3KXBB

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 25
structure length 74
sequence length 74
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbB00
3LELB 5AV8B 3W97C 1S32D 5B2IB 3AN2C 1BFMA 3REKB 1P3IA 4J8VC 5CPIA 1ZLAB 4J8UD 1ULYA 3A6ND 4KGCD 2L5AA 3VH6W 4Z66A 4R8PD 3X1VD 1BH9A 1P3IC 4X23B 5AY8A 5CPIC 5AV5A 1N1JB 3R45A 2HUEC 4YM6A 3TU4A 4Z66C 5F99D 4G92C 5AY8C 3AZGD 5CP6D 5AVBD 1S32A 5AV5C 4J8XB 4YM6C 3TU4C 3W96D 3AFAD 3AZID 4YS3D 5B0YD 1P3FD 4H9QA 3RELD 5KDMA 5B0ZD 4J8UA 1S32C 5B31B 3A6NA 4KGCA 5CHLB 5JA4A 2BYKA 4R8PA 3X1VA 2CV5D 1R4VA 4XUJB 3LZ1D 2FJ7B 3NQUB 4J8UC 3A6NC 4KGCC 3REJB 5F99A 4R8PC 3X1VC 3AZGA 1TAFA 5CP6A 5AVBA 3W96A 5B40D 5B24D 3AFAA 3AZIA 4YS3A 5F99C 5B0YA 1P3FA 3KXBB 4H9OB 3MVDB 3AZGC 4H9SA 5CP6C 3NQJA 5AVBC 5B32G 3RELA 5B0ZA 3W96C 3AZMB 2CV5A 3AFAC 3AZIC 4YS3C 3X1TC 5B0YC 3LZ1A 1P3KB 1P3FC 4AWLC 5GSUD 4ZUXD 3REHD 4KUDD 3RELC 3AZFD 5B0ZC 3WTPE 1Q9CA 1HQ3D 5FUGB 2HIOB 3VH5T 3LZ1C 5DNND 5B40A 5B24A 3X1UB 1TZYB 4H9NA 4Z2MH 5B2JA 4G91B 1BH8B 2YFVB 3WTPD 5DNMB 1P3OC 5BNVA 5B40C 1P3AD 5B24C 1WWSA 5GSUA 4ZUXA 3REHA 3AZFA 5GXQB 1AOIB 3AV2D 5GT3D 3WA9B 3REIC 1HQ3A 2IO5C 3AZED 5GSUC 4ZUXC 3REHC 3KWQD 1P34D 4KUDC 2NZDD 3AZFC 5BT1D 3AV1B 3UTBB 5AVCD 1HQ3C 1H3OB 3AZND 5E5AA 3WTPA 5DNNC 4NFTA 1M18A 4CAYA 2NQBD 3WTPC 3MGRD 3B6GB 3AV2A 5GT3A 1P3AC 1KX5B 3AZEA 4XZQC 3KWQA 2NZDA 1P3PD 3AV2C 5GT3C 3MNNC 5AVCA 3MGQD 3AZEC 3AZJD 3AZNA 4J8WA 4QLCB 3V9RB 3AYWD 1P34C 1HTAA 1BH9B 3KWQC 2NZDC 2BYMB 1EQZD 5AV5B 5BT1C 4KHAB 2AROD 4YM6B 5AVCC 2NQBA 3C1CD 3MGRA 2PYOD 5B33D 3UTAB 4J8VA 2NQBC 5B1MD 3O62B 3UT9B 3MGRC 3B0DB 1P3GB 1P3PA 3MGQA 4H9QB 4LD9B 3AZJA 3AYWA 2BYKB 4R8PB 1P3BB 5B1LB 1P3LB 4NE5A 4WU9B 1P3PC 1EQZA 2AROA 4Z5TD 3MGQC 2YFWA 3AZJC 3AZHD 3C1CA 3AYWC 2PYOA 4CSRA 3W99B 5B33A 1TAFB 1EQZC 2AROC 3AZKB 4EO5B 5B1MA 4NE3A 3C1CC 2PYOC 5AV6D 5B33C 3NQJB 3WAAD 3VH5A 5CPJD 2F8ND 3MGPD 3AZLB 1P3MB 3LELD 2CV5B 3X1TD 5B1MC 4HGAC 1F66B 5B2ID 1M19D 4Z5TA 3REKD 2JSSA 1KX4B 4WNNA 3AZHA 5C3IB 4WZSB 4ZBJB 5B32B 4Z5TC 4E45A 3X1SD 3MGSB 3AZHC 5AV9B 3VH6T 5AV6A 5B2JB 3WAAA 1P3OD 2F8NH 5CPJA 4NE6A 2F8NA 5BNVB 3LELA 3X1TA 5G49A 5B2IA 4J8XD 1M19A 1M1AD 5AV6C 5GSUB 5JRGD 3REKA 3WAAC 5CPJC 3MGPC 3REID 5GT0D 3LELC 4Z2MG 1HQ3B 5B2IC 1M19C 5B31D 3X1SA 3REKC 2F8NK 3B6FB 4WU8B 4H9PB 1ZLAC 1N1JA 2FJ7D 1P3OA 5E5AB 5BO0B 1ID3B 3X1SC 3REJD 4E44A 4X23C 1M18B 4J8XA 1M1AA 5JRGA 3AV2B 5GT3B 3REIA 5GT0A 3KXBD 3MVDD 4XZQD 3B0CW 4J8XC 1WWIA 1M1AC 5B31A 4KUDA 5JRGC 3KWQB 3AZMD 4H9RB 3MNND 1B67A 1U35D 4WV4B 4JJND 1KX3D 3C1BB 5GT0C 5AVCB 3KUYD 2FJ7A 3AZNB 5DNNA 4J8WB 5B31C 1JFIB 3REJA 5CPKB 4UUZA 2LY8A 2HIOD 2FJ7C 3WKJB 1P3AA 3W97B 1A7WA 3REJC 3KXBA 4H9OA 3AN2B 4XZQA 4J8VB 5DNMD 3AZMA 1F1EA 3MNNA 1U35A 4JJNA 1KX3A 3KXBC 3KUYA 3MVDC 1P34A 1P3IB 1AOID 5CPIB 3WA9D 3AZMC 2HUEB 1U35C 4JJNC 1KX3C 2AROB 2HIOA 1P3KC 3KUYC 2YFWB 4Z66B 5BNXA 4G92B 5AY8B 3AV1D 3R45B 3TU4B 3W98D 1BH8A 2HIOC 2YFVA 1B6WA 5DNMA 3LZ0D 1S32B 4DRAA 3B6GD 1AOIA 5DNMC 1KX5D 3WA9A 3VH6A 5KDMB 4J8UB 3A6NB 4KGCB 5JA4B 3X1VB 1AOIC 3AV1A 3WA9C 3W98A 3LJAD 4QLCD 5F99B 3AZGB 5CP6B 5AVBB 3LZ0A 3AV1C 3WAAB 3W98C 3W96B 3B6GA 3AFAB 3AZIB 4YS3B 3X1TB 5B0YB 1P3FB 3UTAD 1KX5A 4AWLB 5G49B 1M19B 3LZ0C 3RELB 5B0ZB 3O62D 3UT9D 1P3GD 3B6GC 5AV8D 3LZ1B 1KX5C 4LD9D 3LJAA 4QLCA 3V9RA 3X1SB 2F8NG 1P3BD 5B1LD 1P3LD 1ZLAD 2BYMA 4WU9D 4KHAA 1P3OB 5B40B 5B24B 4QLCC 4X23D 3LJAC 4H9NB 3W99D 3UTAA 1M1AB 3AZKD 5JRGB 3MGPA 3O62A 3UT9A 1P3GA 3REIB 2IO5B 5GT0B 5AV8A 3UTAC 4ZUXB 3REHB 4LD9A 4KUDB 3AZFB 2RVQD 3VH5W 3AZLD 1P3MD 1P3BA 5B1LA 1P3LA 1ZLAA 3O62C 3UT9C 1P3GC 3B0DC 4WU9A 5AV8C 1F66D 1KX4D 5DNNB 4LD9C 4X23A 4UUZB 1P3BC 5B1LC 4XUJD 1P3LC 3W99A 4WU9C 5B32D 5B31G 3MGSD 3AZKA 3WTPB 1P3AB 4DRBA 5AV9D 4CAYB 3W99C 5B2JD 4XZQB 3AZKC 3AZLA 1P3MA 4EO5C 3MNNB 1U35B 4JJNB 1KX3B 1F66A 3AZEB 3KUYB 4H9SC 1P34B 1KX4A 2NZDB 2RVQC 3AZLC 1P3MC 2CV5C 1P3KD 4XUJA 1F66C 5B32A 3NQUA 3MGSA 5BNXB 1KX4C 3B6FD 4WU8D 5AV9A 5C3IC 4XUJC 2CWEA 1KU5A 4ZBJC 5E5AD 5B32C 2NQBB 3MGSC 3X1UD 1ID3D 3MGRB 1TZYD 5AV9C 1M18D 3MVDA 5B2JC 1P3PB 1P3KA 3MGQB 3AZJB 3AYWB 5GXQD 3B6FA 3B0CT 4WU8A 3C1BD 5FUGA 4M6BA 1EQZB 4H9PA 3W98B 4J8WD 5BO0A 1ID3A 3X1UA 3C1CB 2PYOB 5CPKD 1TZYA 3B6FC 4CSRB 3UTBD 5B33B 4WU8C 3LZ0B 3WKJD 5E5AC 5B1MB 1ID3C 4HGAB 3X1UC 3W97D 1TZYC 3AN2D 1M18C 4J8VD 4G91C 5GXQA 4H9RA 5BS7A 3C1BA 4Z5TB 1P3ID 3LJAB 4WNNB 3AZHB 5CPID 1JFIA 5GXQC 5CPKA 3UTBA 5BS7C 3C1BC 3KSYA 1H3OA 3WKJA 4Z66D 3AZNC 4J8WC 5AY8D 3B0BA 3W97A 5AV5D 5CPKC 5AV6B 4YM6D 3UTBC 3TU4D 3AN2A 5CPJB 2F8NB 3MGPB 3WKJC
