1U35B

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35B00
5FUGA 3MVDD 3AZNB 3MNND 1KX5B 1P34B 2NQBC 2L5AA 3AZEA 5CPKB 3RELB 1M18D 3B6FB 5B1LB 5JA4A 5AV8B 3AZHC 5B32C 3AV1C 1KX4C 3AZKD 4J8UC 2NZDC 3X1UD 2IO5C 3UTBA 5E5AA 3MGSA 2HIOA 3AZEB 3MGRD 3REIB 3W98D 5JA4B 3WKJC 4X23A 4H9NA 2F8NG 1EQZD 3UTBB 5B31C 5E5AB 5GT0A 3AZLD 5B33B 3MGSB 2HIOB 3AV2D 3B6GB 5B0YC 4NE6A 3B0BA 4X23B 4H9NB 5GT0B 1U35D 4DRBA 1KX3C 3LJAD 1AOIA 1B6WA 1M1AD 4CAYA 4AWLC 4UUZA 3AYWC 4XUJA 3AZGC 1P3GD 1HQ3D 5F99A 1P3MD 4YS3A 5B24C 3X1TA 4CAYB 3MGQC 3MVDA 4UUZB 3MNNA 2PYOC 3AZFD 4J8WD 4XUJB 1Q9CA 2BYKA 1M18A 3C1BC 1H3OB 3WTPC 4YS3B 1S32D 4G92C 3X1TB 4JJNB 4ZUXD 3MVDB 5CPIC 3X1UA 3MNNB 3W97D 5CPJC 2BYKB 1M18B 3MGRA 3W98A 3VH5A 3VH6W 3VH6T 1A7WA 3AZKB 3X1UB 3AZLA 4WV4B 2F8NK 3AZMD 3MGRB 3W98B 2FJ7D 2HUEC 1TZYA 4EO5B 1BH9A 2AROD 1EQZB 3AZLB 1U35A 5JRGD 4KGCD 4WU8C 1P3IA 3REHD 5BT1D 3AV2B 3UTAC 3LJAA 5BS7C 3WTPE 5B2JC 1M1AA 4LD9D 3W99D 5AV9D 4KUDC 1U35B 1P3GA 3X1SA 1JFIA 3AZNC 3LJAB 1KX5C 1P34C 1M1AB 2F8NH 5CPKC 3RELC 2JSSA 4HGAB 3B6FC 1M19D 5B1LC 5AV5C 3AZFA 5AV8C 1P3GB 1P3AD 5DNMC 1HQ3B 3AZJD 1JFIB 5CP6D 1P3MB 1S32A 4ZUXA 3AZEC 3AZID 3LZ0D 1P3PD 3AZFB 4J8WB 5GXQD 3KUYD 3WAAD 3REJA 3UTBC 5E5AC 3MGPD 5B33C 1S32B 3MGSC 2HIOC 4ZUXB 3AN2D 3W97B 4XZQD 4X23C 3AZMA 3KWQD 2FJ7A 5GT0C 4KUDA 2AROA 4KGCA 5JRGA 3REHA 3AZMB 2FJ7B 4WZSB 3C1CD 5B1MD 4E44A 3UT9D 4LD9A 2AROB 4KGCB 5JRGB 1AOIC 3REHB 3REIA 3X1VD 4XUJC 4J8VD 4LD9B 5F99C 1M19A 5AV9B 4YS3C 1P3AA 3X1TC 5B33A 5AVBD 4Z66D 3AZJA 3MVDC 1BH8A 3MNNC 5CP6A 3B6GA 5B32D 3R45A 3AZIA 1M18C 3LZ0A 4QLCD 1KU5A 1M19B 1P3AB 5GXQA 3KUYA 3AZKC 3AZJB 3X1UC 3WAAA 1BH8B 2CV5D 3B0DB 5CP6B 3MGPA 3R45B 3AZIB 3LZ0B 3MGRC 3AN2A 4XZQA 1P3PB 3W98C 5B31D 5GXQB 3VH6A 3KUYB 3KWQA 3WAAB 3MGPB 3AZLC 3AN2B 4XZQB 5B0ZD 4H9PA 1TZYC 3KWQB 1ZLAD 3C1CA 1U35C 1H3OA 1ID3D 5B1MA 1P3IC 3UT9A 4JJNA 1P3BD 3LJAC 4H9PB 2LY8A 1M1AC 1WWSA 1P3KD 3C1CB 1P3GC 4J8VA 5B1MB 3MGQD 3UT9B 3AZKA 3X1SC 2PYOD 2YFVB 5AVBA 4Z66A 5DNND 3LELD 3AZFC 3X1VB 4KHAA 4J8VB 4QLCA 1EQZA 3A6ND 5KDMA 1S32C 2BYMA 4Z66B 5B40D 5AVBB 4ZUXC 5CPJD 4Z2MH 3TU4D 4R8PD 1HTAA 2CV5A 3W97C 3AV2A 5G49A 4KHAB 5B32B 3NQUA 3KXBD 4QLCB 3REJC 4NFTA 5KDMB 2BYMB 5BO0A 5B2ID 3KSYA 2CV5B 5G49B 3NQUB 3AZMC 5GSUD 5B0ZA 2FJ7C 5B31B 4G91B 1F66D 5BO0B 4YM6D 5AY8D 1ZLAA 1HQ3A 2AROC 4CSRA 5AVCD 4KGCC 5JRGC 4H9RA 4H9QA 1P3MA 1ID3A 3REHC 5BT1C 1P3BA 1P3OD 5B0ZB 4E45A 4WU9D 4J8WA 4LD9C 1ZLAB 1P3KA 4CSRB 4H9RB 4H9QB 1ID3B 5AV6D 1P3BB 4AWLB 3W97A 3REIC 5AV5D 3O62D 4NE5A 5DNMD 5DNNA 1P3KB 3LELA 1M19C 1P3AC 3MGQB 3AZJC 3AZED 5BNXB 5CP6C 2PYOB 3B6GC 3A6NA 5B40A 3VH5W 3AZIC 3TU4A 5DNNB 4R8PA 3VH5T 3LZ0C 3LELB 1P3LD 5GXQC 3KXBA 3KUYC 4H9OA 3WAAC 3W96D 4H9SA 3A6NB 3MGPC 5B40B 2RVQD 5GT3D 5B2IA 3TU4B 4R8PB 5CPJB 3AN2C 4XZQC 3AFAD 2F8ND 4Z2MG 3REKD 3KXBB 4Z5TD 1P3FD 5GSUA 3KWQC 4J8XD 4H9OB 3W99A 5AV9A 3WA9D 1F66A 5B2IB 4YM6A 5AY8A 5AVCA 3LZ1D 1B67A 1P3OA 5GSUB 5C3IB 3W99B 3C1CC 4WU9A 1AOID 5B1MC 1F66B 2NQBD 4YM6B 5AY8B 4JJNC 3UT9C 5AVCB 5AV6A 3AZHD 1P3OB 3AV1D 1KX4D 5F99D 4J8UD 1P3PA 2NZDD 4WU9B 3O62A 4J8VC 5AV6B 5AVBC 4Z66C 3WKJD 5AV5B 3O62B 2CWEA 5DNMB 5FUGB 4QLCC 1P3LA 4EO5C 1EQZC 5B0YD 2CV5C 3AV2C 3W96A 4DRAA 5GT3A 3AFAA 1P3LB 1KX3D 2F8NA 4G91C 3REKA 4Z5TA 1P3FA 4J8XA 3W96B 2YFWA 3AYWD 3WA9A 2YFVA 5GT3B 4ZBJB 1TZYD 3AZGD 5B0ZC 3AFAB 4HGAC 3LZ1A 2F8NB 3REKB 3X1VA 4Z5TB 1P3ID 4J8XB 1P3FB 5B24D 1ZLAC 1HQ3C 5CHLB 2YFWB 5BNVA 1P3MC 1ID3C 3WA9B 2NQBA 1P3BC 3LZ1B 3V9RA 3C1BD 5B32G 4J8WC 3WTPD 5B32A 3AZHA 3AV1A 1F1EA 1KX4A 1P3KC 3X1SD 4J8UA 2NZDA 5CPID 5BNVB 1AOIB 2NQBB 3V9RB 3NQJA 3AZHB 3WKJA 5DNNC 3AV1B 1KX4B 5F99B 3LELC 4NE3A 4J8UB 1R4VA 5B31G 2IO5B 2NZDB 5B31A 1TAFA 1N1JA 3A6NC 3NQJB 5B40C 5B0YA 3WKJB 3TU4C 4R8PC 3REJD 3KXBC 4WU8D 1TAFB 1KX3A 1N1JB 4H9SC 3UTAD 5B0YB 5B2IC 5B2JD 1BFMA 3AYWA 4KUDD 3AZGA 5GSUC 5C3IC 1KX3B 3W99C 5AV9C 4WNNA 3AZND 1KX5D 1ULYA 1P34D 1F66C 4YM6C 5B24A 5AY8C 3MGQA 3B0CW 3RELD 5BNXA 5AVCC 5CPKD 3B6FD 3B0CT 2PYOA 5B1LD 3AYWB 5AV8D 1TZYB 3AZGB 1P3OC 3C1BA 1BH9B 4WNNB 4WU9C 3WTPA 1P3IB 5B24B 5CPIA 3B0DC 4M6BA 3REID 5AV6C 5CPJA 3C1BB 1P3PC 3UTBD 3WTPB 5E5AD 3O62C 5B33D 4G92B 3MGSD 2HIOD 3X1SB 5CPIB 1WWIA 3B6GD 4X23D 5GT0D 1P3LC 4WU8A 3W96C 3UTAA 2RVQC 5BS7A 5GT3C 5B2JA 2HUEB 4ZBJC 3AFAC 3REJB 3REKC 4Z5TC 1P3FC 4WU8B 4J8XC 3AZNA 3UTAB 1KX5A 3WA9C 1P34A 4XUJD 5B2JB 5CPKA 3RELA 3LZ1C 3B6FA 5B1LA 4KUDB 5AV5A 3X1VC 5AV8A 4YS3D 3X1TD 5DNMA 4JJND
