1U35B

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35B00
1TZYC 4JJND 3WA9A 3KXBD 3MGSA 3MGQC 3MGPD 4R8PA 3W99C 1M1AA 2HIOD 2JSSA 5CPJA 3REID 4G91C 3MGRD 4R8PC 4XUJA 3AZJB 1ID3D 4YS3A 2FJ7A 5B33B 4LD9A 5DNMD 1JFIA 4YS3C 5B40A 2FJ7C 1R4VA 3WTPA 5AVCC 1ZLAC 3LJAB 4NE5A 1P3BA 4KHAA 2CV5D 4CSRB 3VH6A 3B0DB 1EQZB 4WU8B 4WU9B 5F99C 5B31A 3AZID 3X1VA 1F66A 5B33D 3X1TA 5CPKB 5B31C 3W97C 3VH5A 4Z66C 3AZLB 3AZED 3LELC 3B0CT 4XZQA 2NQBD 3WTPE 1KX3A 1P3OB 3UTBD 1KU5A 3KUYA 4XZQC 2BYMA 4M6BA 3C1CC 1KX3C 3AN2B 1EQZD 3WAAA 3O62A 1TZYB 4J8VC 5G49B 3X1UD 3AZNA 3MGQB 3WKJC 2NZDC 3WAAC 4NE3A 5CPKD 3O62C 3W99B 3KXBA 3AZNC 4G91B 4H9PB 3AV1A 2AROA 4KUDA 4J8UA 3KXBC 2CWEA 3AZGA 5CP6A 3AV1C 4YS3B 3UT9D 2FJ7B 3REIC 4J8WD 5AVCB 1ZLAB 5GSUD 3KWQB 1U35D 4ZUXD 1ID3C 3V9RA 1B67A 1KX4B 2L5AA 1P3MA 4KGCD 3WA9D 3MGSD 1P3MC 5F99B 4R8PD 1P34A 1M1AD 5CPJD 3REHA 2CV5C 4XUJD 5B31B 3A6NA 3AZIA 3W97B 4YS3D 4HGAC 2FJ7D 4Z66B 4LD9D 3LELB 3AZIC 5B40D 3WTPD 1BH8B 4H9QB 3W96A 3X1SA 4XZQB 1KX3B 3C1CB 1P3BD 4Z2MH 3AZEC 3W96C 3X1SC 4J8VB 3WKJB 2NQBC 2NZDB 2BYMB 4H9NA 3O62B 5B31D 3AYWB 3X1VD 1F66D 3AZNB 3X1TD 4H9RA 5KDMA 3KXBB 3MGPB 3B6GA 3AV1B 1P3FA 5AV9A 3REIB 4XZQD 5B2JA 3MGRB 3B6GC 1KX3D 2YFWB 1P3FC 1ID3B 3KUYD 2F8NK 1P3AA 3WAAD 3TU4A 3O62D 3UT9C 1P3PA 2LY8A 4J8WC 3AZND 1P3AC 1P3MB 5GSUC 5C3IC 1U35C 3TU4C 2BYKB 4KGCC 2CV5B 3AV1D 2AROD 3VH6W 3WA9C 4KUDD 4J8UD 4HGAB 3MGSC 3AZGD 5CP6D 1F1EA 3AZIB 1M1AC 5E5AA 4ZBJB 1P3LD 5CPJC 1TAFB 5B1MA 4XUJC 5BNVB 3VH5W 4EO5C 4UUZA 1P3MD 4LD9C 5B2IA 3AZEB 3MNNA 3X1SB 5B40C 1M19A 2NQBB 3WTPC 1P34D 3UTBB 5JRGA 3REKA 1H3OA 1M19C 5JA4B 3REHD 1P3BC 2F8NA 5JRGC 3A6ND 4WNNA 3X1UB 1S32A 4Z5TA 1BFMA 5DNNA 1S32C 5KDMB 3X1VC 1F66C 3B6GB 3LZ0A 2IO5C 5GXQA 4QLCA 5CHLB 3X1TC 4DRBA 4CAYA 1P3FB 5DNNC 5B0ZA 3W96D 3X1SD 1N1JB 5B0YA 1P3KA 5GXQC 4QLCC 5BS7A 3UT9B 1HQ3A 1KX5A 5B24A 5B0YC 4J8WB 3AZFA 1P3AB 5GSUB 5C3IB 1U35B 3TU4B 4ZUXB 5BS7C 1KX5C 5B31G 3KUYC 4KGCB 4H9SA 3WA9B 4H9OA 5AV6A 3MGSB 5AVBA 3AZHA 3B6GD 4R8PB 4H9SC 1P3FD 1M1AB 5B1LA 3AV2A 5BNXA 5AV9D 5CPJB 3NQJA 5B2JD 4XUJB 5GT3A 2AROC 3R45A 4EO5B 4KUDC 4Z2MG 4J8UC 3B6FA 1P3LA 1P3GA 5AV5A 3AZGC 1P3AD 5CP6C 4LD9B 3TU4D 1JFIB 5B40B 1P3PD 1P3LC 3WTPB 5AV5C 5CPIA 4E45A 4J8XA 1M19B 3LZ1A 4X23A 1P3BB 4KHAB 5JRGB 3W98A 4X23C 5GT0A 3AZKA 1P34C 4YM6A 5E5AD 1S32B 3X1VB 1F66B 1P3ID 3REHC 2IO5B 5B1MD 3X1TB 3A6NC 5AY8A 4DRAA 3REJA 5GXQB 4QLCB 5B2ID 4CAYB 4NFTA 3MNND 5AY8C 1M19D 3REJC 3C1BA 5JRGD 1KX5B 3KUYB 3REKD 1M18A 3C1BC 3WAAB 2F8ND 1S32D 3MVDA 3AZJA 1M18C 4Z5TD 5DNND 3MVDC 3AFAA 3B0CW 3LZ0D 2AROB 5GXQD 4QLCD 4KUDB 4J8UB 3NQUA 5BNXB 5B0ZD 3AFAC 5B0YD 1P3KD 3AZGB 5CP6B 3R45B 3LJAA 5FUGA 1HQ3D 5AV9C 1P3LB 5B24D 1KX5D 3AZFD 5B2JC 4WU8A 4WU9A 3V9RB 5B32A 1P3PC 2HUEC 5AV6D 5BT1D 5B32C 5AVBD 4X23B 3AZHD 1P34B 1Q9CA 5B1LD 3AZLA 3AV2D 3REHB 5GT3D 3A6NB 3AZLC 3B6FD 1P3IA 1P3GD 1P3OA 5AV5D 5E5AC 5AY8B 3AN2A 1P3IC 3REJB 1TZYA 5CPID 5B1MC 4J8XD 3MGQA 3W96B 3KSYA 3LZ1D 3W99A 4X23D 3C1BB 5B2IC 3MNNC 4H9PA 3W98D 1ULYA 1M18B 5GT0D 3AZKD 4H9NB 4YM6D 3REKC 3MVDB 5AVCA 1ZLAA 4H9RB 3AFAB 5AV8A 5AY8D 4Z5TC 3KWQA 4G92C 3REJD 3AZMA 1KX4A 4WZSB 3NQUB 5AV9B 5AV8C 3KWQC 5B2JB 3AZMC 3LZ0C 1KX4C 3C1BD 5FUGB 5BO0A 5B0ZC 1WWSA 5F99A 3RELA 1P3KC 1M18D 2F8NG 1HQ3C 1P3PB 3RELC 5B24C 2HUEB 3AZFC 4E44A 3MVDD 3AZJD 5B32B 3W97A 1AOIA 4Z66A 3AFAD 3LELA 2PYOA 1AOIC 3UTAA 1BH8A 4H9QA 5AV6C 5BT1C 2PYOC 5AVBC 3AZHC 3UTAC 3LJAD 5E5AB 5B1LC 3C1CA 3AV2C 1P3IB 4J8VA 5B1MB 5GT3C 3WKJA 2NZDA 4UUZB 2RVQC 4WU9D 4WU8D 3B6FC 1P3GC 5B32D 3AYWA 5B2IB 3MNNB 5CPIC 4JJNA 3AYWC 4J8XC 3MGPA 3REKB 1H3OB 3LZ1C 3AZLD 4WV4B 2HIOA 4JJNC 2F8NH 3REIA 2F8NB 3VH6T 3MGPC 3MGRA 4AWLC 3W98C 4WNNB 2YFWA 4Z5TB 2HIOC 4G92B 1P3OD 1ID3A 5GT0C 3AZKC 4YM6C 3MGRC 3B0BA 5DNNB 5DNMA 5AV8B 3AN2D 1HTAA 1TZYD 3LZ0B 3AZMB 2YFVA 1BH9A 3VH5T 3MGQD 5B0ZB 5DNMC 5B0YB 1P3KB 3W99D 2BYKA 4NE6A 5BO0B 1HQ3B 2CV5A 3RELB 5B24B 3AZFB 1A7WA 1AOIB 1TAFA 5B33A 5AVCD 4H9OB 1ZLAD 5BNVA 5AV6B 3AZJC 5AV8D 3KWQD 5AVBB 4ZBJC 3AZHB 2PYOB 3AZMD 1KX4D 3UTAB 5B33C 5B1LB 3AV2B 3AZEA 3NQJB 5GT3B 2NQBA 3B6FB 5F99D 3RELD 1P3GB 1B6WA 3UTBA 5AV5B 5JA4A 4CSRA 3LJAC 1EQZA 3UTBC 5CPIB 3X1UA 1AOID 3W97D 4J8XB 3B0DC 4Z66D 4WU8C 3LZ1B 4WU9C 5CPKA 1EQZC 3LELD 4JJNB 2PYOD 3X1UC 3UTAD 3W98B 4AWLB 1WWIA 5CPKC 2HIOB 5GT0B 1N1JA 3AZKB 4YM6B 3C1CD 2RVQD 3UT9A 4J8VD 4J8WA 3WKJD 2NZDD 5DNMB 5GSUA 1U35A 4ZUXA 1P3OC 3AYWD 5B32G 2YFVB 5G49A 1BH9B 4KGCA 3AN2C 4ZUXC