chains in the Genus database with same CATH superfamily
3LELB 5AV8B 3W97C 1S32D 5B2IB 3AN2C 1BFMA 3REKB 1P3IA 4J8VC 5CPIA 1ZLAB 2Y2PA 4J8UD 1ULYA 3A6ND 4KGCD 2L5AA 3VH6W 4Z66A 4R8PD 3X1VD 1BH9A 1P3IC 4X23B 5AY8A 5CPIC 5AV5A 1N1JB 2HUEC 3R45A 4YM6A 3TU4A 3A1KA 4Z66C 5F99D 4G92C 5AY8C 3AZGD 5CP6D 5AVBD 1S32A 5AV5C 4J8XB 2J8PA 1Z2CB 4YM6C 3TU4C 3W96D 3AFAD 3AZID 4YS3D 5B0YD 1P3FD 4H9QA 3RELD 5KDMA 5B0ZD 4J8UA 1S32C 5B31B 3A6NA 4KGCA 2ZY3A 3AL0C 5CHLB 5JA4A 2BYKA 4R8PA 3X1VA 2CV5D 1R4VA 4XUJB 3LZ1D 2FJ7B 3NQUB 4J8UC 3A6NC 4KGCC 3REJB 5F99A 4R8PC 3X1VC 3AZGA 1TAFA 5CP6A 5AVBA 3W96A 5B40D 5B24D 3H0LC 3AFAA 3AZIA 4YS3A 5F99C 5B0YA 1P3FA 3KXBB 4H9OB 3MVDB 3AZGC 4H9SA 5CP6C 3NQJA 5AVBC 5B32G 3RELA 5B0ZA 3W96C 3AZMB 2CV5A 3AFAC 3AZIC 4YS3C 3X1TC 5B0YC 3LZ1A 1P3KB 1P3FC 4AWLC 5GSUD 4ZUXD 3REHD 4KUDD 3RELC 3AZFD 5B0ZC 3WTPE 1Q9CA 1HQ3D 5FUGB 3KFUG 2HIOB 3VH5T 3LZ1C 5DNND 5B40A 5B24A 3X1UB 1TZYB 4H9NA 4Z2MH 5B2JA 4G91B 1BH8B 2YFVB 3WTPD 2Y2GA 5DNMB 1P3OC 5BNVA 5B40C 1P3AD 5B24C 1WWSA 5GSUA 4ZUXA 3REHA 3AZFA 2ZY5A 5GXQB 1AOIB 3AV2D 5GT3D 3WA9B 3REIC 2Y2HA 1HQ3A 2IO5C 3AZED 5GSUC 4ZUXC 3REHC 3KWQD 1P34D 4KUDC 2NZDD 3AZFC 2W8SA 5BT1D 3AV1B 3UTBB 5AVCD 1HQ3C 1H3OB 3AZND 5E5AA 3WTPA 5DNNC 4NFTA 1M18A 4CAYA 2NQBD 2ZY2A 3WTPC 2G5IC 3MGRD 3B6GB 3AV2A 5GT3A 1P3AC 1KX5B 3AZEA 4XZQC 3EG5B 3A1IA 4UPKA 3KWQA 2NZDA 1P3PD 3AV2C 5GT3C 3MNNC 5AVCA 3MGQD 3AZEC 3AZJD 3AZNA 4J8WA 4QLCB 3V9RB 3AYWD 1P34C 1HTAA 1BH9B 3KWQC 2NZDC 2BYMB 1EQZD 5AV5B 5BT1C 4KHAB 2AROD 4YM6B 5AVCC 2NQBA 3C1CD 3MGRA 2PYOD 5B33D 3UTAB 2DF4C 2Y2IA 4J8VA 2NQBC 5B1MD 3O62B 3UT9B 3MGRC 3B0DB 1P3GB 2JE5A 1P3PA 3MGQA 2DQNC 4H9QB 4LD9B 3AZJA 2VQRA 3AYWA 2BYKB 4R8PB 1P3BB 2FFFB 5B1LB 1P3LB 4NE5A 4WU9B 1P3PC 1EQZA 2AROA 4Z5TD 3MGQC 2YFWA 3AZJC 3AZHD 3C1CA 3AYWC 2PYOA 4CSRA 3W99B 5B33A 1TAFB 1EQZC 2AROC 3AZKB 4EO5B 5B1MA 4NE3A 3C1CC 2PYOC 5AV6D 5B33C 3NQJB 3WAAD 3VH5A 5CPJD 2F8ND 3MGPD 3AZLB 1P3MB 3LELD 2CV5B 3X1TD 5B1MC 4HGAC 1F66B 5B2ID 1M19D 4Z5TA 3REKD 2JSSA 1KX4B 4WNNA 3AZHA 5C3IB 4WZSB 2Y2JA 2Y2OA 4ZBJB 5B32B 3EPJA 4Z5TC 4E45A 3X1SD 3MGSB 2F2AC 3AZHC 5AV9B 1W2EA 3VH6T 5AV6A 5B2JB 3WAAA 1P3OD 2F8NH 5CPJA 4NE6A 2F8NA 5BNVB 3LELA 1PZRA 3X1TA 5G49A 5B2IA 4J8XD 1M19A 1M1AD 5AV6C 5GSUB 5JRGD 3REKA 3WAAC 5CPJC 3MGPC 3REID 5GT0D 3LELC 4Z2MG 1HQ3B 5B2IC 1M19C 5B31D 3X1SA 3REKC 2F8NK 3B6FB 4WU8B 4H9PB 1ZLAC 1N1JA 2ZY4A 2FJ7D 1P3OA 5E5AB 1T3UA 3P5JB 5BO0B 3X1SC 3REJD 4E44A 1ID3B 4X23C 1M18B 4J8XA 1M1AA 5JRGA 3AV2B 5GT3B 3REIA 5GT0A 2BG1A 3KXBD 3EPKA 3MVDD 4XZQD 3B0CW 4J8XC 1WWIA 1M1AC 5B31A 4KUDA 5JRGC 3KWQB 3AZMD 4H9RB 3MNND 1B67A 1U35D 4WV4B 4JJND 1KX3D 3C1BB 5GT0C 5AVCB 3KUYD 2FJ7A 2G5HC 3AZNB 5DNNA 4J8WB 5B31C 1JFIB 3REJA 5CPKB 4UUZA 2LY8A 2HIOD 2FJ7C 3WKJB 3IP4C 1P3AA 3W97B 1A7WA 3REJC 3KXBA 4H9OA 3AN2B 4XZQA 4J8VB 5DNMD 3AZMA 1F1EA 3MNNA 1U35A 4JJNA 1KX3A 3KXBC 3KUYA 3MVDC 1P34A 1P3IB 1AOID 5CPIB 3WA9D 3AZMC 2HUEB 1U35C 4JJNC 1KX3C 2AROB 2HIOA 1P3KC 3KUYC 3F6TA 2ZM5A 2RIQA 2YFWB 5BNXA 4Z66B 4G92B 5AY8B 3AV1D 3R45B 3TU4B 3W98D 1BH8A 2HIOC 2YFVA 1B6WA 5DNMA 3LZ0D 1S32B 2XD5A 4DRAA 3B6GD 1AOIA 5DNMC 1KX5D 3WA9A 2UWXA 3VH6A 5KDMB 4J8UB 3A6NB 4KGCB 5JA4B 3X1VB 2JCHA 1AOIC 3AV1A 3WA9C 3W98A 3LJAD 4QLCD 5F99B 3AZGB 5CP6B 5AVBB 3LZ0A 3AV1C 3WAAB 3W98C 3W96B 3B6GA 3AFAB 3AZIB 4YS3B 3X1TB 5B0YB 1P3FB 3UTAD 1KX5A 4AWLB 5G49B 1M19B 3LZ0C 3RELB 2Y2NA 5B0ZB 3O62D 3UT9D 1P3GD 3B6GC 5AV8D 3LZ1B 1KX5C 4LD9D 3LJAA 4QLCA 3V9RA 3X1SB 2F8NG 1P3BD 5B1LD 1P3LD 1ZLAD 2BYMA 4WU9D 4KHAA 2Y2LA 1P3OB 5B40B 3H0MC 5B24B 4QLCC 4X23D 3LJAC 4H9NB 3W99D 3UTAA 1M1AB 3AZKD 5JRGB 3MGPA 3O62A 3UT9A 1P3GA 3REIB 2IO5B 5GT0B 5AV8A 3UTAC 4ZUXB 3REHB 4LD9A 4KUDB 3AZFB 2RVQD 3VH5W 3AZLD 1P3MD 1P3BA 5B1LA 1P3LA 1ZLAA 3O62C 3UT9C 1P3GC 3B0DC 4WU9A 5AV8C 1F66D 3FDDA 1KX4D 5DNNB 4LD9C 4X23A 4UUZB 1P3BC 5B1LC 4XUJD 1P3LC 3W99A 4WU9C 5B32D 5B31G 3MGSD 3AZKA 3WTPB 4WJ3C 1P3AB 4DRBA 5AV9D 4CAYB 3W99C 5B2JD 4XZQB 3AZKC 3AZLA 1P3MA 4EO5C 3MNNB 2Y2KA 1U35B 4JJNB 1KX3B 1F66A 3AZEB 