chains in the Genus database with same CATH superfamily
5FUGA 3MVDD 3AZNB 3MNND 1KX5B 1P34B 2NQBC 2L5AA 3AZEA 5CPKB 3RELB 1M18D 3B6FB 5B1LB 5JA4A 5AV8B 3AZHC 5B32C 3AV1C 1KX4C 3AZKD 4J8UC 2NZDC 3X1UD 2IO5C 3UTBA 2ZY4A 5E5AA 3MGSA 2HIOA 3AZEB 3MGRD 3REIB 3W98D 5JA4B 3WKJC 4X23A 4H9NA 2F8NG 1EQZD 3UTBB 5B31C 5E5AB 5GT0A 3AZLD 5B33B 3MGSB 2HIOB 3AV2D 3B6GB 5B0YC 4NE6A 3B0BA 4X23B 4H9NB 5GT0B 1U35D 4DRBA 1KX3C 2DF4C 3LJAD 1AOIA 1B6WA 1M1AD 4CAYA 4AWLC 4UUZA 3AYWC 4XUJA 3EPHA 3AZGC 1P3GD 1HQ3D 5F99A 1P3MD 4YS3A 5B24C 3X1TA 4CAYB 3MGQC 3MVDA 4UUZB 3MNNA 2PYOC 3AZFD 4J8WD 4XUJB 1Q9CA 2BYKA 1M18A 3C1BC 3IP4C 1H3OB 3WTPC 4YS3B 1S32D 4G92C 3X1TB 4JJNB 4ZUXD 3MVDB 5CPIC 3X1UA 3MNNB 3W97D 5CPJC 2BYKB 1M18B 3MGRA 3W98A 3VH5A 3VH6W 3VH6T 1A7WA 3AZKB 3X1UB 3AZLA 4WV4B 2F8NK 3AZMD 3MGRB 3W98B 3KFUG 2FJ7D 2HUEC 1TZYA 4EO5B 1BH9A 2AROD 1EQZB 3AZLB 1U35A 5JRGD 4KGCD 4WU8C 1P3IA 3REHD 5BT1D 3AV2B 3UTAC 3LJAA 5BS7C 3WTPE 5B2JC 1M1AA 4LD9D 3W99D 5AV9D 4KUDC 1U35B 1P3GA 3X1SA 1JFIA 3AZNC 3LJAB 1KX5C 1P34C 1M1AB 2F8NH 5CPKC 3RELC 2JSSA 4HGAB 3B6FC 1M19D 5B1LC 5AV5C 3AZFA 5AV8C 1P3GB 1P3AD 5DNMC 1HQ3B 3AZJD 3EG5B 1JFIB 5CP6D 1P3MB 2ZY3A 1S32A 4ZUXA 3AZEC 3AZID 3LZ0D 3EPKA 1P3PD 3AZFB 4J8WB 5GXQD 3KUYD 3WAAD 3REJA 3UTBC 5E5AC 3MGPD 5B33C 1S32B 3MGSC 2HIOC 4ZUXB 3AN2D 3W97B 4XZQD 4X23C 3AZMA 3KWQD 2FJ7A 5GT0C 4KUDA 2AROA 4KGCA 5JRGA 4UPKA 3REHA 3AZMB 2FJ7B 4WZSB 3C1CD 3F6TA 5B1MD 4E44A 3UT9D 4LD9A 2AROB 3FDDA 4KGCB 2Y2LA 5JRGB 1AOIC 3REHB 3REIA 3X1VD 4XUJC 4J8VD 2JE5A 4LD9B 5F99C 1M19A 5AV9B 4YS3C 1P3AA 3X1TC 5B33A 5AVBD 4Z66D 3AZJA 3MVDC 2ZY2A 3H0MC 1BH8A 3MNNC 5CP6A 3B6GA 5B32D 3R45A 3AZIA 1M18C 3LZ0A 4QLCD 1KU5A 1M19B 1P3AB 5GXQA 3KUYA 3AZKC 3AZJB 3X1UC 3WAAA 1BH8B 2CV5D 3B0DB 5CP6B 3MGPA 1W2EA 1Z2CB 3R45B 3AZIB 3LZ0B 3MGRC 3AN2A 4XZQA 1P3PB 3W98C 5B31D 5GXQB 3VH6A 3KUYB 3KWQA 3WAAB 3MGPB 3AZLC 3AN2B 4XZQB 5B0ZD 4H9PA 1TZYC 3KWQB 4DQYB 1ZLAD 3C1CA 1U35C 1H3OA 1ID3D 5B1MA 1P3IC 3UT9A 4JJNA 1P3BD 2Y2IA 3LJAC 2LY8A 4H9PB 1M1AC 1T3UA 1WWSA 1P3KD 3C1CB 2Y2PA 4J8VA 5B1MB 1P3GC 3MGQD 3UT9B 3AZKA 3X1SC 2PYOD 2YFVB 5AVBA 4Z66A 5DNND 3LELD 3AZFC 3X1VB 4KHAA 4J8VB 4QLCA 1EQZA 3A6ND 5KDMA 1S32C 2BYMA 4Z66B 5B40D 5AVBB 4ZUXC 5CPJD 4Z2MH 3TU4D 4R8PD 1HTAA 2CV5A 3W97C 3AV2A 5G49A 4KHAB 5B32B 3NQUA 3KXBD 2ZY5A 4QLCB 3REJC 4NFTA 2XD5A 5KDMB 2BYMB 5BO0A 5B2ID 3KSYA 2CV5B 5G49B 3NQUB 3AZMC 5GSUD 5B0ZA 2FJ7C 5B31B 4G91B 1F66D 5BO0B 4YM6D 5AY8D 1ZLAA 1HQ3A 2AROC 4CSRA 5AVCD 4KGCC 5JRGC 4H9RA 4H9QA 1P3MA 1ID3A 3REHC 5BT1C 1P3BA 1P3OD 5B0ZB 4E45A 4WU9D 4J8WA 2DQNC 2G5HC 2Y2JA 1ZLAB 1P3KA 4LD9C 4CSRB 4H9RB 4H9QB 1ID3B 5AV6D 1P3BB 2F2AC 4AWLB 3W97A 3REIC 5AV5D 3O62D 4NE5A 5DNMD 5DNNA 1P3KB 3LELA 1M19C 2BG1A 1P3AC 3MGQB 3AZJC 3AZED 5BNXB 5CP6C 2PYOB 3B6GC 3A6NA 2Y2HA 5B40A 3EPLA 3VH5W 3AZIC 3TU4A 5DNNB 4R8PA 3VH5T 3LZ0C 3LELB 1P3LD 5GXQC 3KXBA 3KUYC 4H9OA 3WAAC 3W96D 4H9SA 3A6NB 3MGPC 5B40B 2RVQD 3A1KA 5GT3D 5B2IA 3TU4B 4R8PB 5CPJB 3AN2C 4XZQC 3AFAD 2F8ND 4Z2MG 3REKD 3KXBB 4Z5TD 1P3FD 5GSUA 3KWQC 4J8XD 4H9OB 3W99A 5AV9A 3P5JB 3WA9D 1F66A 5B2IB 4YM6A 5AY8A 2JCHA 5AVCA 3LZ1D 1B67A 2Y2NA 1P3OA 5GSUB 5C3IB 3W99B 3C1CC 4WU9A 1AOID 5B1MC 1F66B 2NQBD 4YM6B 5AY8B 4JJNC 3UT9C 5AVCB 5AV6A 3AZHD 1P3OB 3AV1D 1KX4D 5F99D 4J8UD 1P3PA 2NZDD 2XD1A 4WU9B 3O62A 4J8VC 5AV6B 5AVBC 4Z66C 3WKJD 5AV5B 3O62B 2CWEA 5DNMB 5FUGB 4QLCC 1P3LA 4EO5C 1EQZC 2UWXA 5B0YD 2CV5C 3AV2C 3W96A 2Y2OA 4DRAA 5GT3A 3AFAA 1P3LB 1KX3D 2F8NA 4G91C 3REKA 4Z5TA 1P3FA 4J8XA 3AL0C 3W96B 2YFWA 3AYWD 3WA9A 2YFVA 5GT3B 4ZBJB 1TZYD 3AZGD 5B0ZC 3AFAB 4HGAC 3LZ1A 2F8NB 3REKB 3X1VA 4Z5TB 1P3ID 4J8XB 1P3FB 5B24D 1ZLAC 1HQ3C 5CHLB 2VQRA 2YFWB 5BNVA 1P3MC 1ID3C 3WA9B 2NQBA 1P3BC 1PZRA 3LZ1B 3V9RA 3A1IA 3C1BD 5B32G 4J8WC 3WTPD 5B32A 3AZHA 3AV1A 1F1EA 1KX4A 1P3KC 3X1SD 4J8UA 2NZDA 2W8SA 5CPID 5BNVB 1AOIB 2NQBB 3V9RB 3NQJA 3H0LC 3AZHB 3WKJA 5DNNC 3AV1B 1KX4B 5F99B 3LELC 4NE3A 4J8UB 1R4VA 2Y2MA 2IO5B 5B31G 2NZDB 5B31A 1TAFA 1N1JA 3A6NC 3NQJB 5B40C 5B0YA 3WKJB 3TU4C 4R8PC 3REJD 3KXBC 4WJ3C 4WU8D 1TAFB 1KX3A 1N1JB 4H9SC 3UTAD 5B0YB 2RIQA 5B2IC 5B2JD 1BFMA 3AYWA 4KUDD 3AZGA 5GSUC 5C3IC 1KX3B 3W99C 5AV9C 4WNNA 3AZND 1KX5D 1ULYA 1P34D 1F66C 4YM6C 5B24A 5AY8C 3MGQA 3B0CW 3RELD 5BNXA 5AVCC 5CPKD 3B6FD 3B0CT 3EPJA 2PYOA 5B1LD 3AYWB 5AV8D 2J8PA 1TZYB 3AZGB 1P3OC 3C1BA 1BH9B 4WNNB 4WU9C 3WTPA 1P3IB 5B24B 2Y2GA 5CPIA 3B0DC 4M6BA 3REID 5AV6C 5CPJA 3C1BB 1P3PC 3UTBD 3WTPB 5E5AD 3O62C 5B33D 4G92B 3MGSD 2HIOD 3X1SB 5CPIB 1WWIA 3B6GD 2Y2KA 4X23D 5GT0D 1P3LC 2G5IC 4WU8A 3W96C 3UTAA 2RVQC 5BS7A 5GT3C 5B2JA 2HUEB 4ZBJC 2Y2QA 3AFAC 3H0RC 3REJB 3REKC 2FFFB 4Z5TC 1P3FC 4WU8B 4J8XC 3AZNA 3UTAB 1KX5A 3WA9C 1P34A 4XUJD 5B2JB 5CPKA 3RELA 3LZ1C 3B6FA 5B1LA 4KUDB 5AV5A 3X1VC 5AV8A 2ZM5A 4YS3D 3X1TD 5DNMA 4JJND