chains in the Genus database with same CATH superfamily
1TZYC 4JJND 3WA9A 3KXBD 3MGSA 3MGQC 3MGPD 4R8PA 3W99C 1M1AA 2HIOD 2JSSA 5CPJA 3REID 4G91C 3MGRD 4R8PC 4XUJA 3AZJB 1ID3D 3KFUG 4YS3A 2FJ7A 3EPHA 5B33B 4LD9A 5DNMD 2ZM5A 1JFIA 4YS3C 5B40A 2FJ7C 1R4VA 3WTPA 5AVCC 1ZLAC 1PZRA 3LJAB 1W2EA 4NE5A 1P3BA 4KHAA 2CV5D 4CSRB 3VH6A 3B0DB 1EQZB 4WU8B 4WU9B 5F99C 5B31A 3AZID 1Z2CB 3X1VA 1F66A 5B33D 3X1TA 5CPKB 2ZY2A 5B31C 3W97C 3VH5A 4Z66C 3AZLB 3AZED 3LELC 2ZY5A 3B0CT 4XZQA 2NQBD 3WTPE 1KX3A 1P3OB 3UTBD 1KU5A 3KUYA 4XZQC 2BYMA 4M6BA 3C1CC 1KX3C 3AN2B 4UPKA 1EQZD 3WAAA 3O62A 1TZYB 4J8VC 5G49B 3X1UD 3AZNA 3MGQB 3WKJC 2NZDC 3WAAC 4NE3A 4WJ3C 5CPKD 3O62C 3W99B 3KXBA 3AZNC 4G91B 4H9PB 3AV1A 2AROA 4KUDA 4J8UA 3KXBC 2CWEA 3AZGA 5CP6A 3AV1C 4YS3B 3UT9D 2FJ7B 3REIC 4J8WD 5AVCB 1ZLAB 5GSUD 3KWQB 1U35D 4ZUXD 1ID3C 3V9RA 1B67A 1KX4B 2L5AA 2Y2IA 1P3MA 4KGCD 3WA9D 3MGSD 1P3MC 5F99B 4R8PD 1P34A 1M1AD 5CPJD 3REHA 2CV5C 4XUJD 5B31B 3A6NA 3AZIA 3W97B 4YS3D 4HGAC 2FJ7D 4Z66B 4LD9D 3LELB 3AZIC 5B40D 3WTPD 1BH8B 4H9QB 3W96A 3X1SA 4XZQB 1KX3B 3C1CB 1P3BD 4Z2MH 3AZEC 3W96C 3X1SC 4J8VB 3WKJB 2NQBC 2NZDB 2BYMB 4H9NA 3O62B 5B31D 3AYWB 3X1VD 1F66D 3AZNB 2G5IC 3X1TD 4H9RA 5KDMA 3KXBB 3MGPB 3B6GA 3AV1B 1P3FA 5AV9A 3REIB 4XZQD 5B2JA 3MGRB 3B6GC 1KX3D 2YFWB 2J8PA 1P3FC 1ID3B 3KUYD 2F8NK 1P3AA 3WAAD 3TU4A 3O62D 3UT9C 1P3PA 2LY8A 4J8WC 3AZND 1P3AC 1P3MB 5GSUC 5C3IC 1U35C 3TU4C 2BYKB 4KGCC 2CV5B 3AV1D 2AROD 3VH6W 3WA9C 4KUDD 4J8UD 4HGAB 3MGSC 3A1IA 3AZGD 5CP6D 1F1EA 3AZIB 1M1AC 5E5AA 4ZBJB 1P3LD 5CPJC 1TAFB 5B1MA 4XUJC 5BNVB 3VH5W 4EO5C 4UUZA 1P3MD 4LD9C 5B2IA 3AZEB 3MNNA 3X1SB 5B40C 1M19A 2NQBB 3WTPC 3EG5B 1P34D 3UTBB 5JRGA 3REKA 1H3OA 1M19C 5JA4B 3REHD 1P3BC 2F8NA 5JRGC 3A6ND 4WNNA 3X1UB 1S32A 4Z5TA 1BFMA 5DNNA 1S32C 5KDMB 3X1VC 1F66C 3B6GB 3LZ0A 2IO5C 5GXQA 4QLCA 5CHLB 3X1TC 4DRBA 4CAYA 1P3FB 5DNNC 5B0ZA 3W96D 3X1SD 1N1JB 3H0RC 5B0YA 1P3KA 5GXQC 4QLCC 3IP4C 5BS7A 3UT9B 1HQ3A 1KX5A 5B24A 5B0YC 4J8WB 3AZFA 1P3AB 5GSUB 2ZY4A 5C3IB 3TU4B 4ZUXB 5BS7C 1U35B 1KX5C 5B31G 3KUYC 4KGCB 4H9SA 3WA9B 4H9OA 5AV6A 3MGSB 5AVBA 3AZHA 3B6GD 4R8PB 4H9SC 1P3FD 1M1AB 5B1LA 3AV2A 5BNXA 5AV9D 2Y2NA 3NQJA 5CPJB 5B2JD 4XUJB 5GT3A 2F2AC 2AROC 3R45A 2XD5A 4EO5B 4KUDC 4Z2MG 4J8UC 3B6FA 1P3LA 1P3GA 5AV5A 3AZGC 1P3AD 5CP6C 4LD9B 3TU4D 1JFIB 5B40B 1P3PD 2JE5A 1P3LC 3WTPB 5AV5C 5CPIA 4E45A 4J8XA 1M19B 3LZ1A 4X23A 1P3BB 4KHAB 5JRGB 3W98A 4X23C 5GT0A 3AZKA 1P34C 4YM6A 5E5AD 1S32B 3X1VB 1F66B 2FFFB 1P3ID 3REHC 2IO5B 5B1MD 3X1TB 3A6NC 5AY8A 4DRAA 3REJA 5GXQB 4QLCB 5B2ID 4CAYB 4NFTA 3MNND 5AY8C 1M19D 3REJC 3C1BA 2Y2PA 2W8SA 5JRGD 1KX5B 3KUYB 3REKD 1M18A 3C1BC 3WAAB 2F8ND 2ZY3A 1S32D 3MVDA 3AZJA 1M18C 4Z5TD 3EPJA 5DNND 3MVDC 3AFAA 3B0CW 3LZ0D 2AROB 5GXQD 4QLCD 4KUDB 4J8UB 3NQUA 5BNXB 5B0ZD 3AFAC 5B0YD 1P3KD 3AZGB 5CP6B 3FDDA 3R45B 3LJAA 5FUGA 3A1KA 1HQ3D 5AV9C 1P3LB 5B24D 1KX5D 3AZFD 5B2JC 3EPKA 4WU8A 4WU9A 3V9RB 5B32A 1P3PC 2HUEC 5AV6D 5BT1D 5B32C 5AVBD 4X23B 3AZHD 2Y2KA 1P34B 2Y2MA 1Q9CA 5B1LD 3AZLA 3AV2D 1T3UA 3REHB 5GT3D 3A6NB 3AZLC 3B6FD 1P3IA 1P3GD 1P3OA 5AV5D 2G5HC 2VQRA 5E5AC 2Y2HA 5AY8B 3AN2A 1P3IC 3REJB 1TZYA 5CPID 5B1MC 4J8XD 3MGQA 3W96B 3KSYA 3LZ1D 3W99A 4X23D 3C1BB 5B2IC 3MNNC 4H9PA 3W98D 1ULYA 1M18B 2Y2OA 5GT0D 2DF4C 3AZKD 4H9NB 4YM6D 3REKC 3MVDB 2BG1A 5AVCA 2Y2LA 1ZLAA 4H9RB 3AFAB 5AV8A 5AY8D 4Z5TC 3KWQA 4G92C 3REJD 3AZMA 3P5JB 1KX4A 4WZSB 3NQUB 5AV9B 5AV8C 3KWQC 5B2JB 3AZMC 3LZ0C 1KX4C 3C1BD 5FUGB 5BO0A 5B0ZC 1WWSA 5F99A 3RELA 1P3KC 1M18D 2F8NG 1HQ3C 1P3PB 3RELC 5B24C 2HUEB 3AZFC 4E44A 3MVDD 3AZJD 5B32B 3W97A 1AOIA 2DQNC 4Z66A 3AFAD 3LELA 2PYOA 1AOIC 3UTAA 2Y2GA 1BH8A 4H9QA 5AV6C 5BT1C 2PYOC 5AVBC 3AZHC 3H0MC 3UTAC 3LJAD 5E5AB 5B1LC 3C1CA 3AV2C 1P3IB 4J8VA 5B1MB 5GT3C 3WKJA 2NZDA 4UUZB 2RVQC 4WU9D 4WU8D 3B6FC 1P3GC 5B32D 3AYWA 5B2IB 3MNNB 5CPIC 4JJNA 3AYWC 4J8XC 3MGPA 3REKB 1H3OB 3LZ1C 3AZLD 4WV4B 2HIOA 4JJNC 2F8NH 3REIA 2F8NB 3VH6T 3MGPC 3MGRA 4AWLC 3W98C 4WNNB 2YFWA 4Z5TB 2HIOC 4G92B 1P3OD 1ID3A 5GT0C 3AZKC 4YM6C 3MGRC 3B0BA 5DNNB 2RIQA 5DNMA 5AV8B 3AN2D 1HTAA 1TZYD 3LZ0B 3AZMB 2YFVA 1BH9A 3VH5T 3MGQD 5B0ZB 5DNMC 5B0YB 1P3KB 3W99D 2BYKA 4NE6A 5BO0B 2Y2QA 1HQ3B 2CV5A 3RELB 5B24B 3AZFB 1A7WA 1AOIB 1TAFA 5B33A 5AVCD 4H9OB 1ZLAD 5BNVA 5AV6B 3AZJC 5AV8D 3KWQD 5AVBB 4ZBJC 3AZHB 2PYOB 3AZMD 1KX4D 3UTAB 5B33C 5B1LB 3AV2B 3AZEA 3NQJB 2UWXA 3F6TA 5GT3B 4DQYB 2NQBA 3B6FB 5F99D 3RELD 1P3GB 1B6WA 3UTBA 5AV5B 5JA4A 3H0LC 4CSRA 3LJAC 1EQZA 3UTBC 5CPIB 2JCHA 3X1UA 1AOID 3W97D 4J8XB 2XD1A 3B0DC 4Z66D 4WU8C 3LZ1B 4WU9C 5CPKA 1EQZC 3LELD 4JJNB 2PYOD 3X1UC 3UTAD 3W98B 4AWLB 1WWIA 5CPKC 2HIOB 5GT0B 1N1JA 3EPLA 3AZKB 4YM6B 3C1CD 2RVQD 3UT9A 4J8VD 4J8WA 3WKJD 2NZDD 3AL0C 5DNMB 5GSUA 1U35A 4ZUXA 1P3OC 3AYWD 5B32G 2YFVB 5G49A 1BH9B 2Y2JA 4KGCA 3AN2C 4ZUXC