3KUYB 4H9SC 1P34B 1KX4A 2NZDB 2RVQC 3AZLC 1P3MC 2CV5C 1P3KD 4XUJA 2XD1A 1F66C 5B32A 3NQUA 3MGSA 5BNXB 1KX4C 3B6FD 4WU8D 5AV9A 2Y2MA 5C3IC 4XUJC 2CWEA 1KU5A 4ZBJC 5E5AD 5B32C 2NQBB 3MGSC 3X1UD 1ID3D 3MGRB 1TZYD 4DQYB 5AV9C 2Y2QA 3MVDA 1M18D 5B2JC 1P3PB 3EPHA 1P3KA 3MGQB 3AZJB 3AYWB 5GXQD 3B6FA 3B0CT 4WU8A 3C1BD 5FUGA 4M6BA 1EQZB 4H9PA 3W98B 4J8WD 5BO0A 1ID3A 3X1UA 3C1CB 2PYOB 5CPKD 1TZYA 3B6FC 4CSRB 3UTBD 5B33B 4WU8C 3LZ0B 3WKJD 5E5AC 5B1MB 1ID3C 4HGAB 3X1UC 3W97D 1TZYC 3AN2D 3EPLA 1M18C 4J8VD 4G91C 5GXQA 4H9RA 5BS7A 3C1BA 4Z5TB 1P3ID 3LJAB 4WNNB 3AZHB 5CPID 1JFIA 5GXQC 5CPKA 3UTBA 5BS7C 3C1BC 3KSYA 1H3OA 3WKJA 4Z66D 3AZNC 4J8WC 3H0RC 5AY8D 3B0BA 3W97A 5AV5D 5CPKC 5AV6B 4YM6D 3UTBC 3TU4D 3AN2A 5CPJB 2F8NB 3MGPB 3WKJC
chains in the Genus database with same CATH topology
3LELB 5AV8B 3W97C 1S32D 5B2IB 3AN2C 1BFMA 3REKB 1P3IA 4J8VC 5CPIA 1ZLAB 2Y2PA 4J8UD 1ULYA 3A6ND 4KGCD 2L5AA 3VH6W 4Z66A 4R8PD 3X1VD 1BH9A 1P3IC 4X23B 5AY8A 5CPIC 5AV5A 1N1JB 2HUEC 3R45A 4YM6A 3TU4A 3A1KA 4Z66C 5F99D 4G92C 5AY8C 3AZGD 5CP6D 5AVBD 1S32A 5AV5C 4J8XB 2J8PA 1Z2CB 4YM6C 3TU4C 3W96D 3AFAD 3AZID 4YS3D 5B0YD 1P3FD 4H9QA 3RELD 5KDMA 5B0ZD 4J8UA 1S32C 5B31B 3A6NA 4KGCA 2ZY3A 3AL0C 5CHLB 5JA4A 2BYKA 4R8PA 3X1VA 2CV5D 1R4VA 4XUJB 3LZ1D 2FJ7B 3NQUB 4J8UC 3A6NC 4KGCC 3REJB 5F99A 4R8PC 3X1VC 3AZGA 1TAFA 5CP6A 5AVBA 3W96A 5B40D 5B24D 3H0LC 3AFAA 3AZIA 4YS3A 5F99C 5B0YA 1P3FA 3KXBB 4H9OB 3MVDB 3AZGC 4H9SA 5CP6C 3NQJA 5AVBC 5B32G 3RELA 5B0ZA 3W96C 3AZMB 2CV5A 3AFAC 3AZIC 4YS3C 3X1TC 5B0YC 3LZ1A 1P3KB 1P3FC 4AWLC 5GSUD 4ZUXD 3REHD 4KUDD 3RELC 3AZFD 5B0ZC 3WTPE 1Q9CA 1HQ3D 5FUGB 3KFUG 2HIOB 3VH5T 3LZ1C 5DNND 5B40A 5B24A 3X1UB 1TZYB 4H9NA 4Z2MH 5B2JA 4G91B 1BH8B 2YFVB 3WTPD 2Y2GA 5DNMB 1P3OC 5BNVA 5B40C 1P3AD 5B24C 1WWSA 5GSUA 4ZUXA 3REHA 3AZFA 2ZY5A 5GXQB 1AOIB 3AV2D 5GT3D 3WA9B 3REIC 2Y2HA 1HQ3A 2IO5C 3AZED 5GSUC 4ZUXC 3REHC 3KWQD 1P34D 4KUDC 2NZDD 3AZFC 2W8SA 5BT1D 3AV1B 3UTBB 5AVCD 1HQ3C 1H3OB 3AZND 5E5AA 3WTPA 5DNNC 4NFTA 1M18A 4CAYA 2NQBD 2ZY2A 3WTPC 2G5IC 3MGRD 3B6GB 3AV2A 5GT3A 1P3AC 1KX5B 3AZEA 4XZQC 3EG5B 3A1IA 4UPKA 3KWQA 2NZDA 1P3PD 3AV2C 5GT3C 3MNNC 5AVCA 3MGQD 3AZEC 3AZJD 3AZNA 4J8WA 4QLCB 3V9RB 3AYWD 1P34C 1HTAA 1BH9B 3KWQC 2NZDC 2BYMB 1EQZD 5AV5B 5BT1C 4KHAB 2AROD 4YM6B 5AVCC 2NQBA 3C1CD 3MGRA 2PYOD 5B33D 3UTAB 2DF4C 2Y2IA 4J8VA 2NQBC 5B1MD 3O62B 3UT9B 3MGRC 3B0DB 1P3GB 2JE5A 1P3PA 3MGQA 2DQNC 4H9QB 4LD9B 3AZJA 2VQRA 3AYWA 2BYKB 4R8PB 1P3BB 2FFFB 5B1LB 1P3LB 4NE5A 4WU9B 1P3PC 1EQZA 2AROA 4Z5TD 3MGQC 2YFWA 3AZJC 3AZHD 3C1CA 3AYWC 2PYOA 4CSRA 3W99B 5B33A 1TAFB 1EQZC 2AROC 3AZKB 4EO5B 5B1MA 4NE3A 3C1CC 2PYOC 5AV6D 5B33C 3NQJB 3WAAD 3VH5A 5CPJD 2F8ND 3MGPD 3AZLB 1P3MB 3LELD 2CV5B 3X1TD 5B1MC 4HGAC 1F66B 5B2ID 1M19D 4Z5TA 3REKD 2JSSA 1KX4B 4WNNA 3AZHA 5C3IB 4WZSB 2Y2JA 2Y2OA 4ZBJB 5B32B 3EPJA 4Z5TC 4E45A 3X1SD 3MGSB 2F2AC 3AZHC 5AV9B 1W2EA 3VH6T 5AV6A 5B2JB 3WAAA 1P3OD 2F8NH 5CPJA 4NE6A 2F8NA 5BNVB 3LELA 1PZRA 3X1TA 5G49A 5B2IA 4J8XD 1M19A 1M1AD 5AV6C 5GSUB 5JRGD 3REKA 3WAAC 5CPJC 3MGPC 3REID 5GT0D 3LELC 4Z2MG 1HQ3B 5B2IC 1M19C 5B31D 3X1SA 3REKC 2F8NK 3B6FB 4WU8B 4H9PB 1ZLAC 1N1JA 2ZY4A 2FJ7D 1P3OA 5E5AB 1T3UA 3P5JB 5BO0B 3X1SC 3REJD 4E44A 1ID3B 4X23C 1M18B 4J8XA 1M1AA 5JRGA 3AV2B 5GT3B 3REIA 5GT0A 2BG1A 3KXBD 3EPKA 3MVDD 4XZQD 3B0CW 4J8XC 1WWIA 1M1AC 5B31A 4KUDA 5JRGC 3KWQB 3AZMD 4H9RB 3MNND 1B67A 1U35D 4WV4B 4JJND 1KX3D 3C1BB 5GT0C 5AVCB 3KUYD 2FJ7A 2G5HC 3AZNB 5DNNA 4J8WB 5B31C 1JFIB 3REJA 5CPKB 4UUZA 2LY8A 2HIOD 2FJ7C 3WKJB 3IP4C 1P3AA 3W97B 1A7WA 3REJC 3KXBA 4H9OA 3AN2B 4XZQA 4J8VB 5DNMD 3AZMA 1F1EA 3MNNA 1U35A 4JJNA 1KX3A 3KXBC 3KUYA 3MVDC 1P34A 1P3IB 1AOID 5CPIB 3WA9D 3AZMC 2HUEB 1U35C 4JJNC 1KX3C 2AROB 2HIOA 1P3KC 3KUYC 3F6TA 2ZM5A 2RIQA 2YFWB 5BNXA 4Z66B 4G92B 5AY8B 3AV1D 3R45B 3TU4B 3W98D 1BH8A 2HIOC 2YFVA 1B6WA 5DNMA 3LZ0D 1S32B 2XD5A 4DRAA 3B6GD 1AOIA 5DNMC 1KX5D 3WA9A 2UWXA 3VH6A 5KDMB 4J8UB 3A6NB 4KGCB 5JA4B 3X1VB 2JCHA 1AOIC 3AV1A 3WA9C 3W98A 3LJAD 4QLCD 5F99B 3AZGB 5CP6B 5AVBB 3LZ0A 3AV1C 3WAAB 3W98C 3W96B 3B6GA 3AFAB 3AZIB 4YS3B 3X1TB 5B0YB 1P3FB 3UTAD 1KX5A 4AWLB 5G49B 1M19B 3LZ0C 3RELB 2Y2NA 5B0ZB 3O62D 3UT9D 1P3GD 3B6GC 5AV8D 3LZ1B 1KX5C 4LD9D 3LJAA 4QLCA 3V9RA 3X1SB 2F8NG 1P3BD 5B1LD 1P3LD 1ZLAD 2BYMA 4WU9D 4KHAA 2Y2LA 