chains in the Genus database with same CATH topology
5FUGA 3MVDD 3AZNB 3MNND 1KX5B 1P34B 2NQBC 2L5AA 3AZEA 5CPKB 3RELB 1M18D 3B6FB 5B1LB 5JA4A 5AV8B 3AZHC 5B32C 3AV1C 1KX4C 3AZKD 4J8UC 2NZDC 3X1UD 2IO5C 3UTBA 2ZY4A 5E5AA 3MGSA 2HIOA 3AZEB 3MGRD 3REIB 3W98D 5JA4B 3WKJC 4X23A 4H9NA 2F8NG 1EQZD 3UTBB 5B31C 5E5AB 5GT0A 3AZLD 5B33B 3MGSB 2HIOB 3AV2D 3B6GB 5B0YC 4NE6A 3B0BA 4X23B 4H9NB 5GT0B 1U35D 4DRBA 1KX3C 2DF4C 3LJAD 1AOIA 1B6WA 1M1AD 4CAYA 4AWLC 4UUZA 3AYWC 4XUJA 3EPHA 3AZGC 1P3GD 1HQ3D 5F99A 1P3MD 4YS3A 5B24C 3X1TA 4CAYB 3MGQC 3MVDA 4UUZB 3MNNA 2PYOC 3AZFD 4J8WD 4XUJB 1Q9CA 2BYKA 1M18A 3C1BC 3IP4C 1H3OB 3WTPC 4YS3B 1S32D 4G92C 3X1TB 4JJNB 4ZUXD 3MVDB 5CPIC 3X1UA 3MNNB 3W97D 5CPJC 2BYKB 1M18B 3MGRA 3W98A 3VH5A 3VH6W 3VH6T 1A7WA 3AZKB 3X1UB 3AZLA 4WV4B 2F8NK 3AZMD 3MGRB 3W98B 3KFUG 2FJ7D 2HUEC 1TZYA 4EO5B 1BH9A 2AROD 1EQZB 3AZLB 1U35A 5JRGD 4KGCD 4WU8C 1P3IA 3REHD 5BT1D 3AV2B 3UTAC 3LJAA 5BS7C 3WTPE 5B2JC 1M1AA 4LD9D 3W99D 5AV9D 4KUDC 1U35B 1P3GA 3X1SA 1JFIA 3AZNC 3LJAB 1KX5C 1P34C 1M1AB 2F8NH 5CPKC 3RELC 2JSSA 4HGAB 3B6FC 1M19D 5B1LC 5AV5C 3AZFA 5AV8C 1P3GB 1P3AD 5DNMC 1HQ3B 3AZJD 3EG5B 1JFIB 5CP6D 1P3MB 2ZY3A 1S32A 4ZUXA 3AZEC 3AZID 3LZ0D 3EPKA 1P3PD 3AZFB 4J8WB 5GXQD 3KUYD 3WAAD 3REJA 3UTBC 5E5AC 3MGPD 5B33C 1S32B 3MGSC 2HIOC 4ZUXB 3AN2D 3W97B 4XZQD 4X23C 3AZMA 3KWQD 2FJ7A 5GT0C 4KUDA 2AROA 4KGCA 5JRGA 4UPKA 3REHA 3AZMB 2FJ7B 4WZSB 3C1CD 3F6TA 5B1MD 4E44A 3UT9D 4LD9A 2AROB 3FDDA 4KGCB 2Y2LA 5JRGB 1AOIC 3REHB 3REIA 3X1VD 4XUJC 4J8VD 2JE5A 4LD9B 5F99C 1M19A 5AV9B 4YS3C 1P3AA 3X1TC 5B33A 5AVBD 4Z66D 3AZJA 3MVDC 2ZY2A 3H0MC 1BH8A 3MNNC 5CP6A 3B6GA 5B32D 3R45A 3AZIA 1M18C 3LZ0A 4QLCD 1KU5A 1M19B 1P3AB 5GXQA 3KUYA 3AZKC 3AZJB 3X1UC 3WAAA 1BH8B 2CV5D 3B0DB 5CP6B 3MGPA 1W2EA 1Z2CB 3R45B 3AZIB 3LZ0B 3MGRC 3AN2A 4XZQA 1P3PB 3W98C 5B31D 5GXQB 3VH6A 3KUYB 3KWQA 3WAAB 3MGPB 3AZLC 3AN2B 4XZQB 5B0ZD 4H9PA 1TZYC 3KWQB 4DQYB 1ZLAD 3C1CA 1U35C 1H3OA 1ID3D 5B1MA 1P3IC 3UT9A 4JJNA 1P3BD 2Y2IA 3LJAC 2LY8A 4H9PB 1M1AC 1T3UA 1WWSA 1P3KD 3C1CB 2Y2PA 4J8VA 5B1MB 1P3GC 3MGQD 3UT9B 3AZKA 3X1SC 2PYOD 2YFVB 5AVBA 4Z66A 5DNND 3LELD 3AZFC 3X1VB 4KHAA 4J8VB 4QLCA 1EQZA 3A6ND 5KDMA 1S32C 2BYMA 4Z66B 5B40D 5AVBB 4ZUXC 5CPJD 4Z2MH 3TU4D 4R8PD 1HTAA 2CV5A 3W97C 3AV2A 5G49A 4KHAB 5B32B 3NQUA 3KXBD 2ZY5A 4QLCB 3REJC 4NFTA 2XD5A 5KDMB 2BYMB 5BO0A 5B2ID 3KSYA 2CV5B 5G49B 3NQUB 3AZMC 5GSUD 5B0ZA 2FJ7C 5B31B 4G91B 1F66D 5BO0B 4YM6D 5AY8D 1ZLAA 1HQ3A 2AROC 4CSRA 5AVCD 4KGCC 5JRGC 4H9RA 4H9QA 1P3MA 1ID3A 3REHC 5BT1C 1P3BA 1P3OD 5B0ZB 4E45A 4WU9D 4J8WA 2DQNC 2G5HC 2Y2JA 1ZLAB 1P3KA 4LD9C 4CSRB 4H9RB 4H9QB 1ID3B 5AV6D 1P3BB 2F2AC 4AWLB 3W97A 3REIC 5AV5D 3O62D 4NE5A 5DNMD 5DNNA 1P3KB 3LELA 1M19C 2BG1A 1P3AC 3MGQB 3AZJC 3AZED 5BNXB 5CP6C 2PYOB 3B6GC 3A6NA 2Y2HA 5B40A 3EPLA 3VH5W 3AZIC 3TU4A 5DNNB 4R8PA 3VH5T 3LZ0C 3LELB 1P3LD 5GXQC 3KXBA 3KUYC 4H9OA 3WAAC 3W96D 4H9SA 3A6NB 3MGPC 5B40B 2RVQD 3A1KA 5GT3D 5B2IA 3TU4B 4R8PB 5CPJB 3AN2C 4XZQC 3AFAD 2F8ND 4Z2MG 3REKD 3KXBB 4Z5TD 1P3FD 5GSUA 3KWQC 4J8XD 4H9OB 3W99A 5AV9A 3P5JB 3WA9D 1F66A 5B2IB 4YM6A 5AY8A 2JCHA 5AVCA 3LZ1D 1B67A 2Y2NA 1P3OA 5GSUB 5C3IB 3W99B 3C1CC 4WU9A 1AOID 5B1MC 1F66B 2NQBD 4YM6B 5AY8B 4JJNC 3UT9C 5AVCB 5AV6A 3AZHD 1P3OB 3AV1D 1KX4D 5F99D 4J8UD 1P3PA 2NZDD 2XD1A 4WU9B 3O62A 4J8VC 5AV6B 5AVBC 4Z66C 3WKJD 5AV5B 3O62B 2CWEA 5DNMB 5FUGB 4QLCC 1P3LA 4EO5C 1EQZC 2UWXA 5B0YD 2CV5C 3AV2C 3W96A 2Y2OA 4DRAA 5GT3A 3AFAA 1P3LB 1KX3D 2F8NA 4G91C 3REKA 4Z5TA 1P3FA 4J8XA 3AL0C 3W96B 2YFWA 3AYWD 3WA9A 2YFVA 5GT3B 4ZBJB 1TZYD 3AZGD 5B0ZC 3AFAB 4HGAC 3LZ1A 2F8NB 3REKB 3X1VA 4Z5TB 1P3ID 4J8XB 1P3FB 5B24D 1ZLAC 1HQ3C 5CHLB 2VQRA 2YFWB 5BNVA 1P3MC 1ID3C 3WA9B 2NQBA 1P3BC 1PZRA 3LZ1B 3V9RA 3A1IA 3C1BD 5B32G 4J8WC 3WTPD 5B32A 3AZHA 3AV1A 1F1EA 1KX4A 1P3KC 3X1SD 4J8UA 2NZDA 2W8SA 5CPID 5BNVB 1AOIB 2NQBB 3V9RB 3NQJA 3H0LC 3AZHB 3WKJA 5DNNC 