chains in the Genus database with same CATH topology
1TZYC 4JJND 3WA9A 3KXBD 3MGSA 3MGQC 3MGPD 4R8PA 3W99C 1M1AA 2HIOD 2JSSA 5CPJA 3REID 4G91C 3MGRD 4R8PC 4XUJA 3AZJB 1ID3D 3KFUG 4YS3A 2FJ7A 3EPHA 5B33B 4LD9A 5DNMD 2ZM5A 1JFIA 4YS3C 5B40A 2FJ7C 1R4VA 3WTPA 5AVCC 1ZLAC 1PZRA 3LJAB 1W2EA 4NE5A 1P3BA 4KHAA 2CV5D 4CSRB 3VH6A 3B0DB 1EQZB 4WU8B 4WU9B 5F99C 5B31A 3AZID 1Z2CB 3X1VA 1F66A 5B33D 3X1TA 5CPKB 2ZY2A 5B31C 3W97C 3VH5A 4Z66C 3AZLB 3AZED 3LELC 2ZY5A 3B0CT 4XZQA 2NQBD 3WTPE 1KX3A 1P3OB 3UTBD 1KU5A 3KUYA 4XZQC 2BYMA 4M6BA 3C1CC 1KX3C 3AN2B 4UPKA 1EQZD 3WAAA 3O62A 1TZYB 4J8VC 5G49B 3X1UD 3AZNA 3MGQB 3WKJC 2NZDC 3WAAC 4NE3A 4WJ3C 5CPKD 3O62C 3W99B 3KXBA 3AZNC 4G91B 4H9PB 3AV1A 2AROA 4KUDA 4J8UA 3KXBC 2CWEA 3AZGA 5CP6A 3AV1C 4YS3B 3UT9D 2FJ7B 3REIC 4J8WD 5AVCB 1ZLAB 5GSUD 3KWQB 1U35D 4ZUXD 1ID3C 3V9RA 1B67A 1KX4B 2L5AA 2Y2IA 1P3MA 4KGCD 3WA9D 3MGSD 1P3MC 5F99B 4R8PD 1P34A 1M1AD 5CPJD 3REHA 2CV5C 4XUJD 5B31B 3A6NA 3AZIA 3W97B 4YS3D 4HGAC 2FJ7D 4Z66B 4LD9D 3LELB 3AZIC 5B40D 3WTPD 1BH8B 4H9QB 3W96A 3X1SA 4XZQB 1KX3B 3C1CB 1P3BD 4Z2MH 3AZEC 3W96C 3X1SC 4J8VB 3WKJB 2NQBC 2NZDB 2BYMB 4H9NA 3O62B 5B31D 3AYWB 3X1VD 1F66D 3AZNB 2G5IC 3X1TD 4H9RA 5KDMA 3KXBB 3MGPB 3B6GA 3AV1B 1P3FA 5AV9A 3REIB 4XZQD 5B2JA 3MGRB 3B6GC 1KX3D 2YFWB 2J8PA 1P3FC 1ID3B 3KUYD 2F8NK 1P3AA 3WAAD 3TU4A 3O62D 3UT9C 1P3PA 2LY8A 4J8WC 3AZND 1P3AC 1P3MB 5GSUC 5C3IC 1U35C 3TU4C 2BYKB 4KGCC 2CV5B 3AV1D 2AROD 3VH6W 3WA9C 4KUDD 4J8UD 4HGAB 3MGSC 3A1IA 3AZGD 5CP6D 1F1EA 3AZIB 1M1AC 5E5AA 4ZBJB 1P3LD 5CPJC 1TAFB 5B1MA 4XUJC 5BNVB 3VH5W 4EO5C 4UUZA 1P3MD 4LD9C 5B2IA 3AZEB 3MNNA 3X1SB 5B40C 1M19A 2NQBB 3WTPC 3EG5B 1P34D 3UTBB 5JRGA 3REKA 1H3OA 1M19C 5JA4B 3REHD 1P3BC 2F8NA 5JRGC 3A6ND 4WNNA 3X1UB 1S32A 4Z5TA 1BFMA 5DNNA 1S32C 5KDMB 3X1VC 1F66C 3B6GB 3LZ0A 2IO5C 5GXQA 4QLCA 5CHLB 3X1TC 4DRBA 4CAYA 1P3FB 5DNNC 5B0ZA 3W96D 3X1SD 1N1JB 3H0RC 5B0YA 1P3KA 5GXQC 4QLCC 3IP4C 5BS7A 3UT9B 1HQ3A 1KX5A 5B24A 5B0YC 4J8WB 3AZFA 1P3AB 5GSUB 2ZY4A 5C3IB 3TU4B 4ZUXB 5BS7C 1U35B 1KX5C 5B31G 3KUYC 4KGCB 4H9SA 3WA9B 4H9OA 5AV6A 3MGSB 5AVBA 3AZHA 3B6GD 4R8PB 4H9SC 1P3FD 1M1AB 5B1LA 3AV2A 5BNXA 5AV9D 2Y2NA 3NQJA 5CPJB 5B2JD 4XUJB 5GT3A 2F2AC 2AROC 3R45A 2XD5A 4EO5B 4KUDC 4Z2MG 4J8UC 3B6FA 1P3LA 1P3GA 5AV5A 3AZGC 1P3AD 5CP6C 4LD9B 3TU4D 1JFIB 5B40B 1P3PD 2JE5A 1P3LC 3WTPB 5AV5C 5CPIA 4E45A 4J8XA 1M19B 3LZ1A 4X23A 1P3BB 4KHAB 5JRGB 3W98A 4X23C 5GT0A 3AZKA 1P34C 4YM6A 5E5AD 1S32B 3X1VB 1F66B 2FFFB 1P3ID 3REHC 2IO5B 5B1MD 3X1TB 3A6NC 5AY8A 4DRAA 3REJA 5GXQB 4QLCB 5B2ID 4CAYB 4NFTA 3MNND 5AY8C 1M19D 3REJC 3C1BA 2Y2PA 2W8SA 5JRGD 1KX5B 3KUYB 3REKD 1M18A 3C1BC 3WAAB 2F8ND 2ZY3A 1S32D 3MVDA 3AZJA 1M18C 4Z5TD 3EPJA 5DNND 3MVDC 3AFAA 3B0CW 3LZ0D 2AROB 5GXQD 4QLCD 4KUDB 4J8UB 3NQUA 5BNXB 5B0ZD 3AFAC 5B0YD 1P3KD 3AZGB 5CP6B 3FDDA 3R45B 3LJAA 5FUGA 3A1KA 1HQ3D 5AV9C 1P3LB 5B24D 1KX5D 3AZFD 5B2JC 3EPKA 4WU8A 4WU9A 3V9RB 5B32A 1P3PC 2HUEC 5AV6D 5BT1D 5B32C 5AVBD 4X23B 3AZHD 2Y2KA 1P34B 2Y2MA 1Q9CA 5B1LD 3AZLA 3AV2D 1T3UA 3REHB 5GT3D 3A6NB 3AZLC 3B6FD 1P3IA 1P3GD 1P3OA 5AV5D 2G5HC 2VQRA 5E5AC 2Y2HA 5AY8B 3AN2A 1P3IC 3REJB 1TZYA 5CPID 5B1MC 4J8XD 3MGQA 3W96B 3KSYA 3LZ1D 3W99A 4X23D 3C1BB 5B2IC 3MNNC 4H9PA 3W98D 1ULYA 1M18B 2Y2OA 5GT0D 2DF4C 3AZKD 4H9NB 4YM6D 3REKC 3MVDB 2BG1A 5AVCA 2Y2LA 1ZLAA 4H9RB 3AFAB 5AV8A 5AY8D 4Z5TC 3KWQA 4G92C 3REJD 3AZMA 3P5JB 1KX4A 4WZSB 3NQUB 5AV9B 5AV8C 3KWQC 5B2JB 3AZMC 3LZ0C 1KX4C 3C1BD 5FUGB 5BO0A 5B0ZC 1WWSA 5F99A 3RELA 1P3KC 1M18D 2F8NG 1HQ3C 1P3PB 3RELC 5B24C 2HUEB 3AZFC 4E44A 3MVDD 3AZJD 5B32B 3W97A 1AOIA 2DQNC 4Z66A 3AFAD 3LELA 2PYOA 1AOIC 3UTAA 2Y2GA 1BH8A 4H9QA 5AV6C 5BT1C 2PYOC 5AVBC 3AZHC 3H0MC 3UTAC 3LJAD 5E5AB 5B1LC 3C1CA 3AV2C 1P3IB 4J8VA 5B1MB 5GT3C 3WKJA 2NZDA 4UUZB 2RVQC 4WU9D 4WU8D 3B6FC 1P3GC 5B32D 3AYWA 5B2IB 3MNNB 5CPIC 4JJNA 3AYWC 4J8XC 3MGPA 3REKB 1H3OB 3LZ1C 3AZLD 4WV4B 