1P3OB 5B40B 3H0MC 5B24B 4QLCC 4X23D 3LJAC 4H9NB 3W99D 3UTAA 1M1AB 3AZKD 5JRGB 3MGPA 3O62A 3UT9A 1P3GA 3REIB 2IO5B 5GT0B 5AV8A 3UTAC 4ZUXB 3REHB 4LD9A 4KUDB 3AZFB 2RVQD 3VH5W 3AZLD 1P3MD 1P3BA 5B1LA 1P3LA 1ZLAA 3O62C 3UT9C 1P3GC 3B0DC 4WU9A 5AV8C 1F66D 3FDDA 1KX4D 5DNNB 4LD9C 4X23A 4UUZB 1P3BC 5B1LC 4XUJD 1P3LC 3W99A 4WU9C 5B32D 5B31G 3MGSD 3AZKA 3WTPB 4WJ3C 1P3AB 4DRBA 5AV9D 4CAYB 3W99C 5B2JD 4XZQB 3AZKC 3AZLA 1P3MA 4EO5C 3MNNB 2Y2KA 1U35B 4JJNB 1KX3B 1F66A 3AZEB 3KUYB 4H9SC 1P34B 1KX4A 2NZDB 2RVQC 3AZLC 1P3MC 2CV5C 1P3KD 4XUJA 2XD1A 1F66C 5B32A 3NQUA 3MGSA 5BNXB 1KX4C 3B6FD 4WU8D 5AV9A 2Y2MA 5C3IC 4XUJC 2CWEA 1KU5A 4ZBJC 5E5AD 5B32C 2NQBB 3MGSC 3X1UD 1ID3D 3MGRB 1TZYD 4DQYB 5AV9C 2Y2QA 3MVDA 1M18D 5B2JC 1P3PB 3EPHA 1P3KA 3MGQB 3AZJB 3AYWB 5GXQD 3B6FA 3B0CT 4WU8A 3C1BD 5FUGA 4M6BA 1EQZB 4H9PA 3W98B 4J8WD 5BO0A 1ID3A 3X1UA 3C1CB 2PYOB 5CPKD 1TZYA 3B6FC 4CSRB 3UTBD 5B33B 4WU8C 3LZ0B 3WKJD 5E5AC 5B1MB 1ID3C 4HGAB 3X1UC 3W97D 1TZYC 3AN2D 3EPLA 1M18C 4J8VD 4G91C 5GXQA 4H9RA 5BS7A 3C1BA 4Z5TB 1P3ID 3LJAB 4WNNB 3AZHB 5CPID 1JFIA 5GXQC 5CPKA 3UTBA 5BS7C 3C1BC 3KSYA 1H3OA 3WKJA 4Z66D 3AZNC 4J8WC 3H0RC 5AY8D 3B0BA 3W97A 5AV5D 5CPKC 5AV6B 4YM6D 3UTBC 3TU4D 3AN2A 5CPJB 2F8NB 3MGPB 3WKJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL B;  5AV8 B;  3W97 C;  1S32 D;  5B2I B;  3AN2 C;  1BFM A;  3REK B;  1P3I A;  4J8V C;  5CPI A;  1ZLA B;  4J8U D;  1ULY A;  3A6N D;  4KGC D;  2L5A A;  3VH6 W;  4Z66 A;  4R8P D;  3X1V D;  1BH9 A;  1P3I C;  4X23 B;  5AY8 A;  5CPI C;  5AV5 A;  1N1J B;  3R45 A;  2HUE C;  4YM6 A;  3TU4 A;  4Z66 C;  5F99 D;  4G92 C;  5AY8 C;  3AZG D;  5CP6 D;  5AVB D;  1S32 A;  5AV5 C;  4J8X B;  4YM6 C;  3TU4 C;  3W96 D;  3AFA D;  3AZI D;  4YS3 D;  5B0Y D;  1P3F D;  4H9Q A;  3REL D;  5KDM A;  5B0Z D;  4J8U A;  1S32 C;  5B31 B;  3A6N A;  4KGC A;  5CHL B;  5JA4 A;  2BYK A;  4R8P A;  3X1V A;  2CV5 D;  1R4V A;  4XUJ B;  3LZ1 D;  2FJ7 B;  3NQU B;  4J8U C;  3A6N C;  4KGC C;  3REJ B;  5F99 A;  4R8P C;  3X1V C;  3AZG A;  1TAF A;  5CP6 A;  5AVB A;  3W96 A;  5B40 D;  5B24 D;  3AFA A;  3AZI A;  4YS3 A;  5F99 C;  5B0Y A;  1P3F A;  3KXB B;  4H9O B;  3MVD B;  3AZG C;  4H9S A;  5CP6 C;  3NQJ A;  5AVB C;  5B32 G;  3REL A;  5B0Z A;  3W96 C;  3AZM B;  2CV5 A;  3AFA C;  3AZI C;  4YS3 C;  3X1T C;  5B0Y C;  3LZ1 A;  1P3K B;  1P3F C;  4AWL C;  5GSU D;  4ZUX D;  3REH D;  4KUD D;  3REL C;  3AZF D;  5B0Z C;  3WTP E;  1Q9C A;  1HQ3 D;  5FUG B;  2HIO B;  3VH5 T;  3LZ1 C;  5DNN D;  5B40 A;  5B24 A;  3X1U B;  1TZY B;  4H9N A;  4Z2M H;  5B2J A;  4G91 B;  1BH8 B;  2YFV B;  3WTP D;  5DNM B;  1P3O C;  5BNV A;  5B40 C;  1P3A D;  5B24 C;  1WWS A;  5GSU A;  4ZUX A;  3REH A;  3AZF A;  5GXQ B;  1AOI B;  3AV2 D;  5GT3 D;  3WA9 B;  3REI C;  1HQ3 A;  2IO5 C;  3AZE D;  5GSU C;  4ZUX C;  3REH C;  3KWQ D;  1P34 D;  4KUD C;  2NZD D;  3AZF C;  5BT1 D;  3AV1 B;  3UTB B;  5AVC D;  1HQ3 C;  1H3O B;  3AZN D;  5E5A A;  3WTP A;  5DNN C;  4NFT A;  1M18 A;  4CAY A;  2NQB D;  3WTP C;  3MGR D;  3B6G B;  3AV2 A;  5GT3 A;  1P3A C;  1KX5 B;  3AZE A;  4XZQ C;  3KWQ A;  2NZD A;  1P3P D;  3AV2 C;  5GT3 C;  3MNN C;  5AVC A;  3MGQ D;  3AZE C;  3AZJ D;  3AZN A;  4J8W A;  4QLC B;  3V9R B;  3AYW D;  1P34 C;  1HTA A;  1BH9 B;  3KWQ C;  2NZD C;  2BYM B;  1EQZ D;  5AV5 B;  5BT1 C;  4KHA B;  2ARO D;  4YM6 B;  5AVC C;  2NQB A;  3C1C D;  3MGR A;  2PYO D;  5B33 D;  3UTA B;  4J8V A;  2NQB C;  5B1M D;  3O62 B;  3UT9 B;  3MGR C;  3B0D B;  1P3G B;  1P3P A;  3MGQ A;  4H9Q B;  4LD9 B;  3AZJ A;  3AYW A;  2BYK B;  4R8P B;  1P3B B;  5B1L B;  1P3L B;  4NE5 A;  4WU9 B;  1P3P C;  1EQZ A;  2ARO A;  4Z5T D;  3MGQ C;  2YFW A;  3AZJ C;  3AZH D;  3C1C A;  3AYW C;  2PYO A;  4CSR A;  3W99 B;  5B33 A;  1TAF B;  1EQZ C;  2ARO C;  3AZK B;  4EO5 B;  5B1M A;  4NE3 A;  3C1C C;  2PYO C;  5AV6 D;  5B33 C;  3NQJ B;  3WAA D;  3VH5 A;  5CPJ D;  2F8N D;  3MGP D;  3AZL B;  1P3M B;  3LEL D;  2CV5 B;  3X1T D;  5B1M C;  4HGA C;  1F66 B;  5B2I D;  1M19 D;  4Z5T A;  3REK D;  2JSS A;  1KX4 B;  4WNN A;  3AZH A;  5C3I B;  4WZS B;  4ZBJ B;  5B32 B;  4Z5T C;  4E45 A;  3X1S D;  3MGS B;  3AZH C;  5AV9 B;  3VH6 T;  5AV6 A;  5B2J B;  3WAA A;  1P3O D;  2F8N H;  5CPJ A;  4NE6 A;  2F8N A;  5BNV B;  3LEL A;  3X1T A;  5G49 A;  5B2I