3AV1B 1KX4B 5F99B 3LELC 4NE3A 4J8UB 1R4VA 2Y2MA 2IO5B 5B31G 2NZDB 5B31A 1TAFA 1N1JA 3A6NC 3NQJB 5B40C 5B0YA 3WKJB 3TU4C 4R8PC 3REJD 3KXBC 4WJ3C 4WU8D 1TAFB 1KX3A 1N1JB 4H9SC 3UTAD 5B0YB 2RIQA 5B2IC 5B2JD 1BFMA 3AYWA 4KUDD 3AZGA 5GSUC 5C3IC 1KX3B 3W99C 5AV9C 4WNNA 3AZND 1KX5D 1ULYA 1P34D 1F66C 4YM6C 5B24A 5AY8C 3MGQA 3B0CW 3RELD 5BNXA 5AVCC 5CPKD 3B6FD 3B0CT 3EPJA 2PYOA 5B1LD 3AYWB 5AV8D 2J8PA 1TZYB 3AZGB 1P3OC 3C1BA 1BH9B 4WNNB 4WU9C 3WTPA 1P3IB 5B24B 2Y2GA 5CPIA 3B0DC 4M6BA 3REID 5AV6C 5CPJA 3C1BB 1P3PC 3UTBD 3WTPB 5E5AD 3O62C 5B33D 4G92B 3MGSD 2HIOD 3X1SB 5CPIB 1WWIA 3B6GD 2Y2KA 4X23D 5GT0D 1P3LC 2G5IC 4WU8A 3W96C 3UTAA 2RVQC 5BS7A 5GT3C 5B2JA 2HUEB 4ZBJC 2Y2QA 3AFAC 3H0RC 3REJB 3REKC 2FFFB 4Z5TC 1P3FC 4WU8B 4J8XC 3AZNA 3UTAB 1KX5A 3WA9C 1P34A 4XUJD 5B2JB 5CPKA 3RELA 3LZ1C 3B6FA 5B1LA 4KUDB 5AV5A 3X1VC 5AV8A 2ZM5A 4YS3D 3X1TD 5DNMA 4JJND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG A;  3MVD D;  3AZN B;  3MNN D;  1KX5 B;  1P34 B;  2NQB C;  2L5A A;  3AZE A;  5CPK B;  3REL B;  1M18 D;  3B6F B;  5B1L B;  5JA4 A;  5AV8 B;  3AZH C;  5B32 C;  3AV1 C;  1KX4 C;  3AZK D;  4J8U C;  2NZD C;  3X1U D;  2IO5 C;  3UTB A;  5E5A A;  3MGS A;  2HIO A;  3AZE B;  3MGR D;  3REI B;  3W98 D;  5JA4 B;  3WKJ C;  4X23 A;  4H9N A;  2F8N G;  1EQZ D;  3UTB B;  5B31 C;  5E5A B;  5GT0 A;  3AZL D;  5B33 B;  3MGS B;  2HIO B;  3AV2 D;  3B6G B;  5B0Y C;  4NE6 A;  3B0B A;  4X23 B;  4H9N B;  5GT0 B;  1U35 D;  4DRB A;  1KX3 C;  3LJA D;  1AOI A;  1B6W A;  1M1A D;  4CAY A;  4AWL C;  4UUZ A;  3AYW C;  4XUJ A;  3AZG C;  1P3G D;  1HQ3 D;  5F99 A;  1P3M D;  4YS3 A;  5B24 C;  3X1T A;  4CAY B;  3MGQ C;  3MVD A;  4UUZ B;  3MNN A;  2PYO C;  3AZF D;  4J8W D;  4XUJ B;  1Q9C A;  2BYK A;  1M18 A;  3C1B C;  1H3O B;  3WTP C;  4YS3 B;  1S32 D;  4G92 C;  3X1T B;  4JJN B;  4ZUX D;  3MVD B;  5CPI C;  3X1U A;  3MNN B;  3W97 D;  5CPJ C;  2BYK B;  1M18 B;  3MGR A;  3W98 A;  3VH5 A;  3VH6 W;  3VH6 T;  1A7W A;  3AZK B;  3X1U B;  3AZL A;  4WV4 B;  2F8N K;  3AZM D;  3MGR B;  3W98 B;  2FJ7 D;  2HUE C;  1TZY A;  4EO5 B;  1BH9 A;  2ARO D;  1EQZ B;  3AZL B;  1U35 A;  5JRG D;  4KGC D;  4WU8 C;  1P3I A;  3REH D;  5BT1 D;  3AV2 B;  3UTA C;  3LJA A;  5BS7 C;  3WTP E;  5B2J C;  1M1A A;  4LD9 D;  3W99 D;  5AV9 D;  4KUD C;  1U35 B;  1P3G A;  3X1S A;  1JFI A;  3AZN C;  3LJA B;  1KX5 C;  1P34 C;  1M1A B;  2F8N H;  5CPK C;  3REL C;  2JSS A;  4HGA B;  3B6F C;  1M19 D;  5B1L C;  5AV5 C;  3AZF A;  5AV8 C;  1P3G B;  1P3A D;  5DNM C;  1HQ3 B;  3AZJ D;  1JFI B;  5CP6 D;  1P3M B;  1S32 A;  4ZUX A;  3AZE C;  3AZI D;  3LZ0 D;  1P3P D;  3AZF B;  4J8W B;  5GXQ D;  3KUY D;  3WAA D;  3REJ A;  3UTB C;  5E5A C;  3MGP D;  5B33 C;  1S32 B;  3MGS C;  2HIO C;  4ZUX B;  3AN2 D;  3W97 B;  4XZQ D;  4X23 C;  3AZM A;  3KWQ D;  2FJ7 A;  5GT0 C;  4KUD A;  2ARO A;  4KGC A;  5JRG A;  3REH A;  3AZM B;  2FJ7 B;  4WZS B;  3C1C D;  5B1M D;  4E44 A;  3UT9 D;  4LD9 A;  2ARO B;  4KGC B;  5JRG B;  1AOI C;  3REH B;  3REI A;  3X1V D;  4XUJ C;  4J8V D;  4LD9 B;  5F99 C;  1M19 A;  5AV9 B;  4YS3 C;  1P3A A;  3X1T C;  5B33 A;  5AVB D;  4Z66 D;  3AZJ A;  3MVD C;  1BH8 A;  3MNN C;  5CP6 A;  3B6G A;  5B32 D;  3R45 A;  3AZI A;  1M18 C;  3LZ0 A;  4QLC D;  1KU5 A;  1M19 B;  1P3A B;  5GXQ A;  3KUY A;  3AZK C;  3AZJ B;  3X1U C;  3WAA A;  1BH8 B;  2CV5 D;  3B0D B;  5CP6 B;  3MGP A;  3R45 B;  3AZI B;  3LZ0 B;  3MGR C;  3AN2 A;  4XZQ A;  1P3P B;  3W98 C;  5B31 D;  5GXQ B;  3VH6 A;  3KUY B;  3KWQ A;  3WAA B;  3MGP B;  3AZL C;  3AN2 B;  4XZQ B;  5B0Z D;  4H9P A;  1TZY C;  3KWQ B;  1ZLA D;  3C1C A;  1U35 C;  1H3O A;  1ID3 D;  5B1M A;  1P3I C;  3UT9 A;  4JJN A;  1P3B D;  3LJA C;  4H9P B;  2LY8 A;  1M1A C;  1WWS A;  1P3K D;  3C1C B;  1P3G C;  4J8V A;  5B1M B;  3MGQ D;  3UT9 B;  3AZK A;  3X1S C;  2PYO D;  2YFV B;  5AVB A;  4Z66 A;  5DNN D;  3LEL D;  3AZF C;  3X1V B;  4KHA A;  4J8V B;  4QLC A;  1EQZ A;  3A6N D;  5KDM A;  1S32 C;  2BYM A;  4Z66 B;  5B40 D;  5AVB B;  4ZUX C;  5CPJ D;  4Z2M H;  3TU4 D;  4R8P D;  1HTA A;  2CV5 A;  3W97 C;  3AV2 A;  5G49 A;  4KHA B;  5B32 B;  3NQU A;  3KXB D;  4QLC B;  3REJ C;  4NFT A;  5KDM B;  2BYM B;  5BO0 A;  5B2I D;  3KSY A;  2CV5 B;  5G49 B;  3NQU B;  3AZM C;  5GSU D;  5B0Z A;  2FJ7 C;  5B31 B;  4G91 B;  1F66 D;  5BO0 B;  4YM6 D;  5AY8 D;  1ZLA A;  1HQ3 A;  2ARO C;  4CSR A;  5AVC