2HIOA 4JJNC 2F8NH 3REIA 2F8NB 3VH6T 3MGPC 3MGRA 4AWLC 3W98C 4WNNB 2YFWA 4Z5TB 2HIOC 4G92B 1P3OD 1ID3A 5GT0C 3AZKC 4YM6C 3MGRC 3B0BA 5DNNB 2RIQA 5DNMA 5AV8B 3AN2D 1HTAA 1TZYD 3LZ0B 3AZMB 2YFVA 1BH9A 3VH5T 3MGQD 5B0ZB 5DNMC 5B0YB 1P3KB 3W99D 2BYKA 4NE6A 5BO0B 2Y2QA 1HQ3B 2CV5A 3RELB 5B24B 3AZFB 1A7WA 1AOIB 1TAFA 5B33A 5AVCD 4H9OB 1ZLAD 5BNVA 5AV6B 3AZJC 5AV8D 3KWQD 5AVBB 4ZBJC 3AZHB 2PYOB 3AZMD 1KX4D 3UTAB 5B33C 5B1LB 3AV2B 3AZEA 3NQJB 2UWXA 3F6TA 5GT3B 4DQYB 2NQBA 3B6FB 5F99D 3RELD 1P3GB 1B6WA 3UTBA 5AV5B 5JA4A 3H0LC 4CSRA 3LJAC 1EQZA 3UTBC 5CPIB 2JCHA 3X1UA 1AOID 3W97D 4J8XB 2XD1A 3B0DC 4Z66D 4WU8C 3LZ1B 4WU9C 5CPKA 1EQZC 3LELD 4JJNB 2PYOD 3X1UC 3UTAD 3W98B 4AWLB 1WWIA 5CPKC 2HIOB 5GT0B 1N1JA 3EPLA 3AZKB 4YM6B 3C1CD 2RVQD 3UT9A 4J8VD 4J8WA 3WKJD 2NZDD 3AL0C 5DNMB 5GSUA 1U35A 4ZUXA 1P3OC 3AYWD 5B32G 2YFVB 5G49A 1BH9B 2Y2JA 4KGCA 3AN2C 4ZUXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY C;  4JJN D;  3WA9 A;  3KXB D;  3MGS A;  3MGQ C;  3MGP D;  4R8P A;  3W99 C;  1M1A A;  2HIO D;  2JSS A;  5CPJ A;  3REI D;  4G91 C;  3MGR D;  4R8P C;  4XUJ A;  3AZJ B;  1ID3 D;  4YS3 A;  2FJ7 A;  5B33 B;  4LD9 A;  5DNM D;  1JFI A;  4YS3 C;  5B40 A;  2FJ7 C;  1R4V A;  3WTP A;  5AVC C;  1ZLA C;  3LJA B;  4NE5 A;  1P3B A;  4KHA A;  2CV5 D;  4CSR B;  3VH6 A;  3B0D B;  1EQZ B;  4WU8 B;  4WU9 B;  5F99 C;  5B31 A;  3AZI D;  3X1V A;  1F66 A;  5B33 D;  3X1T A;  5CPK B;  5B31 C;  3W97 C;  3VH5 A;  4Z66 C;  3AZL B;  3AZE D;  3LEL C;  3B0C T;  4XZQ A;  2NQB D;  3WTP E;  1KX3 A;  1P3O B;  3UTB D;  1KU5 A;  3KUY A;  4XZQ C;  2BYM A;  4M6B A;  3C1C C;  1KX3 C;  3AN2 B;  1EQZ D;  3WAA A;  3O62 A;  1TZY B;  4J8V C;  5G49 B;  3X1U D;  3AZN A;  3MGQ B;  3WKJ C;  2NZD C;  3WAA C;  4NE3 A;  5CPK D;  3O62 C;  3W99 B;  3KXB A;  3AZN C;  4G91 B;  4H9P B;  3AV1 A;  2ARO A;  4KUD A;  4J8U A;  3KXB C;  2CWE A;  3AZG A;  5CP6 A;  3AV1 C;  4YS3 B;  3UT9 D;  2FJ7 B;  3REI C;  4J8W D;  5AVC B;  1ZLA B;  5GSU D;  3KWQ B;  1U35 D;  4ZUX D;  1ID3 C;  3V9R A;  1B67 A;  1KX4 B;  2L5A A;  1P3M A;  4KGC D;  3WA9 D;  3MGS D;  1P3M C;  5F99 B;  4R8P D;  1P34 A;  1M1A D;  5CPJ D;  3REH A;  2CV5 C;  4XUJ D;  5B31 B;  3A6N A;  3AZI A;  3W97 B;  4YS3 D;  4HGA C;  2FJ7 D;  4Z66 B;  4LD9 D;  3LEL B;  3AZI C;  5B40 D;  3WTP D;  1BH8 B;  4H9Q B;  3W96 A;  3X1S A;  4XZQ B;  1KX3 B;  3C1C B;  1P3B D;  4Z2M H;  3AZE C;  3W96 C;  3X1S C;  4J8V B;  3WKJ B;  2NQB C;  2NZD B;  2BYM B;  4H9N A;  3O62 B;  5B31 D;  3AYW B;  3X1V D;  1F66 D;  3AZN B;  3X1T D;  4H9R A;  5KDM A;  3KXB B;  3MGP B;  3B6G A;  3AV1 B;  1P3F A;  5AV9 A;  3REI B;  4XZQ D;  5B2J A;  3MGR B;  3B6G C;  1KX3 D;  2YFW B;  1P3F C;  1ID3 B;  3KUY D;  2F8N K;  1P3A A;  3WAA D;  3TU4 A;  3O62 D;  3UT9 C;  1P3P A;  2LY8 A;  4J8W C;  3AZN D;  1P3A C;  1P3M B;  5GSU C;  5C3I C;  1U35 C;  3TU4 C;  2BYK B;  4KGC C;  2CV5 B;  3AV1 D;  2ARO D;  3VH6 W;  3WA9 C;  4KUD D;  4J8U D;  4HGA B;  3MGS C;  3AZG D;  5CP6 D;  1F1E A;  3AZI B;  1M1A C;  5E5A A;  4ZBJ B;  1P3L D;  5CPJ C;  1TAF B;  5B1M A;  4XUJ C;  5BNV B;  3VH5 W;  4EO5 C;  4UUZ A;  1P3M D;  4LD9 C;  5B2I A;  3AZE B;  3MNN A;  3X1S B;  5B40 C;  1M19 A;  2NQB B;  3WTP C;  1P34 D;  3UTB B;  5JRG A;  3REK A;  1H3O A;  1M19 C;  5JA4 B;  3REH D;  1P3B C;  2F8N A;  5JRG C;  3A6N D;  4WNN A;  3X1U B;  1S32 A;  4Z5T A;  1BFM A;  5DNN A;  1S32 C;  5KDM B;  3X1V C;  1F66 C;  3B6G B;  3LZ0 A;  2IO5 C;  5GXQ A;  4QLC A;  5CHL B;  3X1T C;  4DRB A;  4CAY A;  1P3F B;  5DNN C;  5B0Z A;  3W96 D;  3X1S D;  1N1J B;  5B0Y A;  1P3K A;  5GXQ C;  4QLC C;  5BS7 A;  3UT9 B;  1HQ3 A;  1KX5 A;  5B24 A;  5B0Y C;  4J8W B;  3AZF A;  1P3A B;  5GSU B;  5C3I B;  1U35 B;  3TU4 B;  4ZUX B;  5BS7 C;  1KX5 C;  5B31 G;  3KUY C;  4KGC B;  4H9S A;  3WA9 B;  4H9O A;  5AV6 A;  3MGS B;  5AVB A;  3AZH A;  3B6G D;  4R8P B;  4H9S C;  1P3F D;  1M1A B;  5B1L A;  3AV2 A;  5BNX A;  5AV9 D;  5CPJ B;  3NQJ A;  5B2J D;  4XUJ B;  5GT3 A;  2ARO C;  3R45 A;  4EO5 B;  4KUD C;  4Z2M G;  4J8U C;  3B6F A;  1P3L A;  1P3G A;  5AV5 A;  3AZG C;  1P3A D;  5CP6 C;  4LD9 B;  3TU4 D;  1JFI B;  5B40 B;  1P3P D;  1P3L C;  3WTP B;  5AV5 C;  5CPI A;  4E45 A;  4J8X A;  1M19 B;  3LZ1 A;  4X23 A;  1P3B B;  4KHA B;  5JRG B;  3W98 A;  4X23 C;  5GT0 A;  3AZK A;  1P34 C;  4YM6 A;  5E5A D;  1S32 B;  3X1V B;  1F66 B;  1P3I