 D;  2Y2Q A;  5DNN A;  3AZM C;  3AZG D;  3AZG B;  5FUG B;  5GT0 A;  3AZJ B;  2YFV A;  5CP6 A;  3KXB A;  3AYW C;  3C1C B;  4E44 A;  1HQ3 C;  5BS7 A;  1S32 D;  1R4V A;  1S32 B;  3AFA A;  1P3P C;  3AZE D;  3X1T A;  3AZE B;  2ZY5 A;  5E5A A;  2W8S A;  4KHA B;  2F2A C;  5F99 D;  3WAA C;  2Y2P A;  1BH9 B;  3REK C;  5GXQ C;  4XZQ A;  3KSY A;  3MNN C;  3B6F C;  5CPI B;  4J8U D;  3W96 A;  1P3K A;  4UUZ A;  1ZLA D;  2FJ7 A;  1TZY B;  5DNN D;  3AV2 A;  1Q9C A;  3UTB B;  3MVD B;  2ZM5 A;  2CV5 A;  5GT0 B;  3W98 C;  4ZUX C;  2YFV B;  5CP6 D;  4DQY B;  5B31 D;  3KXB B;  5JA4 B;  3AFA D;  3AFA B;  3X1T D;  2F8N H;  3H0L C;  5E5A D;  3KUY C;  1M18 C;  3LJA C;  4G91 B;  1H3O A;  2HUE C;  2YFW B;  4J8W A;  3TU4 C;  4DRA A;  5AVB C;  3A6N A;  4XUJ B;  4XZQ D;  4XZQ B;  3KWQ C;  3W96 D;  3VH5 A;  1P3K B;  3W96 B;  4DRB A;  3LZ1 D;  2FJ7 D;  2FJ7 B;  5AV6 B;  3WTP C;  3AV2 D;  3AV2 B;  3P5J B;  2CV5 D;  2CV5 B;  3WKJ A;  5B0Y B;  4NFT A;  4EO5 B;  5AV5 C;  4Z66 C;  4AWL C;  3C1B A;  3AN2 B;  1P3F A;  5BNX A;  3AZL B;  3MGP C;  3O62 D;  5CPK B;  4YM6 C;  2HIO C;  1KX4 A;  4CSR B;  2IO5 C;  3A1K A;  5B32 A;  3X1V A;  4J8W D;  3AZN B;  3A6N D;  3VH5 W;  1T3U A;  3H0M C;  5B1M C;  4ZBJ B;  3UTA C;  1AOI A;  1P3L A;  4Z5T A;  1P3A A;  3WA9 C;  3EPL A;  3WKJ B;  5C3I C;  3C1B D;  1P3F D;  3C1B B;  5BNX B;  3VH6 A;  3REJ A;  3H0R C;  1P3B C;  5B33 B;  4LD9 D;  2ZY3 A;  3MGS C;  2ARO B;  3AZI C;  5GSU C;  4Z2M G;  1KX4 B;  1M1A C;  2NZD A;  2DF4 C;  5DNM C;  2VQR A;  2G5H C;  5B32 D;  1P3G A;  2BG1 A;  5B32 B;  3X1V B;  4X23 A;  3AZK C;  2PYO C;  2NQB C;  1AOI D;  1AOI B;  1U35 C;  1P3L B;  3B0D C;  4Z5T D;  4QLC D;  5AV9 B;  1P3A D;  1P3O A;  2LY8 A;  2BYM B;  2L5A A;  4WJ3 C;  3AZJ A;  5B1L A;  3UT9 A;  2Y2H A;  4J8V C;  3C1C A;  3B6G C;  4Z2M H;  5AV8 C;  3W97 A;  3REJ D;  3REJ B;  4WU8 A;  1KX3 C;  1HTA A;  4KHA A;  4KGC C;  5B40 A;  4YS3 C;  2NZD D;  4J8X A;  3X1U C;  2Y2N A;  5GT3 A;  1P34 C;  2FFF B;  5B24 B;  3AZG C;  1P3G D;  1JFI A;  1P3G B;  1ID3 A;  4X23 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...