D;  4KGC C;  5JRG C;  4H9R A;  4H9Q A;  1P3M A;  1ID3 A;  3REH C;  5BT1 C;  1P3B A;  1P3O D;  5B0Z B;  4E45 A;  4WU9 D;  4J8W A;  4LD9 C;  1ZLA B;  1P3K A;  4CSR B;  4H9R B;  4H9Q B;  1ID3 B;  5AV6 D;  1P3B B;  4AWL B;  3W97 A;  3REI C;  5AV5 D;  3O62 D;  4NE5 A;  5DNM D;  5DNN A;  1P3K B;  3LEL A;  1M19 C;  1P3A C;  3MGQ B;  3AZJ C;  3AZE D;  5BNX B;  5CP6 C;  2PYO B;  3B6G C;  3A6N A;  5B40 A;  3VH5 W;  3AZI C;  3TU4 A;  5DNN B;  4R8P A;  3VH5 T;  3LZ0 C;  3LEL B;  1P3L D;  5GXQ C;  3KXB A;  3KUY C;  4H9O A;  3WAA C;  3W96 D;  4H9S A;  3A6N B;  3MGP C;  5B40 B;  2RVQ D;  5GT3 D;  5B2I A;  3TU4 B;  4R8P B;  5CPJ B;  3AN2 C;  4XZQ C;  3AFA D;  2F8N D;  4Z2M G;  3REK D;  3KXB B;  4Z5T D;  1P3F D;  5GSU A;  3KWQ C;  4J8X D;  4H9O B;  3W99 A;  5AV9 A;  3WA9 D;  1F66 A;  5B2I B;  4YM6 A;  5AY8 A;  5AVC A;  3LZ1 D;  1B67 A;  1P3O A;  5GSU B;  5C3I B;  3W99 B;  3C1C C;  4WU9 A;  1AOI D;  5B1M C;  1F66 B;  2NQB D;  4YM6 B;  5AY8 B;  4JJN C;  3UT9 C;  5AVC B;  5AV6 A;  3AZH D;  1P3O B;  3AV1 D;  1KX4 D;  5F99 D;  4J8U D;  1P3P A;  2NZD D;  4WU9 B;  3O62 A;  4J8V C;  5AV6 B;  5AVB C;  4Z66 C;  3WKJ D;  5AV5 B;  3O62 B;  2CWE A;  5DNM B;  5FUG B;  4QLC C;  1P3L A;  4EO5 C;  1EQZ C;  5B0Y D;  2CV5 C;  3AV2 C;  3W96 A;  4DRA A;  5GT3 A;  3AFA A;  1P3L B;  1KX3 D;  2F8N A;  4G91 C;  3REK A;  4Z5T A;  1P3F A;  4J8X A;  3W96 B;  2YFW A;  3AYW D;  3WA9 A;  2YFV A;  5GT3 B;  4ZBJ B;  1TZY D;  3AZG D;  5B0Z C;  3AFA B;  4HGA C;  3LZ1 A;  2F8N B;  3REK B;  3X1V A;  4Z5T B;  1P3I D;  4J8X B;  1P3F B;  5B24 D;  1ZLA C;  1HQ3 C;  5CHL B;  2YFW B;  5BNV A;  1P3M C;  1ID3 C;  3WA9 B;  2NQB A;  1P3B C;  3LZ1 B;  3V9R A;  3C1B D;  5B32 G;  4J8W C;  3WTP D;  5B32 A;  3AZH A;  3AV1 A;  1F1E A;  1KX4 A;  1P3K C;  3X1S D;  4J8U A;  2NZD A;  5CPI D;  5BNV B;  1AOI B;  2NQB B;  3V9R B;  3NQJ A;  3AZH B;  3WKJ A;  5DNN C;  3AV1 B;  1KX4 B;  5F99 B;  3LEL C;  4NE3 A;  4J8U B;  1R4V A;  5B31 G;  2IO5 B;  2NZD B;  5B31 A;  1TAF A;  1N1J A;  3A6N C;  3NQJ B;  5B40 C;  5B0Y A;  3WKJ B;  3TU4 C;  4R8P C;  3REJ D;  3KXB C;  4WU8 D;  1TAF B;  1KX3 A;  1N1J B;  4H9S C;  3UTA D;  5B0Y B;  5B2I C;  5B2J D;  1BFM A;  3AYW A;  4KUD D;  3AZG A;  5GSU C;  5C3I C;  1KX3 B;  3W99 C;  5AV9 C;  4WNN A;  3AZN D;  1KX5 D;  1ULY A;  1P34 D;  1F66 C;  4YM6 C;  5B24 A;  5AY8 C;  3MGQ A;  3B0C W;  3REL D;  5BNX A;  5AVC C;  5CPK D;  3B6F D;  3B0C T;  2PYO A;  5B1L D;  3AYW B;  5AV8 D;  1TZY B;  3AZG B;  1P3O C;  3C1B A;  1BH9 B;  4WNN B;  4WU9 C;  3WTP A;  1P3I B;  5B24 B;  5CPI A;  3B0D C;  4M6B A;  3REI D;  5AV6 C;  5CPJ A;  3C1B B;  1P3P C;  3UTB D;  3WTP B;  5E5A D;  3O62 C;  5B33 D;  4G92 B;  3MGS D;  2HIO D;  3X1S B;  5CPI B;  1WWI A;  3B6G D;  4X23 D;  5GT0 D;  1P3L C;  4WU8 A;  3W96 C;  3UTA A;  2RVQ C;  5BS7 A;  5GT3 C;  5B2J A;  2HUE B;  4ZBJ C;  3AFA C;  3REJ B;  3REK C;  4Z5T C;  1P3F C;  4WU8 B;  4J8X C;  3AZN A;  3UTA B;  1KX5 A;  3WA9 C;  1P34 A;  4XUJ D;  5B2J B;  5CPK A;  3REL A;  3LZ1 C;  3B6F A;  5B1L A;  4KUD B;  5AV5 A;  3X1V C;  5AV8 A;  4YS3 D;  3X1T D;  5DNM A;  4JJN D; 
#chains in the Genus database with same CATH topology
 5FUG A;  3MVD D;  3AZN B;  3MNN D;  1KX5 B;  1P34 B;  2NQB C;  2L5A A;  3AZE A;  5CPK B;  3REL B;  1M18 D;  3B6F B;  5B1L B;  5JA4 A;  5AV8 B;  3AZH C;  5B32 C;  3AV1 C;  1KX4 C;  3AZK D;  4J8U C;  2NZD C;  3X1U D;  2IO5 C;  3UTB A;  2ZY4 A;  5E5A A;  3MGS A;  2HIO A;  3AZE B;  3MGR D;  3REI B;  3W98 D;  5JA4 B;  3WKJ C;  4X23 A;  4H9N A;  2F8N G;  1EQZ D;  3UTB B;  5B31 C;  5E5A B;  5GT0 A;  3AZL D;  5B33 B;  3MGS B;  2HIO B;  3AV2 D;  3B6G B;  5B0Y C;  4NE6 A;  3B0B A;  4X23 B;  4H9N B;  5GT0 B;  1U35 D;  4DRB A;  1KX3 C;  2DF4 C;  3LJA D;  1AOI A;  1B6W A;  1M1A D;  4CAY A;  4AWL C;  4UUZ A;  3AYW C;  4XUJ A;  3EPH A;  3AZG C;  1P3G D;  1HQ3 D;  5F99 A;  1P3M D;  4YS3 A;  5B24 C;  3X1T A;  4CAY B;  3MGQ C;  3MVD A;  4UUZ B;  3MNN A;  2PYO C;  3AZF D;  4J8W D;  4XUJ B;  1Q9C A;  2BYK A;  1M18 A;  3C1B C;  3IP4 C;  1H3O B;  3WTP C;  4YS3 B;  1S32 D;  4G92 C;  3X1T B;  4JJN B;  4ZUX D;  3MVD B;  5CPI C;  3X1U A;  3MNN B;  3W97 D;  5CPJ C;  2BYK B;  1M18 B;  3MGR A;  3W98 A;  3VH5 A;  3VH6 W;  3VH6 T;  1A7W A;  3AZK B;  3X1U B;  3AZL A;  4WV4 B;  2F8N K;  3AZM D;  3MGR B;  3W98 B;  3KFU G;  2FJ7 D;  