D;  3REH C;  2IO5 B;  5B1M D;  3X1T B;  3A6N C;  5AY8 A;  4DRA A;  3REJ A;  5GXQ B;  4QLC B;  5B2I D;  4CAY B;  4NFT A;  3MNN D;  5AY8 C;  1M19 D;  3REJ C;  3C1B A;  5JRG D;  1KX5 B;  3KUY B;  3REK D;  1M18 A;  3C1B C;  3WAA B;  2F8N D;  1S32 D;  3MVD A;  3AZJ A;  1M18 C;  4Z5T D;  5DNN D;  3MVD C;  3AFA A;  3B0C W;  3LZ0 D;  2ARO B;  5GXQ D;  4QLC D;  4KUD B;  4J8U B;  3NQU A;  5BNX B;  5B0Z D;  3AFA C;  5B0Y D;  1P3K D;  3AZG B;  5CP6 B;  3R45 B;  3LJA A;  5FUG A;  1HQ3 D;  5AV9 C;  1P3L B;  5B24 D;  1KX5 D;  3AZF D;  5B2J C;  4WU8 A;  4WU9 A;  3V9R B;  5B32 A;  1P3P C;  2HUE C;  5AV6 D;  5BT1 D;  5B32 C;  5AVB D;  4X23 B;  3AZH D;  1P34 B;  1Q9C A;  5B1L D;  3AZL A;  3AV2 D;  3REH B;  5GT3 D;  3A6N B;  3AZL C;  3B6F D;  1P3I A;  1P3G D;  1P3O A;  5AV5 D;  5E5A C;  5AY8 B;  3AN2 A;  1P3I C;  3REJ B;  1TZY A;  5CPI D;  5B1M C;  4J8X D;  3MGQ A;  3W96 B;  3KSY A;  3LZ1 D;  3W99 A;  4X23 D;  3C1B B;  5B2I C;  3MNN C;  4H9P A;  3W98 D;  1ULY A;  1M18 B;  5GT0 D;  3AZK D;  4H9N B;  4YM6 D;  3REK C;  3MVD B;  5AVC A;  1ZLA A;  4H9R B;  3AFA B;  5AV8 A;  5AY8 D;  4Z5T C;  3KWQ A;  4G92 C;  3REJ D;  3AZM A;  1KX4 A;  4WZS B;  3NQU B;  5AV9 B;  5AV8 C;  3KWQ C;  5B2J B;  3AZM C;  3LZ0 C;  1KX4 C;  3C1B D;  5FUG B;  5BO0 A;  5B0Z C;  1WWS A;  5F99 A;  3REL A;  1P3K C;  1M18 D;  2F8N G;  1HQ3 C;  1P3P B;  3REL C;  5B24 C;  2HUE B;  3AZF C;  4E44 A;  3MVD D;  3AZJ D;  5B32 B;  3W97 A;  1AOI A;  4Z66 A;  3AFA D;  3LEL A;  2PYO A;  1AOI C;  3UTA A;  1BH8 A;  4H9Q A;  5AV6 C;  5BT1 C;  2PYO C;  5AVB C;  3AZH C;  3UTA C;  3LJA D;  5E5A B;  5B1L C;  3C1C A;  3AV2 C;  1P3I B;  4J8V A;  5B1M B;  5GT3 C;  3WKJ A;  2NZD A;  4UUZ B;  2RVQ C;  4WU9 D;  4WU8 D;  3B6F C;  1P3G C;  5B32 D;  3AYW A;  5B2I B;  3MNN B;  5CPI C;  4JJN A;  3AYW C;  4J8X C;  3MGP A;  3REK B;  1H3O B;  3LZ1 C;  3AZL D;  4WV4 B;  2HIO A;  4JJN C;  2F8N H;  3REI A;  2F8N B;  3VH6 T;  3MGP C;  3MGR A;  4AWL C;  3W98 C;  4WNN B;  2YFW A;  4Z5T B;  2HIO C;  4G92 B;  1P3O D;  1ID3 A;  5GT0 C;  3AZK C;  4YM6 C;  3MGR C;  3B0B A;  5DNN B;  5DNM A;  5AV8 B;  3AN2 D;  1HTA A;  1TZY D;  3LZ0 B;  3AZM B;  2YFV A;  1BH9 A;  3VH5 T;  3MGQ D;  5B0Z B;  5DNM C;  5B0Y B;  1P3K B;  3W99 D;  2BYK A;  4NE6 A;  5BO0 B;  1HQ3 B;  2CV5 A;  3REL B;  5B24 B;  3AZF B;  1A7W A;  1AOI B;  1TAF A;  5B33 A;  5AVC D;  4H9O B;  1ZLA D;  5BNV A;  5AV6 B;  3AZJ C;  5AV8 D;  3KWQ D;  5AVB B;  4ZBJ C;  3AZH B;  2PYO B;  3AZM D;  1KX4 D;  3UTA B;  5B33 C;  5B1L B;  3AV2 B;  3AZE A;  3NQJ B;  5GT3 B;  2NQB A;  3B6F B;  5F99 D;  3REL D;  1P3G B;  1B6W A;  3UTB A;  5AV5 B;  5JA4 A;  4CSR A;  3LJA C;  1EQZ A;  3UTB C;  5CPI B;  3X1U A;  1AOI D;  3W97 D;  4J8X B;  3B0D C;  4Z66 D;  4WU8 C;  3LZ1 B;  4WU9 C;  5CPK A;  1EQZ C;  3LEL D;  4JJN B;  2PYO D;  3X1U C;  3UTA D;  3W98 B;  4AWL B;  1WWI A;  5CPK C;  2HIO B;  5GT0 B;  1N1J A;  3AZK B;  4YM6 B;  3C1C D;  2RVQ D;  3UT9 A;  4J8V D;  4J8W A;  3WKJ D;  2NZD D;  5DNM B;  5GSU A;  1U35 A;  4ZUX A;  1P3O C;  3AYW D;  5B32 G;  2YFV B;  5G49 A;  1BH9 B;  4KGC A;  3AN2 C;  4ZUX C; 
#chains in the Genus database with same CATH topology
 1TZY C;  4JJN D;  3WA9 A;  3KXB D;  3MGS A;  3MGQ C;  3MGP D;  4R8P A;  3W99 C;  1M1A A;  2HIO D;  2JSS A;  5CPJ A;  3REI D;  4G91 C;  3MGR D;  4R8P C;  4XUJ A;  3AZJ B;  1ID3 D;  3KFU G;  4YS3 A;  2FJ7 A;  3EPH A;  5B33 B;  4LD9 A;  5DNM D;  2ZM5 A;  1JFI A;  4YS3 C;  5B40 A;  2FJ7 C;  1R4V A;  3WTP A;  5AVC C;  1ZLA C;  1PZR A;  3LJA B;  1W2E A;  4NE5 A;  1P3B A;  4KHA A;  2CV5 D;  4CSR B;  3VH6 A;  3B0D B;  1EQZ B;  4WU8 B;  4WU9 B;  5F99 C;  5B31 A;  3AZI D;  1Z2C B;  3X1V A;  1F66 A;  5B33 D;  3X1T A;  5CPK B;  2ZY2 A;  5B31 C;  3W97 C;  3VH5 A;  4Z66 C;  3AZL B;  3AZE D;  3LEL C;  2ZY5 A;  3B0C T;  4XZQ A;  2NQB D;  3WTP E;  1KX3 A;  1P3O B;  3UTB D;  1KU5 A;  3KUY A;  4XZQ C;  2BYM A;  4M6B A;  3C1C C;  1KX3 C;  3AN2 B;  4UPK A;  1EQZ D;  3WAA A;  3O62 A;  1TZY B;  4J8V C;  5G49 B;  3X1U D;  3AZN A;  3MGQ B;  3WKJ C;  2NZD C;  3WAA C;  4NE3 A;  4WJ3 C;  5CPK D;  3O62 C;  3W99 B;  3KXB A;  3AZN C;  4G91 B;  4H9P B;  3AV1 A;  2ARO A;  4KUD A;  4J8U A;  3KXB C;  2CWE A;  3AZG A;  5CP6 A;  3AV1 C;  4YS3 B;  3UT9 D;  2FJ7 B;  3REI C;  4J8W D;  5AVC B;  1ZLA B;  5GSU D;  3KWQ B;  1U35 D;  4ZUX D;  