A;  4J8X D;  1M19 A;  1M1A D;  5AV6 C;  5GSU B;  5JRG D;  3REK A;  3WAA C;  5CPJ C;  3MGP C;  3REI D;  5GT0 D;  3LEL C;  4Z2M G;  1HQ3 B;  5B2I C;  1M19 C;  5B31 D;  3X1S A;  3REK C;  2F8N K;  3B6F B;  4WU8 B;  4H9P B;  1ZLA C;  1N1J A;  2FJ7 D;  1P3O A;  5E5A B;  5BO0 B;  1ID3 B;  3X1S C;  3REJ D;  4E44 A;  4X23 C;  1M18 B;  4J8X A;  1M1A A;  5JRG A;  3AV2 B;  5GT3 B;  3REI A;  5GT0 A;  3KXB D;  3MVD D;  4XZQ D;  3B0C W;  4J8X C;  1WWI A;  1M1A C;  5B31 A;  4KUD A;  5JRG C;  3KWQ B;  3AZM D;  4H9R B;  3MNN D;  1B67 A;  1U35 D;  4WV4 B;  4JJN D;  1KX3 D;  3C1B B;  5GT0 C;  5AVC B;  3KUY D;  2FJ7 A;  3AZN B;  5DNN A;  4J8W B;  5B31 C;  1JFI B;  3REJ A;  5CPK B;  4UUZ A;  2LY8 A;  2HIO D;  2FJ7 C;  3WKJ B;  1P3A A;  3W97 B;  1A7W A;  3REJ C;  3KXB A;  4H9O A;  3AN2 B;  4XZQ A;  4J8V B;  5DNM D;  3AZM A;  1F1E A;  3MNN A;  1U35 A;  4JJN A;  1KX3 A;  3KXB C;  3KUY A;  3MVD C;  1P34 A;  1P3I B;  1AOI D;  5CPI B;  3WA9 D;  3AZM C;  2HUE B;  1U35 C;  4JJN C;  1KX3 C;  2ARO B;  2HIO A;  1P3K C;  3KUY C;  2YFW B;  4Z66 B;  5BNX A;  4G92 B;  5AY8 B;  3AV1 D;  3R45 B;  3TU4 B;  3W98 D;  1BH8 A;  2HIO C;  2YFV A;  1B6W A;  5DNM A;  3LZ0 D;  1S32 B;  4DRA A;  3B6G D;  1AOI A;  5DNM C;  1KX5 D;  3WA9 A;  3VH6 A;  5KDM B;  4J8U B;  3A6N B;  4KGC B;  5JA4 B;  3X1V B;  1AOI C;  3AV1 A;  3WA9 C;  3W98 A;  3LJA D;  4QLC D;  5F99 B;  3AZG B;  5CP6 B;  5AVB B;  3LZ0 A;  3AV1 C;  3WAA B;  3W98 C;  3W96 B;  3B6G A;  3AFA B;  3AZI B;  4YS3 B;  3X1T B;  5B0Y B;  1P3F B;  3UTA D;  1KX5 A;  4AWL B;  5G49 B;  1M19 B;  3LZ0 C;  3REL B;  5B0Z B;  3O62 D;  3UT9 D;  1P3G D;  3B6G C;  5AV8 D;  3LZ1 B;  1KX5 C;  4LD9 D;  3LJA A;  4QLC A;  3V9R A;  3X1S B;  2F8N G;  1P3B D;  5B1L D;  1P3L D;  1ZLA D;  2BYM A;  4WU9 D;  4KHA A;  1P3O B;  5B40 B;  5B24 B;  4QLC C;  4X23 D;  3LJA C;  4H9N B;  3W99 D;  3UTA A;  1M1A B;  3AZK D;  5JRG B;  3MGP A;  3O62 A;  3UT9 A;  1P3G A;  3REI B;  2IO5 B;  5GT0 B;  5AV8 A;  3UTA C;  4ZUX B;  3REH B;  4LD9 A;  4KUD B;  3AZF B;  2RVQ D;  3VH5 W;  3AZL D;  1P3M D;  1P3B A;  5B1L A;  1P3L A;  1ZLA A;  3O62 C;  3UT9 C;  1P3G C;  3B0D C;  4WU9 A;  5AV8 C;  1F66 D;  1KX4 D;  5DNN B;  4LD9 C;  4X23 A;  4UUZ B;  1P3B C;  5B1L C;  4XUJ D;  1P3L C;  3W99 A;  4WU9 C;  5B32 D;  5B31 G;  3MGS D;  3AZK A;  3WTP B;  1P3A B;  4DRB A;  5AV9 D;  4CAY B;  3W99 C;  5B2J D;  4XZQ B;  3AZK C;  3AZL A;  1P3M A;  4EO5 C;  3MNN B;  1U35 B;  4JJN B;  1KX3 B;  1F66 A;  3AZE B;  3KUY B;  4H9S C;  1P34 B;  1KX4 A;  2NZD B;  2RVQ C;  3AZL C;  1P3M C;  2CV5 C;  1P3K D;  4XUJ A;  1F66 C;  5B32 A;  3NQU A;  3MGS A;  5BNX B;  1KX4 C;  3B6F D;  4WU8 D;  5AV9 A;  5C3I C;  4XUJ C;  2CWE A;  1KU5 A;  4ZBJ C;  5E5A D;  5B32 C;  2NQB B;  3MGS C;  3X1U D;  1ID3 D;  3MGR B;  1TZY D;  5AV9 C;  1M18 D;  3MVD A;  5B2J C;  1P3P B;  1P3K A;  3MGQ B;  3AZJ B;  3AYW B;  5GXQ D;  3B6F A;  3B0C T;  4WU8 A;  3C1B D;  5FUG A;  4M6B A;  1EQZ B;  4H9P A;  3W98 B;  4J8W D;  5BO0 A;  1ID3 A;  3X1U A;  3C1C B;  2PYO B;  5CPK D;  1TZY A;  3B6F C;  4CSR B;  3UTB D;  5B33 B;  4WU8 C;  3LZ0 B;  3WKJ D;  5E5A C;  5B1M B;  1ID3 C;  4HGA B;  3X1U C;  3W97 D;  1TZY C;  3AN2 D;  1M18 C;  4J8V D;  4G91 C;  5GXQ A;  4H9R A;  5BS7 A;  3C1B A;  4Z5T B;  1P3I D;  3LJA B;  4WNN B;  3AZH B;  5CPI D;  1JFI A;  5GXQ C;  5CPK A;  3UTB A;  5BS7 C;  3C1B C;  3KSY A;  1H3O A;  3WKJ A;  4Z66 D;  3AZN C;  4J8W C;  5AY8 D;  3B0B A;  3W97 A;  5AV5 D;  5CPK C;  5AV6 B;  4YM6 D;  3UTB C;  3TU4 D;  3AN2 A;  5CPJ B;  2F8N B;  3MGP B;  3WKJ C; 
#chains in the Genus database with same CATH topology
 3LEL B;  5AV8 B;  3W97 C;  1S32 D;  5B2I B;  3AN2 C;  1BFM A;  3REK B;  1P3I A;  4J8V C;  5CPI A;  1ZLA B;  2Y2P A;  4J8U D;  1ULY A;  3A6N D;  4KGC D;  2L5A A;  3VH6 W;  4Z66 A;  4R8P D;  3X1V D;  1BH9 A;  1P3I C;  4X23 B;  5AY8 A;  5CPI C;  5AV5 A;  1N1J B;  2HUE C;  3R45 A;  4YM6 A;  3TU4 A;  3A1K A;  4Z66 C;  5F99 D;  4G92 C;  5AY8 C;  3AZG D;  5CP6 D;  5AVB D;  1S32 A;  5AV5 C;  4J8X B;  2J8P A;  1Z2C B;  4YM6 C;  3TU4 C;  3W96 D;  3AFA D;  3AZI D;  4YS3 D;  5B0Y D;  1P3F D;  4H9Q A;  3REL D;  5KDM A;  5B0Z D;  4J8U A;  1S32 C;  5B31 B;  3A6N A;  4KGC A;  2ZY3 A;  3AL0 C;  5CHL B;  5JA4 A;  2BYK A;  4R8P A;  3X1V A;  2CV5 D;  1R4V A;  4XUJ B;  3LZ1 D;  2FJ7 B;  3NQU B;  4J8U C;  3A6N C;  4KGC C;  3REJ B;  5F99 A;  4R8P C;  3X1V C;  3AZG A;  1TAF A;  5CP6 A;  5AVB A;  3W96 A;  5B40 D;  5B24 D;  3H0L C;  3AFA A;  3AZI A;  4YS3 A;  5F99 C;  5B0Y A;  1P3F A;  3KXB B;  4H9O B;  3MVD B;  3AZG C;  4H9S A;  5CP6 C;  3NQJ A;  5AVB C;  5B32 G;  3REL A;  5B0Z A;  3W96 C;  3AZM B;  2CV5 A;  3AFA C;  3AZI C;  4YS3 C;  3X1T C;  5B0Y C;  3LZ1 A;  1P3K B;  1P3F C;  4AWL C;  5GSU D;  4ZUX D;  3REH D;  4KUD D;  3REL C;  3AZF D;  5B0Z C;  3WTP E;  1Q9C A;  1HQ3 D;  5FUG B;  3KFU G;  2HIO B;  3VH5 T;  3LZ1 C;  5DNN D;  5B40 A;  5B24 A;  3X1U B;  1TZY B;  4H9N A;  4Z2M H;  5B2J A;  4G91 B;  1BH8 B;  2YFV B;  3WTP D;  2Y2G A;  5DNM B;  1P3O C;  5BNV A;  5B40 C;  1P3A D;  5B24 C;  1WWS A;  5GSU A;  4ZUX A;  3REH A;  3AZF A;  2ZY5 A;  5GXQ B;  1AOI B;  3AV2 D;  5GT3 D;  3WA9 B;  3REI C;  2Y2H A;  1HQ3 A;  2IO5 C;  3AZE D;  5GSU C;  4ZUX C;  3REH C;  3KWQ D;  1P34 D;  4KUD C;  2NZD D;  3AZF C;  2W8S A;  5BT1 D;  3AV1 B;  3UTB B;  5AVC D;  1HQ3 C;  1H3O B;  3AZN D;  5E5A A;  3WTP A;  5DNN C;  4NFT A;  1M18 A;  4CAY A;  2NQB D;  2ZY2 A;  3WTP C;  2G5I C;  3MGR D;  3B6G B;  3AV2 A;  5GT3 A;  1P3A C;  1KX5 B;  3AZE A;  4XZQ C;  3EG5 B;  3A1I A;  4UPK A;  3KWQ A;  2NZD A;  1P3P D;  3AV2 C;  5GT3 C;  3MNN C;  5AVC A;  3MGQ D;  3AZE C;  3AZJ D;  3AZN A;  4J8W A;  4QLC B;  3V9R B;  3AYW D;  1P34 C;  1HTA A;  1BH9 B;  3KWQ C;  2NZD C;  2BYM B;  1EQZ D;  5AV5 B;  5BT1 C;  4KHA B;  2ARO D;  4YM6 B;  5AVC C;  2NQB A;  3C1C D;  3MGR A;  2PYO D;  5B33 D;  3UTA B;  2DF4 C;  2Y2I A;  4J8V A;  2NQB C;  5B1M D;  3O62 B;  3UT9 B;  3MGR C;  3B0D B;  1P3G B;  2JE5 A;  1P3P A;  3MGQ A;  2DQN C;  4H9Q B;  4LD9 B;  3AZJ A;  2VQR A;  3AYW A;  2BYK B;  4R8P B;  1P3B B;  2FFF B;  5B1L B;  1P3L B;  4NE5 A;  4WU9 B;  1P3P C;  1EQZ A;  2ARO A;  4Z5T D;  3MGQ C;  2YFW A;  3AZJ C;  3AZH D;  3C1C A;  3AYW C;  2PYO A;  4CSR A;  3W99 B;  5B33 A;  1TAF B;  1EQZ C;  2ARO C;  3AZK B;  4EO5 B;  5B1M A;  4NE3 A;  3C1C C;  2PYO C;  5AV6 D;  5B33 C;  3NQJ B;  3WAA D;  3VH5 A;  5CPJ D;  2F8N D;  3MGP D;  3AZL B;  1P3M B;  3LEL D;  2CV5 B;  3X1T D;  5B1M C;  4HGA C;  1F66 B;  5B2I D;  1M19 D;  4Z5T A;  3REK D;  2JSS A;  1KX4 B;  4WNN A;  3AZH A;  5C3I B;  4WZS B;  2Y2J A;  2Y2O A;  4ZBJ B;  5B32 B;  3EPJ A;  4Z5T C;  4E45 A;  3X1S D;  3MGS B;  2F2A C;  3AZH C;  5AV9 B;  1W2E A;  3VH6 T;  5AV6 A;  5B2J B;  3WAA A;  1P3O D;  2F8N H;  5CPJ A;  4NE6 A;  2F8N A;  5BNV B;  3LEL A;  1PZR A;  3X1T A;  5G49 A;  5B2I A;  4J8X D;  1M19 A;  1M1A D;  5AV6 C;  5GSU B;  5JRG D;  3REK A;  3WAA C;  5CPJ C;  3MGP C;  3REI D;  5GT0 D;  3LEL C;  4Z2M G;  1HQ3 B;  5B2I C;  1M19 C;  5B31 D;  3X1S A;  3REK C;  2F8N K;  3B6F B;  4WU8 B;  4H9P B;  1ZLA C;  1N1J A;  2ZY4 A;  2FJ7 D;  1P3O A;  5E5A B;  1T3U A;  3P5J B;  5BO0 B;  3X1S C;  3REJ D;  4E44 A;  1ID3 B;  4X23 C;  1M18 B;  4J8X A;  1M1A A;  5JRG A;  3AV2 B;  5GT3 B;  3REI A;  5GT0 A;  2BG1 A;  3KXB D;  3EPK A;  3MVD D;  4XZQ D;  3B0C W;  4J8X C;  1WWI A;  1M1A C;  5B31 A;  4KUD A;  5JRG C;  3KWQ B;  3AZM D;  4H9R B;  3MNN D;  1B67 A;  1U35 D;  4WV4 B;  4JJN D;  1KX3 D;  3C1B B;  5GT0 C;  5AVC B;  3KUY D;  2FJ7 A;  2G5H C;  3AZN B;  5DNN A;  4J8W B;  5B31 C;  1JFI B;  3REJ A;  5CPK B;  4UUZ A;  2LY8 A;  2HIO D;  2FJ7 C;  3WKJ B;  3IP4 C;  1P3A A;  3W97 B;  1A7W A;  3REJ C;  3KXB A;  4H9O A;  3AN2 B;  4XZQ A;  4J8V B;  5DNM D;  3AZM A;  1F1E A;  3MNN A;  1U35 A;  4JJN A;  1KX3 A;  3KXB C;  3KUY A;  3MVD C;  1P34 A;  1P3I B;  1AOI D;  5CPI B;  3WA9 D;  3AZM C;  2HUE B;  1U35 C;  4JJN C;  1KX3 C;  2ARO B;  2HIO A;  1P3K C;  3KUY C;  3F6T A;  2ZM5 A;  2RIQ A;  2YFW B;  5BNX A;  4Z66 B;  4G92 B;  5AY8 B;  3AV1 D;  3R45 B;  3TU4 B;  3W98 D;  1BH8 A;  2HIO C;  2YFV A;  1B6W A;  5DNM A;  3LZ0 D;  1S32 B;  2XD5 A;  4DRA A;  3B6G D;  1AOI A;  5DNM C;  1KX5 D;  3WA9 A;  2UWX A;  3VH6 A;  5KDM B;  4J8U B;  3A6N B;  4KGC B;  5JA4 B;  3X1V B;  2JCH A;  1AOI C;  3AV1 A;  3WA9 C;  3W98 A;  3LJA D;  4QLC D;  5F99 B;  3AZG B;  5CP6 B;  5AVB B;  3LZ0 A;  3AV1 C;  3WAA B;  3W98 C;  3W96 B;  3B6G A;  3AFA B;  3AZI B;  4YS3 B;  3X1T B;  5B0Y B;  1P3F B;  3UTA