2HUE C;  1TZY A;  4EO5 B;  1BH9 A;  2ARO D;  1EQZ B;  3AZL B;  1U35 A;  5JRG D;  4KGC D;  4WU8 C;  1P3I A;  3REH D;  5BT1 D;  3AV2 B;  3UTA C;  3LJA A;  5BS7 C;  3WTP E;  5B2J C;  1M1A A;  4LD9 D;  3W99 D;  5AV9 D;  4KUD C;  1U35 B;  1P3G A;  3X1S A;  1JFI A;  3AZN C;  3LJA B;  1KX5 C;  1P34 C;  1M1A B;  2F8N H;  5CPK C;  3REL C;  2JSS A;  4HGA B;  3B6F C;  1M19 D;  5B1L C;  5AV5 C;  3AZF A;  5AV8 C;  1P3G B;  1P3A D;  5DNM C;  1HQ3 B;  3AZJ D;  3EG5 B;  1JFI B;  5CP6 D;  1P3M B;  2ZY3 A;  1S32 A;  4ZUX A;  3AZE C;  3AZI D;  3LZ0 D;  3EPK A;  1P3P D;  3AZF B;  4J8W B;  5GXQ D;  3KUY D;  3WAA D;  3REJ A;  3UTB C;  5E5A C;  3MGP D;  5B33 C;  1S32 B;  3MGS C;  2HIO C;  4ZUX B;  3AN2 D;  3W97 B;  4XZQ D;  4X23 C;  3AZM A;  3KWQ D;  2FJ7 A;  5GT0 C;  4KUD A;  2ARO A;  4KGC A;  5JRG A;  4UPK A;  3REH A;  3AZM B;  2FJ7 B;  4WZS B;  3C1C D;  3F6T A;  5B1M D;  4E44 A;  3UT9 D;  4LD9 A;  2ARO B;  3FDD A;  4KGC B;  2Y2L A;  5JRG B;  1AOI C;  3REH B;  3REI A;  3X1V D;  4XUJ C;  4J8V D;  2JE5 A;  4LD9 B;  5F99 C;  1M19 A;  5AV9 B;  4YS3 C;  1P3A A;  3X1T C;  5B33 A;  5AVB D;  4Z66 D;  3AZJ A;  3MVD C;  2ZY2 A;  3H0M C;  1BH8 A;  3MNN C;  5CP6 A;  3B6G A;  5B32 D;  3R45 A;  3AZI A;  1M18 C;  3LZ0 A;  4QLC D;  1KU5 A;  1M19 B;  1P3A B;  5GXQ A;  3KUY A;  3AZK C;  3AZJ B;  3X1U C;  3WAA A;  1BH8 B;  2CV5 D;  3B0D B;  5CP6 B;  3MGP A;  1W2E A;  1Z2C B;  3R45 B;  3AZI B;  3LZ0 B;  3MGR C;  3AN2 A;  4XZQ A;  1P3P B;  3W98 C;  5B31 D;  5GXQ B;  3VH6 A;  3KUY B;  3KWQ A;  3WAA B;  3MGP B;  3AZL C;  3AN2 B;  4XZQ B;  5B0Z D;  4H9P A;  1TZY C;  3KWQ B;  4DQY B;  1ZLA D;  3C1C A;  1U35 C;  1H3O A;  1ID3 D;  5B1M A;  1P3I C;  3UT9 A;  4JJN A;  1P3B D;  2Y2I A;  3LJA C;  2LY8 A;  4H9P B;  1M1A C;  1T3U A;  1WWS A;  1P3K D;  3C1C B;  2Y2P A;  4J8V A;  5B1M B;  1P3G C;  3MGQ D;  3UT9 B;  3AZK A;  3X1S C;  2PYO D;  2YFV B;  5AVB A;  4Z66 A;  5DNN D;  3LEL D;  3AZF C;  3X1V B;  4KHA A;  4J8V B;  4QLC A;  1EQZ A;  3A6N D;  5KDM A;  1S32 C;  2BYM A;  4Z66 B;  5B40 D;  5AVB B;  4ZUX C;  5CPJ D;  4Z2M H;  3TU4 D;  4R8P D;  1HTA A;  2CV5 A;  3W97 C;  3AV2 A;  5G49 A;  4KHA B;  5B32 B;  3NQU A;  3KXB D;  2ZY5 A;  4QLC B;  3REJ C;  4NFT A;  2XD5 A;  5KDM B;  2BYM B;  5BO0 A;  5B2I D;  3KSY A;  2CV5 B;  5G49 B;  3NQU B;  3AZM C;  5GSU D;  5B0Z A;  2FJ7 C;  5B31 B;  4G91 B;  1F66 D;  5BO0 B;  4YM6 D;  5AY8 D;  1ZLA A;  1HQ3 A;  2ARO C;  4CSR A;  5AVC D;  4KGC C;  5JRG C;  4H9R A;  4H9Q A;  1P3M A;  1ID3 A;  3REH C;  5BT1 C;  1P3B A;  1P3O D;  5B0Z B;  4E45 A;  4WU9 D;  4J8W A;  2DQN C;  2G5H C;  2Y2J A;  1ZLA B;  1P3K A;  4LD9 C;  4CSR B;  4H9R B;  4H9Q B;  1ID3 B;  5AV6 D;  1P3B B;  2F2A C;  4AWL B;  3W97 A;  3REI C;  5AV5 D;  3O62 D;  4NE5 A;  5DNM D;  5DNN A;  1P3K B;  3LEL A;  1M19 C;  2BG1 A;  1P3A C;  3MGQ B;  3AZJ C;  3AZE D;  5BNX B;  5CP6 C;  2PYO B;  3B6G C;  3A6N A;  2Y2H A;  5B40 A;  3EPL A;  3VH5 W;  3AZI C;  3TU4 A;  5DNN B;  4R8P A;  3VH5 T;  3LZ0 C;  3LEL B;  1P3L D;  5GXQ C;  3KXB A;  3KUY C;  4H9O A;  3WAA C;  3W96 D;  4H9S A;  3A6N B;  3MGP C;  5B40 B;  2RVQ D;  3A1K A;  5GT3 D;  5B2I A;  3TU4 B;  4R8P B;  5CPJ B;  3AN2 C;  4XZQ C;  3AFA D;  2F8N D;  4Z2M G;  3REK D;  3KXB B;  4Z5T D;  1P3F D;  5GSU A;  3KWQ C;  4J8X D;  4H9O B;  3W99 A;  5AV9 A;  3P5J B;  3WA9 D;  1F66 A;  5B2I B;  4YM6 A;  5AY8 A;  2JCH A;  5AVC A;  3LZ1 D;  1B67 A;  2Y2N A;  1P3O A;  5GSU B;  5C3I B;  3W99 B;  3C1C C;  4WU9 A;  1AOI D;  5B1M C;  1F66 B;  2NQB D;  4YM6 B;  5AY8 B;  4JJN C;  3UT9 C;  5AVC B;  5AV6 A;  3AZH D;  1P3O B;  3AV1 D;  1KX4 D;  5F99 D;  4J8U D;  1P3P A;  2NZD D;  2XD1 A;  4WU9 B;  3O62 A;  4J8V C;  5AV6 B;  5AVB C;  4Z66 C;  3WKJ D;  5AV5 B;  3O62 B;  2CWE A;  5DNM B;  5FUG B;  4QLC C;  1P3L A;  4EO5 C;  1EQZ C;  2UWX A;  5B0Y D;  2CV5 C;  3AV2 C;  3W96 A;  2Y2O A;  4DRA A;  5GT3 A;  3AFA A;  1P3L B;  1KX3 D;  2F8N A;  4G91 C;  3REK A;  4Z5T A;  1P3F A;  4J8X A;  3AL0 C;  3W96 B;  2YFW A;  3AYW D;  3WA9 A;  2YFV A;  5GT3 B;  4ZBJ B;  1TZY D;  3AZG D;  5B0Z C;  3AFA B;  4HGA C;  3LZ1 A;  2F8N B;  3REK B;  3X1V A;  4Z5T B;  1P3I D;  4J8X B;  1P3F B;  5B24 D;  1ZLA C;  1HQ3 C;  5CHL B;  2VQR A;  2YFW B;  5BNV A;  1P3M C;  1ID3 C;  3WA9 B;  2NQB A;  1P3B C;  1PZR A;  3LZ1 B;  3V9R A;  3A1I A;  3C1B D;  5B32 G;  4J8W