1ID3 C;  3V9R A;  1B67 A;  1KX4 B;  2L5A A;  2Y2I A;  1P3M A;  4KGC D;  3WA9 D;  3MGS D;  1P3M C;  5F99 B;  4R8P D;  1P34 A;  1M1A D;  5CPJ D;  3REH A;  2CV5 C;  4XUJ D;  5B31 B;  3A6N A;  3AZI A;  3W97 B;  4YS3 D;  4HGA C;  2FJ7 D;  4Z66 B;  4LD9 D;  3LEL B;  3AZI C;  5B40 D;  3WTP D;  1BH8 B;  4H9Q B;  3W96 A;  3X1S A;  4XZQ B;  1KX3 B;  3C1C B;  1P3B D;  4Z2M H;  3AZE C;  3W96 C;  3X1S C;  4J8V B;  3WKJ B;  2NQB C;  2NZD B;  2BYM B;  4H9N A;  3O62 B;  5B31 D;  3AYW B;  3X1V D;  1F66 D;  3AZN B;  2G5I C;  3X1T D;  4H9R A;  5KDM A;  3KXB B;  3MGP B;  3B6G A;  3AV1 B;  1P3F A;  5AV9 A;  3REI B;  4XZQ D;  5B2J A;  3MGR B;  3B6G C;  1KX3 D;  2YFW B;  2J8P A;  1P3F C;  1ID3 B;  3KUY D;  2F8N K;  1P3A A;  3WAA D;  3TU4 A;  3O62 D;  3UT9 C;  1P3P A;  2LY8 A;  4J8W C;  3AZN D;  1P3A C;  1P3M B;  5GSU C;  5C3I C;  1U35 C;  3TU4 C;  2BYK B;  4KGC C;  2CV5 B;  3AV1 D;  2ARO D;  3VH6 W;  3WA9 C;  4KUD D;  4J8U D;  4HGA B;  3MGS C;  3A1I A;  3AZG D;  5CP6 D;  1F1E A;  3AZI B;  1M1A C;  5E5A A;  4ZBJ B;  1P3L D;  5CPJ C;  1TAF B;  5B1M A;  4XUJ C;  5BNV B;  3VH5 W;  4EO5 C;  4UUZ A;  1P3M D;  4LD9 C;  5B2I A;  3AZE B;  3MNN A;  3X1S B;  5B40 C;  1M19 A;  2NQB B;  3WTP C;  3EG5 B;  1P34 D;  3UTB B;  5JRG A;  3REK A;  1H3O A;  1M19 C;  5JA4 B;  3REH D;  1P3B C;  2F8N A;  5JRG C;  3A6N D;  4WNN A;  3X1U B;  1S32 A;  4Z5T A;  1BFM A;  5DNN A;  1S32 C;  5KDM B;  3X1V C;  1F66 C;  3B6G B;  3LZ0 A;  2IO5 C;  5GXQ A;  4QLC A;  5CHL B;  3X1T C;  4DRB A;  4CAY A;  1P3F B;  5DNN C;  5B0Z A;  3W96 D;  3X1S D;  1N1J B;  3H0R C;  5B0Y A;  1P3K A;  5GXQ C;  4QLC C;  3IP4 C;  5BS7 A;  3UT9 B;  1HQ3 A;  1KX5 A;  5B24 A;  5B0Y C;  4J8W B;  3AZF A;  1P3A B;  5GSU B;  2ZY4 A;  5C3I B;  3TU4 B;  4ZUX B;  5BS7 C;  1U35 B;  1KX5 C;  5B31 G;  3KUY C;  4KGC B;  4H9S A;  3WA9 B;  4H9O A;  5AV6 A;  3MGS B;  5AVB A;  3AZH A;  3B6G D;  4R8P B;  4H9S C;  1P3F D;  1M1A B;  5B1L A;  3AV2 A;  5BNX A;  5AV9 D;  2Y2N A;  3NQJ A;  5CPJ B;  5B2J D;  4XUJ B;  5GT3 A;  2F2A C;  2ARO C;  3R45 A;  2XD5 A;  4EO5 B;  4KUD C;  4Z2M G;  4J8U C;  3B6F A;  1P3L A;  1P3G A;  5AV5 A;  3AZG C;  1P3A D;  5CP6 C;  4LD9 B;  3TU4 D;  1JFI B;  5B40 B;  1P3P D;  2JE5 A;  1P3L C;  3WTP B;  5AV5 C;  5CPI A;  4E45 A;  4J8X A;  1M19 B;  3LZ1 A;  4X23 A;  1P3B B;  4KHA B;  5JRG B;  3W98 A;  4X23 C;  5GT0 A;  3AZK A;  1P34 C;  4YM6 A;  5E5A D;  1S32 B;  3X1V B;  1F66 B;  2FFF B;  1P3I D;  3REH C;  2IO5 B;  5B1M D;  3X1T B;  3A6N C;  5AY8 A;  4DRA A;  3REJ A;  5GXQ B;  4QLC B;  5B2I D;  4CAY B;  4NFT A;  3MNN D;  5AY8 C;  1M19 D;  3REJ C;  3C1B A;  2Y2P A;  2W8S A;  5JRG D;  1KX5 B;  3KUY B;  3REK D;  1M18 A;  3C1B C;  3WAA B;  2F8N D;  2ZY3 A;  1S32 D;  3MVD A;  3AZJ A;  1M18 C;  4Z5T D;  3EPJ A;  5DNN D;  3MVD C;  3AFA A;  3B0C W;  3LZ0 D;  2ARO B;  5GXQ D;  4QLC D;  4KUD B;  4J8U B;  3NQU A;  5BNX B;  5B0Z D;  3AFA C;  5B0Y D;  1P3K D;  3AZG B;  5CP6 B;  3FDD A;  3R45 B;  3LJA A;  5FUG A;  3A1K A;  1HQ3 D;  5AV9 C;  1P3L B;  5B24 D;  1KX5 D;  3AZF D;  5B2J C;  3EPK A;  4WU8 A;  4WU9 A;  3V9R B;  5B32 A;  1P3P C;  2HUE C;  5AV6 D;  5BT1 D;  5B32 C;  5AVB D;  4X23 B;  3AZH D;  2Y2K A;  1P34 B;  2Y2M A;  1Q9C A;  5B1L D;  3AZL A;  3AV2 D;  1T3U A;  3REH B;  5GT3 D;  3A6N B;  3AZL C;  3B6F D;  1P3I A;  1P3G D;  1P3O A;  5AV5 D;  2G5H C;  2VQR A;  5E5A C;  2Y2H A;  5AY8 B;  3AN2 A;  1P3I C;  3REJ B;  1TZY A;  5CPI D;  5B1M C;  4J8X D;  3MGQ A;  3W96 B;  3KSY A;  3LZ1 D;  3W99 A;  4X23 D;  3C1B B;  5B2I C;  3MNN C;  4H9P A;  3W98 D;  1ULY A;  1M18 B;  2Y2O A;  5GT0 D;  2DF4 C;  3AZK D;  4H9N B;  4YM6 D;  3REK C;  3MVD B;  2BG1 A;  5AVC A;  2Y2L A;  1ZLA A;  4H9R B;  3AFA B;  5AV8 A;  5AY8 D;  4Z5T C;  3KWQ A;  4G92 C;  3REJ D;  3AZM A;  3P5J B;  1KX4 A;  4WZS B;  3NQU B;  5AV9 B;  5AV8 C;  3KWQ C;  5B2J B;  3AZM C;  3LZ0 C;  1KX4 C;  3C1B D;  5FUG B;  5BO0 A;  5B0Z C;  1WWS A;  5F99 A;  3REL A;  1P3K C;  1M18 D;  2F8N G;  1HQ3 C;  1P3P B;  3REL C;  5B24 C;  2HUE B;  3AZF C;  4E44 A;  3MVD D;  3AZJ D;  5B32 B;  3W97 A;  1AOI A;  2DQN C;  4Z66 A;  3AFA D;  3LEL A;  2PYO A;  1AOI C;  3UTA A;  2Y2G A;  1BH8 A;  4H9Q A;  5AV6 C;  5BT1 C;  2PYO C;  5AVB C;  3AZH C;  3H0M C;  3UTA C;  3LJA D;  5E5A B;  5B1L C;  3C1C A;  3AV2 C;  1P3I B;  4J8V A;  5B1M B;  5GT3 C;  3WKJ A;  2NZD A;  4UUZ B;  2RVQ C;  4WU9 D;  4WU8 D;  3B6F C;  1P3G C;  5B32 D;  3AYW A;  5B2I B;  3MNN B;  5CPI C;  4JJN A;  3AYW C;  4J8X C;  3MGP A;  3REK B;  1H3O B;  3LZ1 C;  3AZL D;  4WV4 B;  2HIO A;  4JJN C;  2F8N H;  3REI A;  2F8N B;  3VH6 T;  3MGP C;  3MGR A;  4AWL C;  3W98 C;  4WNN B;  2YFW A;  4Z5T B;  2HIO C;  4G92 B;  1P3O D;  1ID3 A;  5GT0 C;  3AZK C;  4YM6 C;  3MGR C;  3B0B A;  5DNN B;  2RIQ A;  5DNM A;  5AV8 B;  3AN2 D;  1HTA A;  1TZY D;  3LZ0 B;  3AZM B;  2YFV A;  1BH9 A;  3VH5 T;  3MGQ D;  5B0Z B;  5DNM C;  5B0Y B;  1P3K B;  3W99 D;  2BYK A;  4NE6 A;  5BO0 B;  2Y2Q A;  1HQ3 B;  2CV5 A;  3REL B;  5B24 B;  3AZF B;  1A7W A;  1AOI B;  1TAF A;  5B33 A;  5AVC D;  4H9O B;  1ZLA D;  5BNV A;  5AV6 B;  3AZJ C;  5AV8 D;  3KWQ D;  5AVB B;  4ZBJ C;  3AZH B;  2PYO B;  3AZM D;  1KX4 D;  3UTA B;  5B33 C;  5B1L B;  3AV2 B;  3AZE A;  3NQJ B;  2UWX A;  3F6T A;  5GT3 B;  4DQY B;  2NQB A;  3B6F B;  5F99 D;  3REL D;  1P3G B;  1B6W A;  3UTB A;  5AV5 B;  5JA4 A;  3H0L C;  4CSR A;  3LJA C;  1EQZ A;  3UTB C;  5CPI B;  2JCH A;  3X1U A;  1AOI D;  3W97 D;  4J8X B;  2XD1 A;  3B0D C;  4Z66 D;  4WU8 C;  3LZ1 B;  4WU9 C;  5CPK A;  1EQZ C;  3LEL D;  4JJN B;  2PYO D;  3X1U C;  3UTA D;  3W98 B;  4AWL B;  1WWI A;  5CPK C;  2HIO B;  5GT0 B;  1N1J A;  3EPL A;  3AZK B;  4YM6 B;  3C1C D;  2RVQ D;  3UT9 A;  4J8V D;  4J8W A;  3WKJ D;  2NZD D;  3AL0 C;  5DNM B;  5GSU A;  1U35 A;  4ZUX A;  1P3O C;  3AYW D;  5B32 G;  2YFV B;  5G49 A;  1BH9 B;  2Y2J A;  4KGC A;  3AN2 C;  4ZUX C; 
#chains in the Genus database with same CATH homology
 1TZY C;  4JJN D;  3WA9 A;  3KXB D;  3MGS A;  3MGQ C;  3MGP D;  4R8P A;  3W99 C;  1M1A A;  2HIO D;  2JSS A;  5CPJ A;  3REI D;  4G91 C;  3MGR D;  4R8P C;  4XUJ A;  3AZJ B;  1ID3 D;  3KFU G;  4YS3 A;  2FJ7 A;  3EPH A;  5B33 B;  4LD9 A;  5DNM D;  2ZM5 A;  1JFI A;  4YS3 C;  5B40 A;  2FJ7 C;  1R4V A;  3WTP A;  5AVC C;  1ZLA C;  1PZR A;  3LJA B;  1W2E A;  4NE5 A;  1P3B A;  4KHA A;  2CV5 D;  4CSR B;  3VH6 A;  3B0D B;  1EQZ B;  4WU8 B;  4WU9 B;  5F99 C;  5B31 A;  3AZI D;  1Z2C B;  3X1V A;  1F66 A;  5B33 D;  3X1T A;  5CPK B;  2ZY2 A;  5B31 C;  3W97 C;  3VH5 A;  4Z66 C;  3AZL B;  3AZE D;  3LEL C;  2ZY5 A;  3B0C T;  4XZQ A;  2NQB D;  3WTP E;  1KX3 A;  1P3O B;  3UTB D;  1KU5 A;  3KUY A;  4XZQ C;  2BYM A;  4M6B A;  3C1C C;  1KX3 C;  3AN2 B;  4UPK A;  1EQZ D;  3WAA A;  3O62 A;  1TZY B;  4J8V C;  5G49 B;  3X1U D;  3AZN A;  3MGQ B;  3WKJ C;  2NZD C;  3WAA C;  4NE3 A;  4WJ3 C;  5CPK D;  3O62 C;  3W99 B;  3KXB A;  3AZN C;  4G91 B;  4H9P B;  3AV1 A;  2ARO A;  4KUD A;  4J8U A;  3KXB C;  2CWE A;  3AZG A;  5CP6 A;  3AV1 C;  4YS3 B;  3UT9 D;  2FJ7 B;  3REI C;  4J8W D;  5AVC B;  1ZLA B;  5GSU D;  3KWQ B;  1U35 D;  4ZUX D;  1ID3 C;  3V9R A;  1B67 A;  1KX4 B;  2L5A A;  2Y2I A;  1P3M A;  4KGC D;  3WA9 D;  3MGS D;  1P3M C;  5F99 B;  4R8P D;  1P34 A;  1M1A D;  5CPJ D;  3REH A;  2CV5 C;  4XUJ D;  5B31 B;  3A6N A;  3AZI A;  3W97 B;  4YS3 D;  4HGA C;  2FJ7 D;  4Z66 B;  4LD9 D;  3LEL B;  3AZI C;  5B40 D;  3WTP D;  1BH8 B;  4H9Q B;  3W96 A;  3X1S A;  4XZQ B;  1KX3 B;  3C1C B;  1P3B D;  4Z2M H;  3AZE C;  3W96 C;  3X1S C;  4J8V B;  3WKJ B;  2NQB C;  2NZD B;  2BYM B;  4H9N A;  3O62 B;  5B31 D;  3AYW B;  3X1V D;  1F66 D;  3AZN B;  2G5I C;  3X1T D;  4H9R A;  5KDM A;  3KXB B;  3MGP B;  3B6G A;  3AV1 B;  1P3F A;  5AV9 A;  3REI B;  4XZQ D;  5B2J A;  3MGR B;  3B6G C;  1KX3 D;  2YFW B;  2J8P A;  1P3F C;  1ID3 B;  3KUY D;  2F8N K;  1P3A A;  3WAA D;  3TU4 A;  3O62 D;  3UT9 C;  1P3P A;  2LY8 A;  4J8W C;  3AZN D;  1P3A C;  1P3M B;  5GSU C;  5C3I C;  1U35 C;  3TU4 C;  2BYK B;  4KGC C;  2CV5 B;  3AV1 D;  2ARO D;  3VH6 W;  3WA9 C;  4KUD D;  4J8U D;  4HGA B;  3MGS C;  3A1I A;  3AZG D;  5CP6 D;  1F1E A;  3AZI B;  1M1A C;  5E5A A;  4ZBJ B;  1P3L D;  5CPJ C;  1TAF B;  5B1M A;  4XUJ C;  5BNV B;  3VH5 W;  4EO5 C;  4UUZ A;  1P3M D;  4LD9 C;  5B2I A;  3AZE B;  3MNN A;  3X1S B;  5B40 C;  1M19 A;  2NQB B;  3WTP C;  3EG5 B;  1P34 D;  3UTB B;  5JRG A;  3REK A;  1H3O A;  1M19 C;  5JA4 B;  3REH D;  1P3B C;  2F8N A;  5JRG C;  3A6N D;  4WNN A;  3X1U B;  1S32 A;  4Z5T A;  1BFM A;  5DNN A;  1S32 C;  5KDM B;  3X1V C;  1F66 C;  3B6G B;  3LZ0 A;  2IO5 C;  5GXQ A;  4QLC A;  5CHL B;  3X1T C;  4DRB A;  4CAY A;  1P3F B;  5DNN C;  5B0Z A;  3W96 D;  3X1S D;  1N1J B;  