D;  1KX5 A;  4AWL B;  5G49 B;  1M19 B;  3LZ0 C;  3REL B;  2Y2N A;  5B0Z B;  3O62 D;  3UT9 D;  1P3G D;  3B6G C;  5AV8 D;  3LZ1 B;  1KX5 C;  4LD9 D;  3LJA A;  4QLC A;  3V9R A;  3X1S B;  2F8N G;  1P3B D;  5B1L D;  1P3L D;  1ZLA D;  2BYM A;  4WU9 D;  4KHA A;  2Y2L A;  1P3O B;  5B40 B;  3H0M C;  5B24 B;  4QLC C;  4X23 D;  3LJA C;  4H9N B;  3W99 D;  3UTA A;  1M1A B;  3AZK D;  5JRG B;  3MGP A;  3O62 A;  3UT9 A;  1P3G A;  3REI B;  2IO5 B;  5GT0 B;  5AV8 A;  3UTA C;  4ZUX B;  3REH B;  4LD9 A;  4KUD B;  3AZF B;  2RVQ D;  3VH5 W;  3AZL D;  1P3M D;  1P3B A;  5B1L A;  1P3L A;  1ZLA A;  3O62 C;  3UT9 C;  1P3G C;  3B0D C;  4WU9 A;  5AV8 C;  1F66 D;  3FDD A;  1KX4 D;  5DNN B;  4LD9 C;  4X23 A;  4UUZ B;  1P3B C;  5B1L C;  4XUJ D;  1P3L C;  3W99 A;  4WU9 C;  5B32 D;  5B31 G;  3MGS D;  3AZK A;  3WTP B;  4WJ3 C;  1P3A B;  4DRB A;  5AV9 D;  4CAY B;  3W99 C;  5B2J D;  4XZQ B;  3AZK C;  3AZL A;  1P3M A;  4EO5 C;  3MNN B;  2Y2K A;  1U35 B;  4JJN B;  1KX3 B;  1F66 A;  3AZE B;  3KUY B;  4H9S C;  1P34 B;  1KX4 A;  2NZD B;  2RVQ C;  3AZL C;  1P3M C;  2CV5 C;  1P3K D;  4XUJ A;  2XD1 A;  1F66 C;  5B32 A;  3NQU A;  3MGS A;  5BNX B;  1KX4 C;  3B6F D;  4WU8 D;  5AV9 A;  2Y2M A;  5C3I C;  4XUJ C;  2CWE A;  1KU5 A;  4ZBJ C;  5E5A D;  5B32 C;  2NQB B;  3MGS C;  3X1U D;  1ID3 D;  3MGR B;  1TZY D;  4DQY B;  5AV9 C;  2Y2Q A;  3MVD A;  1M18 D;  5B2J C;  1P3P B;  3EPH A;  1P3K A;  3MGQ B;  3AZJ B;  3AYW B;  5GXQ D;  3B6F A;  3B0C T;  4WU8 A;  3C1B D;  5FUG A;  4M6B A;  1EQZ B;  4H9P A;  3W98 B;  4J8W D;  5BO0 A;  1ID3 A;  3X1U A;  3C1C B;  2PYO B;  5CPK D;  1TZY A;  3B6F C;  4CSR B;  3UTB D;  5B33 B;  4WU8 C;  3LZ0 B;  3WKJ D;  5E5A C;  5B1M B;  1ID3 C;  4HGA B;  3X1U C;  3W97 D;  1TZY C;  3AN2 D;  3EPL A;  1M18 C;  4J8V D;  4G91 C;  5GXQ A;  4H9R A;  5BS7 A;  3C1B A;  4Z5T B;  1P3I D;  3LJA B;  4WNN B;  3AZH B;  5CPI D;  1JFI A;  5GXQ C;  5CPK A;  3UTB A;  5BS7 C;  3C1B C;  3KSY A;  1H3O A;  3WKJ A;  4Z66 D;  3AZN C;  4J8W C;  3H0R C;  5AY8 D;  3B0B A;  3W97 A;  5AV5 D;  5CPK C;  5AV6 B;  4YM6 D;  3UTB C;  3TU4 D;  3AN2 A;  5CPJ B;  2F8N B;  3MGP B;  3WKJ C; 
#chains in the Genus database with same CATH homology
 3LEL B;  5AV8 B;  3W97 C;  1S32 D;  5B2I B;  3AN2 C;  1BFM A;  3REK B;  1P3I A;  4J8V C;  5CPI A;  1ZLA B;  2Y2P A;  4J8U D;  1ULY A;  3A6N D;  4KGC D;  2L5A A;  3VH6 W;  4Z66 A;  4R8P D;  3X1V D;  1BH9 A;  1P3I C;  4X23 B;  5AY8 A;  5CPI C;  5AV5 A;  1N1J B;  2HUE C;  3R45 A;  4YM6 A;  3TU4 A;  3A1K A;  4Z66 C;  5F99 D;  4G92 C;  5AY8 C;  3AZG D;  5CP6 D;  5AVB D;  1S32 A;  5AV5 C;  4J8X B;  2J8P A;  1Z2C B;  4YM6 C;  3TU4 C;  3W96 D;  3AFA D;  3AZI D;  4YS3 D;  5B0Y D;  1P3F D;  4H9Q A;  3REL D;  5KDM A;  5B0Z D;  4J8U A;  1S32 C;  5B31 B;  3A6N A;  4KGC A;  2ZY3 A;  3AL0 C;  5CHL B;  5JA4 A;  2BYK A;  4R8P A;  3X1V A;  2CV5 D;  1R4V A;  4XUJ B;  3LZ1 D;  2FJ7 B;  3NQU B;  4J8U C;  3A6N C;  4KGC C;  3REJ B;  5F99 A;  4R8P C;  3X1V C;  3AZG A;  1TAF A;  5CP6 A;  5AVB A;  3W96 A;  5B40 D;  5B24 D;  3H0L C;  3AFA A;  3AZI A;  4YS3 A;  5F99 C;  5B0Y A;  1P3F A;  3KXB B;  4H9O B;  3MVD B;  3AZG C;  4H9S A;  5CP6 C;  3NQJ A;  5AVB C;  5B32 G;  3REL A;  5B0Z A;  3W96 C;  3AZM B;  2CV5 A;  3AFA C;  3AZI C;  4YS3 C;  3X1T C;  5B0Y C;  3LZ1 A;  1P3K B;  1P3F C;  4AWL C;  5GSU D;  4ZUX D;  3REH D;  4KUD D;  3REL C;  3AZF D;  5B0Z C;  3WTP E;  1Q9C A;  1HQ3 D;  5FUG B;  3KFU G;  2HIO B;  3VH5 T;  3LZ1 C;  5DNN D;  5B40 A;  5B24 A;  3X1U B;  1TZY B;  4H9N A;  4Z2M H;  5B2J A;  4G91 B;  1BH8 B;  2YFV B;  3WTP D;  2Y2G A;  5DNM B;  1P3O C;  5BNV A;  5B40 C;  1P3A D;  5B24 C;  1WWS A;  5GSU A;  4ZUX A;  3REH A;  3AZF A;  2ZY5 A;  5GXQ B;  1AOI B;  3AV2 D;  5GT3 D;  3WA9 B;  3REI C;  2Y2H A;  1HQ3 A;  2IO5 C;  3AZE D;  5GSU C;  4ZUX C;  3REH C;  3KWQ D;  1P34 D;  4KUD C;  2NZD D;  3AZF C;  2W8S A;  5BT1 D;  3AV1 B;  3UTB B;  5AVC D;  1HQ3 C;  1H3O B;  3AZN D;  5E5A A;  3WTP A;  5DNN C;  4NFT A;  1M18 A;  4CAY A;  2NQB D;  2ZY2 A;  3WTP C;  2G5I C;  3MGR D;  3B6G B;  3AV2 A;  5GT3 A;  1P3A C;  1KX5 B;  3AZE A;  4XZQ C;  3EG5 B;  3A1I A;  4UPK A;  3KWQ A;  2NZD A;  1P3P D;  3AV2 C;  5GT3 C;  3MNN C;  5AVC A;  3MGQ D;  3AZE C;  3AZJ D;  3AZN A;  4J8W A;  