C;  3WTP D;  5B32 A;  3AZH A;  3AV1 A;  1F1E A;  1KX4 A;  1P3K C;  3X1S D;  4J8U A;  2NZD A;  2W8S A;  5CPI D;  5BNV B;  1AOI B;  2NQB B;  3V9R B;  3NQJ A;  3H0L C;  3AZH B;  3WKJ A;  5DNN C;  3AV1 B;  1KX4 B;  5F99 B;  3LEL C;  4NE3 A;  4J8U B;  1R4V A;  2Y2M A;  2IO5 B;  5B31 G;  2NZD B;  5B31 A;  1TAF A;  1N1J A;  3A6N C;  3NQJ B;  5B40 C;  5B0Y A;  3WKJ B;  3TU4 C;  4R8P C;  3REJ D;  3KXB C;  4WJ3 C;  4WU8 D;  1TAF B;  1KX3 A;  1N1J B;  4H9S C;  3UTA D;  5B0Y B;  2RIQ A;  5B2I C;  5B2J D;  1BFM A;  3AYW A;  4KUD D;  3AZG A;  5GSU C;  5C3I C;  1KX3 B;  3W99 C;  5AV9 C;  4WNN A;  3AZN D;  1KX5 D;  1ULY A;  1P34 D;  1F66 C;  4YM6 C;  5B24 A;  5AY8 C;  3MGQ A;  3B0C W;  3REL D;  5BNX A;  5AVC C;  5CPK D;  3B6F D;  3B0C T;  3EPJ A;  2PYO A;  5B1L D;  3AYW B;  5AV8 D;  2J8P A;  1TZY B;  3AZG B;  1P3O C;  3C1B A;  1BH9 B;  4WNN B;  4WU9 C;  3WTP A;  1P3I B;  5B24 B;  2Y2G A;  5CPI A;  3B0D C;  4M6B A;  3REI D;  5AV6 C;  5CPJ A;  3C1B B;  1P3P C;  3UTB D;  3WTP B;  5E5A D;  3O62 C;  5B33 D;  4G92 B;  3MGS D;  2HIO D;  3X1S B;  5CPI B;  1WWI A;  3B6G D;  2Y2K A;  4X23 D;  5GT0 D;  1P3L C;  2G5I C;  4WU8 A;  3W96 C;  3UTA A;  2RVQ C;  5BS7 A;  5GT3 C;  5B2J A;  2HUE B;  4ZBJ C;  2Y2Q A;  3AFA C;  3H0R C;  3REJ B;  3REK C;  2FFF B;  4Z5T C;  1P3F C;  4WU8 B;  4J8X C;  3AZN A;  3UTA B;  1KX5 A;  3WA9 C;  1P34 A;  4XUJ D;  5B2J B;  5CPK A;  3REL A;  3LZ1 C;  3B6F A;  5B1L A;  4KUD B;  5AV5 A;  3X1V C;  5AV8 A;  2ZM5 A;  4YS3 D;  3X1T D;  5DNM A;  4JJN D; 
#chains in the Genus database with same CATH homology
 5FUG A;  3MVD D;  3AZN B;  3MNN D;  1KX5 B;  1P34 B;  2NQB C;  2L5A A;  3AZE A;  5CPK B;  3REL B;  1M18 D;  3B6F B;  5B1L B;  5JA4 A;  5AV8 B;  3AZH C;  5B32 C;  3AV1 C;  1KX4 C;  3AZK D;  4J8U C;  2NZD C;  3X1U D;  2IO5 C;  3UTB A;  2ZY4 A;  5E5A A;  3MGS A;  2HIO A;  3AZE B;  3MGR D;  3REI B;  3W98 D;  5JA4 B;  3WKJ C;  4X23 A;  4H9N A;  2F8N G;  1EQZ D;  3UTB B;  5B31 C;  5E5A B;  5GT0 A;  3AZL D;  5B33 B;  3MGS B;  2HIO B;  3AV2 D;  3B6G B;  5B0Y C;  4NE6 A;  3B0B A;  4X23 B;  4H9N B;  5GT0 B;  1U35 D;  4DRB A;  1KX3 C;  2DF4 C;  3LJA D;  1AOI A;  1B6W A;  1M1A D;  4CAY A;  4AWL C;  4UUZ A;  3AYW C;  4XUJ A;  3EPH A;  3AZG C;  1P3G D;  1HQ3 D;  5F99 A;  1P3M D;  4YS3 A;  5B24 C;  3X1T A;  4CAY B;  3MGQ C;  3MVD A;  4UUZ B;  3MNN A;  2PYO C;  3AZF D;  4J8W D;  4XUJ B;  1Q9C A;  2BYK A;  1M18 A;  3C1B C;  3IP4 C;  1H3O B;  3WTP C;  4YS3 B;  1S32 D;  4G92 C;  3X1T B;  4JJN B;  4ZUX D;  3MVD B;  5CPI C;  3X1U A;  3MNN B;  3W97 D;  5CPJ C;  2BYK B;  1M18 B;  3MGR A;  3W98 A;  3VH5 A;  3VH6 W;  3VH6 T;  1A7W A;  3AZK B;  3X1U B;  3AZL A;  4WV4 B;  2F8N K;  3AZM D;  3MGR B;  3W98 B;  3KFU G;  2FJ7 D;  2HUE C;  1TZY A;  4EO5 B;  1BH9 A;  2ARO D;  1EQZ B;  3AZL B;  1U35 A;  5JRG D;  4KGC D;  4WU8 C;  1P3I A;  3REH D;  5BT1 D;  3AV2 B;  3UTA C;  3LJA A;  5BS7 C;  3WTP E;  5B2J C;  1M1A A;  4LD9 D;  3W99 D;  5AV9 D;  4KUD C;  1U35 B;  1P3G A;  3X1S A;  1JFI A;  3AZN C;  3LJA B;  1KX5 C;  1P34 C;  1M1A B;  2F8N H;  5CPK C;  3REL C;  2JSS A;  4HGA B;  3B6F C;  1M19 D;  5B1L C;  5AV5 C;  3AZF A;  5AV8 C;  1P3G B;  1P3A D;  5DNM C;  1HQ3 B;  3AZJ D;  3EG5 B;  1JFI B;  5CP6 D;  1P3M B;  2ZY3 A;  1S32 A;  4ZUX A;  3AZE C;  3AZI D;  3LZ0 D;  3EPK A;  1P3P D;  3AZF B;  4J8W B;  5GXQ D;  3KUY D;  3WAA D;  3REJ A;  3UTB C;  5E5A C;  3MGP D;  5B33 C;  1S32 B;  3MGS C;  2HIO C;  4ZUX B;  3AN2 D;  3W97 B;  4XZQ D;  4X23 C;  3AZM A;  3KWQ D;  2FJ7 A;  5GT0 C;  4KUD A;  2ARO A;  4KGC A;  5JRG A;  4UPK A;  3REH A;  3AZM B;  2FJ7 B;  4WZS B;  3C1C D;  3F6T A;  5B1M D;  4E44 A;  3UT9 D;  4LD9 A;  2ARO B;  3FDD A;  4KGC B;  2Y2L A;  5JRG B;  1AOI C;  3REH B;  3REI A;  3X1V D;  4XUJ C;  4J8V D;  2JE5 A;  4LD9 B;  5F99 C;  1M19 A;  5AV9 B;  4YS3 C;  1P3A A;  3X1T C;  5B33 A;  5AVB D;  4Z66 D;  3AZJ A;  3MVD C;  2ZY2 A;  3H0M C;  1BH8 A;  3MNN C;  5CP6 A;  3B6G A;  5B32 D;  3R45 A;  3AZI A;  1M18 C;  3LZ0 A;  4QLC D;  1KU5 A;  1M19 B;  1P3A B;  5GXQ A;  3KUY A;  3AZK C;  3AZJ B;  3X1U C;  3WAA A;  1BH8 B;  2CV5 D;  3B0D B;  5CP6 B;  3MGP A;  1W2E A;  1Z2C B;  3R45 B;  3AZI B;  3LZ0 B;  3MGR C;  3AN2 A;  4XZQ A;  1P3P B;  3W98 C;  5B31 D;  5GXQ B;  3VH6 A;  3KUY B;  3KWQ A;  3WAA B;  3MGP B;  3AZL C;  3AN2 B;  4XZQ B;  