3H0R C;  5B0Y A;  1P3K A;  5GXQ C;  4QLC C;  3IP4 C;  5BS7 A;  3UT9 B;  1HQ3 A;  1KX5 A;  5B24 A;  5B0Y C;  4J8W B;  3AZF A;  1P3A B;  5GSU B;  2ZY4 A;  5C3I B;  3TU4 B;  4ZUX B;  5BS7 C;  1U35 B;  1KX5 C;  5B31 G;  3KUY C;  4KGC B;  4H9S A;  3WA9 B;  4H9O A;  5AV6 A;  3MGS B;  5AVB A;  3AZH A;  3B6G D;  4R8P B;  4H9S C;  1P3F D;  1M1A B;  5B1L A;  3AV2 A;  5BNX A;  5AV9 D;  2Y2N A;  3NQJ A;  5CPJ B;  5B2J D;  4XUJ B;  5GT3 A;  2F2A C;  2ARO C;  3R45 A;  2XD5 A;  4EO5 B;  4KUD C;  4Z2M G;  4J8U C;  3B6F A;  1P3L A;  1P3G A;  5AV5 A;  3AZG C;  1P3A D;  5CP6 C;  4LD9 B;  3TU4 D;  1JFI B;  5B40 B;  1P3P D;  2JE5 A;  1P3L C;  3WTP B;  5AV5 C;  5CPI A;  4E45 A;  4J8X A;  1M19 B;  3LZ1 A;  4X23 A;  1P3B B;  4KHA B;  5JRG B;  3W98 A;  4X23 C;  5GT0 A;  3AZK A;  1P34 C;  4YM6 A;  5E5A D;  1S32 B;  3X1V B;  1F66 B;  2FFF B;  1P3I D;  3REH C;  2IO5 B;  5B1M D;  3X1T B;  3A6N C;  5AY8 A;  4DRA A;  3REJ A;  5GXQ B;  4QLC B;  5B2I D;  4CAY B;  4NFT A;  3MNN D;  5AY8 C;  1M19 D;  3REJ C;  3C1B A;  2Y2P A;  2W8S A;  5JRG D;  1KX5 B;  3KUY B;  3REK D;  1M18 A;  3C1B C;  3WAA B;  2F8N D;  2ZY3 A;  1S32 D;  3MVD A;  3AZJ A;  1M18 C;  4Z5T D;  3EPJ A;  5DNN D;  3MVD C;  3AFA A;  3B0C W;  3LZ0 D;  2ARO B;  5GXQ D;  4QLC D;  4KUD B;  4J8U B;  3NQU A;  5BNX B;  5B0Z D;  3AFA C;  5B0Y D;  1P3K D;  3AZG B;  5CP6 B;  3FDD A;  3R45 B;  3LJA A;  5FUG A;  3A1K A;  1HQ3 D;  5AV9 C;  1P3L B;  5B24 D;  1KX5 D;  3AZF D;  5B2J C;  3EPK A;  4WU8 A;  4WU9 A;  3V9R B;  5B32 A;  1P3P C;  2HUE C;  5AV6 D;  5BT1 D;  5B32 C;  5AVB D;  4X23 B;  3AZH D;  2Y2K A;  1P34 B;  2Y2M A;  1Q9C A;  5B1L D;  3AZL A;  3AV2 D;  1T3U A;  3REH B;  5GT3 D;  3A6N B;  3AZL C;  3B6F D;  1P3I A;  1P3G D;  1P3O A;  5AV5 D;  2G5H C;  2VQR A;  5E5A C;  2Y2H A;  5AY8 B;  3AN2 A;  1P3I C;  3REJ B;  1TZY A;  5CPI D;  5B1M C;  4J8X D;  3MGQ A;  3W96 B;  3KSY A;  3LZ1 D;  3W99 A;  4X23 D;  3C1B B;  5B2I C;  3MNN C;  4H9P A;  3W98 D;  1ULY A;  1M18 B;  2Y2O A;  5GT0 D;  2DF4 C;  3AZK D;  4H9N B;  4YM6 D;  3REK C;  3MVD B;  2BG1 A;  5AVC A;  2Y2L A;  1ZLA A;  4H9R B;  3AFA B;  5AV8 A;  5AY8 D;  4Z5T C;  3KWQ A;  4G92 C;  3REJ D;  3AZM A;  3P5J B;  1KX4 A;  4WZS B;  3NQU B;  5AV9 B;  5AV8 C;  3KWQ C;  5B2J B;  3AZM C;  3LZ0 C;  1KX4 C;  3C1B D;  5FUG B;  5BO0 A;  5B0Z C;  1WWS A;  5F99 A;  3REL A;  1P3K C;  1M18 D;  2F8N G;  1HQ3 C;  1P3P B;  3REL C;  5B24 C;  2HUE B;  3AZF C;  4E44 A;  3MVD D;  3AZJ D;  5B32 B;  3W97 A;  1AOI A;  2DQN C;  4Z66 A;  3AFA D;  3LEL A;  2PYO A;  1AOI C;  3UTA A;  2Y2G A;  1BH8 A;  4H9Q A;  5AV6 C;  5BT1 C;  2PYO C;  5AVB C;  3AZH C;  3H0M C;  3UTA C;  3LJA D;  5E5A B;  5B1L C;  3C1C A;  3AV2 C;  1P3I B;  4J8V A;  5B1M B;  5GT3 C;  3WKJ A;  2NZD A;  4UUZ B;  2RVQ C;  4WU9 D;  4WU8 D;  3B6F C;  1P3G C;  5B32 D;  3AYW A;  5B2I B;  3MNN B;  5CPI C;  4JJN A;  3AYW C;  4J8X C;  3MGP A;  3REK B;  1H3O B;  3LZ1 C;  3AZL D;  4WV4 B;  2HIO A;  4JJN C;  2F8N H;  3REI A;  2F8N B;  3VH6 T;  3MGP C;  3MGR A;  4AWL C;  3W98 C;  4WNN B;  2YFW A;  4Z5T B;  2HIO C;  4G92 B;  1P3O D;  1ID3 A;  5GT0 C;  3AZK C;  4YM6 C;  3MGR C;  3B0B A;  5DNN B;  2RIQ A;  5DNM A;  5AV8 B;  3AN2 D;  1HTA A;  1TZY D;  3LZ0 B;  3AZM B;  2YFV A;  1BH9 A;  3VH5 T;  3MGQ D;  5B0Z B;  5DNM C;  5B0Y B;  1P3K B;  3W99 D;  2BYK A;  4NE6 A;  5BO0 B;  2Y2Q A;  1HQ3 B;  2CV5 A;  3REL B;  5B24 B;  3AZF B;  1A7W A;  1AOI B;  1TAF A;  5B33 A;  5AVC D;  4H9O B;  1ZLA D;  5BNV A;  5AV6 B;  3AZJ C;  5AV8 D;  3KWQ D;  5AVB B;  4ZBJ C;  3AZH B;  2PYO B;  3AZM D;  1KX4 D;  3UTA B;  5B33 C;  5B1L B;  3AV2 B;  3AZE A;  3NQJ B;  2UWX A;  3F6T A;  5GT3 B;  4DQY B;  2NQB A;  3B6F B;  5F99 D;  3REL D;  1P3G B;  1B6W A;  3UTB A;  5AV5 B;  5JA4 A;  3H0L C;  4CSR A;  3LJA C;  1EQZ A;  3UTB C;  5CPI B;  2JCH A;  3X1U A;  1AOI D;  3W97 D;  4J8X B;  2XD1 A;  3B0D C;  4Z66 D;  4WU8 C;  3LZ1 B;  4WU9 C;  5CPK A;  1EQZ C;  3LEL D;  4JJN B;  2PYO D;  3X1U C;  3UTA D;  3W98 B;  4AWL B;  1WWI A;  5CPK C;  2HIO B;  5GT0 B;  1N1J A;  3EPL A;  3AZK B;  4YM6 B;  3C1C D;  2RVQ D;  3UT9 A;  4J8V D;  4J8W A;  3WKJ D;  2NZD D;  3AL0 C;  5DNM B;  5GSU A;  1U35 A;  4ZUX A;  1P3O C;  3AYW D;  5B32 G;  2YFV B;  5G49 A;  1BH9 B;  2Y2J A;  4KGC A;  3AN2 C;  4ZUX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...