5B0Z D;  4H9P A;  1TZY C;  3KWQ B;  4DQY B;  1ZLA D;  3C1C A;  1U35 C;  1H3O A;  1ID3 D;  5B1M A;  1P3I C;  3UT9 A;  4JJN A;  1P3B D;  2Y2I A;  3LJA C;  2LY8 A;  4H9P B;  1M1A C;  1T3U A;  1WWS A;  1P3K D;  3C1C B;  2Y2P A;  4J8V A;  5B1M B;  1P3G C;  3MGQ D;  3UT9 B;  3AZK A;  3X1S C;  2PYO D;  2YFV B;  5AVB A;  4Z66 A;  5DNN D;  3LEL D;  3AZF C;  3X1V B;  4KHA A;  4J8V B;  4QLC A;  1EQZ A;  3A6N D;  5KDM A;  1S32 C;  2BYM A;  4Z66 B;  5B40 D;  5AVB B;  4ZUX C;  5CPJ D;  4Z2M H;  3TU4 D;  4R8P D;  1HTA A;  2CV5 A;  3W97 C;  3AV2 A;  5G49 A;  4KHA B;  5B32 B;  3NQU A;  3KXB D;  2ZY5 A;  4QLC B;  3REJ C;  4NFT A;  2XD5 A;  5KDM B;  2BYM B;  5BO0 A;  5B2I D;  3KSY A;  2CV5 B;  5G49 B;  3NQU B;  3AZM C;  5GSU D;  5B0Z A;  2FJ7 C;  5B31 B;  4G91 B;  1F66 D;  5BO0 B;  4YM6 D;  5AY8 D;  1ZLA A;  1HQ3 A;  2ARO C;  4CSR A;  5AVC D;  4KGC C;  5JRG C;  4H9R A;  4H9Q A;  1P3M A;  1ID3 A;  3REH C;  5BT1 C;  1P3B A;  1P3O D;  5B0Z B;  4E45 A;  4WU9 D;  4J8W A;  2DQN C;  2G5H C;  2Y2J A;  1ZLA B;  1P3K A;  4LD9 C;  4CSR B;  4H9R B;  4H9Q B;  1ID3 B;  5AV6 D;  1P3B B;  2F2A C;  4AWL B;  3W97 A;  3REI C;  5AV5 D;  3O62 D;  4NE5 A;  5DNM D;  5DNN A;  1P3K B;  3LEL A;  1M19 C;  2BG1 A;  1P3A C;  3MGQ B;  3AZJ C;  3AZE D;  5BNX B;  5CP6 C;  2PYO B;  3B6G C;  3A6N A;  2Y2H A;  5B40 A;  3EPL A;  3VH5 W;  3AZI C;  3TU4 A;  5DNN B;  4R8P A;  3VH5 T;  3LZ0 C;  3LEL B;  1P3L D;  5GXQ C;  3KXB A;  3KUY C;  4H9O A;  3WAA C;  3W96 D;  4H9S A;  3A6N B;  3MGP C;  5B40 B;  2RVQ D;  3A1K A;  5GT3 D;  5B2I A;  3TU4 B;  4R8P B;  5CPJ B;  3AN2 C;  4XZQ C;  3AFA D;  2F8N D;  4Z2M G;  3REK D;  3KXB B;  4Z5T D;  1P3F D;  5GSU A;  3KWQ C;  4J8X D;  4H9O B;  3W99 A;  5AV9 A;  3P5J B;  3WA9 D;  1F66 A;  5B2I B;  4YM6 A;  5AY8 A;  2JCH A;  5AVC A;  3LZ1 D;  1B67 A;  2Y2N A;  1P3O A;  5GSU B;  5C3I B;  3W99 B;  3C1C C;  4WU9 A;  1AOI D;  5B1M C;  1F66 B;  2NQB D;  4YM6 B;  5AY8 B;  4JJN C;  3UT9 C;  5AVC B;  5AV6 A;  3AZH D;  1P3O B;  3AV1 D;  1KX4 D;  5F99 D;  4J8U D;  1P3P A;  2NZD D;  2XD1 A;  4WU9 B;  3O62 A;  4J8V C;  5AV6 B;  5AVB C;  4Z66 C;  3WKJ D;  5AV5 B;  3O62 B;  2CWE A;  5DNM B;  5FUG B;  4QLC C;  1P3L A;  4EO5 C;  1EQZ C;  2UWX A;  5B0Y D;  2CV5 C;  3AV2 C;  3W96 A;  2Y2O A;  4DRA A;  5GT3 A;  3AFA A;  1P3L B;  1KX3 D;  2F8N A;  4G91 C;  3REK A;  4Z5T A;  1P3F A;  4J8X A;  3AL0 C;  3W96 B;  2YFW A;  3AYW D;  3WA9 A;  2YFV A;  5GT3 B;  4ZBJ B;  1TZY D;  3AZG D;  5B0Z C;  3AFA B;  4HGA C;  3LZ1 A;  2F8N B;  3REK B;  3X1V A;  4Z5T B;  1P3I D;  4J8X B;  1P3F B;  5B24 D;  1ZLA C;  1HQ3 C;  5CHL B;  2VQR A;  2YFW B;  5BNV A;  1P3M C;  1ID3 C;  3WA9 B;  2NQB A;  1P3B C;  1PZR A;  3LZ1 B;  3V9R A;  3A1I A;  3C1B D;  5B32 G;  4J8W C;  3WTP D;  5B32 A;  3AZH A;  3AV1 A;  1F1E A;  1KX4 A;  1P3K C;  3X1S D;  4J8U A;  2NZD A;  2W8S A;  5CPI D;  5BNV B;  1AOI B;  2NQB B;  3V9R B;  3NQJ A;  3H0L C;  3AZH B;  3WKJ A;  5DNN C;  3AV1 B;  1KX4 B;  5F99 B;  3LEL C;  4NE3 A;  4J8U B;  1R4V A;  2Y2M A;  2IO5 B;  5B31 G;  2NZD B;  5B31 A;  1TAF A;  1N1J A;  3A6N C;  3NQJ B;  5B40 C;  5B0Y A;  3WKJ B;  3TU4 C;  4R8P C;  3REJ D;  3KXB C;  4WJ3 C;  4WU8 D;  1TAF B;  1KX3 A;  1N1J B;  4H9S C;  3UTA D;  5B0Y B;  2RIQ A;  5B2I C;  5B2J D;  1BFM A;  3AYW A;  4KUD D;  3AZG A;  5GSU C;  5C3I C;  1KX3 B;  3W99 C;  5AV9 C;  4WNN A;  3AZN D;  1KX5 D;  1ULY A;  1P34 D;  1F66 C;  4YM6 C;  5B24 A;  5AY8 C;  3MGQ A;  3B0C W;  3REL D;  5BNX A;  5AVC C;  5CPK D;  3B6F D;  3B0C T;  3EPJ A;  2PYO A;  5B1L D;  3AYW B;  5AV8 D;  2J8P A;  1TZY B;  3AZG B;  1P3O C;  3C1B A;  1BH9 B;  4WNN B;  4WU9 C;  3WTP A;  1P3I B;  5B24 B;  2Y2G A;  5CPI A;  3B0D C;  4M6B A;  3REI D;  5AV6 C;  5CPJ A;  3C1B B;  1P3P C;  3UTB D;  3WTP B;  5E5A D;  3O62 C;  5B33 D;  4G92 B;  3MGS D;  2HIO D;  3X1S B;  5CPI B;  1WWI A;  3B6G D;  2Y2K A;  4X23 D;  5GT0 D;  1P3L C;  2G5I C;  4WU8 A;  3W96 C;  3UTA A;  2RVQ C;  5BS7 A;  5GT3 C;  5B2J A;  2HUE B;  4ZBJ C;  2Y2Q A;  3AFA C;  3H0R C;  3REJ B;  3REK C;  2FFF B;  4Z5T C;  1P3F C;  4WU8 B;  4J8X C;  3AZN A;  3UTA B;  1KX5 A;  3WA9 C;  1P34 A;  4XUJ D;  5B2J B;  5CPK A;  3REL A;  3LZ1 C;  3B6F A;  5B1L A;  4KUD B;  5AV5 A;  3X1V C;  5AV8 A;  2ZM5 A;  4YS3 D;  3X1T D;  5DNM A;  4JJN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...