4QLC B;  3V9R B;  3AYW D;  1P34 C;  1HTA A;  1BH9 B;  3KWQ C;  2NZD C;  2BYM B;  1EQZ D;  5AV5 B;  5BT1 C;  4KHA B;  2ARO D;  4YM6 B;  5AVC C;  2NQB A;  3C1C D;  3MGR A;  2PYO D;  5B33 D;  3UTA B;  2DF4 C;  2Y2I A;  4J8V A;  2NQB C;  5B1M D;  3O62 B;  3UT9 B;  3MGR C;  3B0D B;  1P3G B;  2JE5 A;  1P3P A;  3MGQ A;  2DQN C;  4H9Q B;  4LD9 B;  3AZJ A;  2VQR A;  3AYW A;  2BYK B;  4R8P B;  1P3B B;  2FFF B;  5B1L B;  1P3L B;  4NE5 A;  4WU9 B;  1P3P C;  1EQZ A;  2ARO A;  4Z5T D;  3MGQ C;  2YFW A;  3AZJ C;  3AZH D;  3C1C A;  3AYW C;  2PYO A;  4CSR A;  3W99 B;  5B33 A;  1TAF B;  1EQZ C;  2ARO C;  3AZK B;  4EO5 B;  5B1M A;  4NE3 A;  3C1C C;  2PYO C;  5AV6 D;  5B33 C;  3NQJ B;  3WAA D;  3VH5 A;  5CPJ D;  2F8N D;  3MGP D;  3AZL B;  1P3M B;  3LEL D;  2CV5 B;  3X1T D;  5B1M C;  4HGA C;  1F66 B;  5B2I D;  1M19 D;  4Z5T A;  3REK D;  2JSS A;  1KX4 B;  4WNN A;  3AZH A;  5C3I B;  4WZS B;  2Y2J A;  2Y2O A;  4ZBJ B;  5B32 B;  3EPJ A;  4Z5T C;  4E45 A;  3X1S D;  3MGS B;  2F2A C;  3AZH C;  5AV9 B;  1W2E A;  3VH6 T;  5AV6 A;  5B2J B;  3WAA A;  1P3O D;  2F8N H;  5CPJ A;  4NE6 A;  2F8N A;  5BNV B;  3LEL A;  1PZR A;  3X1T A;  5G49 A;  5B2I A;  4J8X D;  1M19 A;  1M1A D;  5AV6 C;  5GSU B;  5JRG D;  3REK A;  3WAA C;  5CPJ C;  3MGP C;  3REI D;  5GT0 D;  3LEL C;  4Z2M G;  1HQ3 B;  5B2I C;  1M19 C;  5B31 D;  3X1S A;  3REK C;  2F8N K;  3B6F B;  4WU8 B;  4H9P B;  1ZLA C;  1N1J A;  2ZY4 A;  2FJ7 D;  1P3O A;  5E5A B;  1T3U A;  3P5J B;  5BO0 B;  3X1S C;  3REJ D;  4E44 A;  1ID3 B;  4X23 C;  1M18 B;  4J8X A;  1M1A A;  5JRG A;  3AV2 B;  5GT3 B;  3REI A;  5GT0 A;  2BG1 A;  3KXB D;  3EPK A;  3MVD D;  4XZQ D;  3B0C W;  4J8X C;  1WWI A;  1M1A C;  5B31 A;  4KUD A;  5JRG C;  3KWQ B;  3AZM D;  4H9R B;  3MNN D;  1B67 A;  1U35 D;  4WV4 B;  4JJN D;  1KX3 D;  3C1B B;  5GT0 C;  5AVC B;  3KUY D;  2FJ7 A;  2G5H C;  3AZN B;  5DNN A;  4J8W B;  5B31 C;  1JFI B;  3REJ A;  5CPK B;  4UUZ A;  2LY8 A;  2HIO D;  2FJ7 C;  3WKJ B;  3IP4 C;  1P3A A;  3W97 B;  1A7W A;  3REJ C;  3KXB A;  4H9O A;  3AN2 B;  4XZQ A;  4J8V B;  5DNM D;  3AZM A;  1F1E A;  3MNN A;  1U35 A;  4JJN A;  1KX3 A;  3KXB C;  3KUY A;  3MVD C;  1P34 A;  1P3I B;  1AOI D;  5CPI B;  3WA9 D;  3AZM C;  2HUE B;  1U35 C;  4JJN C;  1KX3 C;  2ARO B;  2HIO A;  1P3K C;  3KUY C;  3F6T A;  2ZM5 A;  2RIQ A;  2YFW B;  5BNX A;  4Z66 B;  4G92 B;  5AY8 B;  3AV1 D;  3R45 B;  3TU4 B;  3W98 D;  1BH8 A;  2HIO C;  2YFV A;  1B6W A;  5DNM A;  3LZ0 D;  1S32 B;  2XD5 A;  4DRA A;  3B6G D;  1AOI A;  5DNM C;  1KX5 D;  3WA9 A;  2UWX A;  3VH6 A;  5KDM B;  4J8U B;  3A6N B;  4KGC B;  5JA4 B;  3X1V B;  2JCH A;  1AOI C;  3AV1 A;  3WA9 C;  3W98 A;  3LJA D;  4QLC D;  5F99 B;  3AZG B;  5CP6 B;  5AVB B;  3LZ0 A;  3AV1 C;  3WAA B;  3W98 C;  3W96 B;  3B6G A;  3AFA B;  3AZI B;  4YS3 B;  3X1T B;  5B0Y B;  1P3F B;  3UTA D;  1KX5 A;  4AWL B;  5G49 B;  1M19 B;  3LZ0 C;  3REL B;  2Y2N A;  5B0Z B;  3O62 D;  3UT9 D;  1P3G D;  3B6G C;  5AV8 D;  3LZ1 B;  1KX5 C;  4LD9 D;  3LJA A;  4QLC A;  3V9R A;  3X1S B;  2F8N G;  1P3B D;  5B1L D;  1P3L D;  1ZLA D;  2BYM A;  4WU9 D;  4KHA A;  2Y2L A;  1P3O B;  5B40 B;  3H0M C;  5B24 B;  4QLC C;  4X23 D;  3LJA C;  4H9N B;  3W99 D;  3UTA A;  1M1A B;  3AZK D;  5JRG B;  3MGP A;  3O62 A;  3UT9 A;  1P3G A;  3REI B;  2IO5 B;  5GT0 B;  5AV8 A;  3UTA C;  4ZUX B;  3REH B;  4LD9 A;  4KUD B;  3AZF B;  2RVQ D;  3VH5 W;  3AZL D;  1P3M D;  1P3B A;  5B1L A;  1P3L A;  1ZLA A;  3O62 C;  3UT9 C;  1P3G C;  3B0D C;  4WU9 A;  5AV8 C;  1F66 D;  3FDD A;  1KX4 D;  5DNN B;  4LD9 C;  4X23 A;  4UUZ B;  1P3B C;  5B1L C;  4XUJ D;  1P3L C;  3W99 A;  4WU9 C;  5B32 D;  5B31 G;  3MGS D;  3AZK A;  3WTP B;  4WJ3 C;  1P3A B;  4DRB A;  5AV9 D;  4CAY B;  3W99 C;  5B2J D;  4XZQ B;  3AZK C;  3AZL A;  1P3M A;  4EO5 C;  3MNN B;  2Y2K A;  1U35 B;  4JJN B;  1KX3 B;  1F66 A;  3AZE B;  3KUY B;  4H9S C;  1P34 B;  1KX4 A;  2NZD B;  2RVQ C;  3AZL C;  1P3M C;  2CV5 C;  1P3K D;  4XUJ A;  2XD1 A;  1F66 C;  5B32 A;  3NQU A;  3MGS A;  5BNX B;  1KX4 C;  3B6F D;  4WU8 D;  5AV9 A;  2Y2M A;  5C3I C;  4XUJ C;  2CWE A;  1KU5 A;  4ZBJ C;  5E5A D;  5B32 C;  2NQB B;  3MGS C;  3X1U D;  1ID3 D;  3MGR B;  1TZY D;  4DQY B;  5AV9 C;  2Y2Q A;  3MVD A;  1M18 D;  5B2J C;  1P3P B;  3EPH A;  1P3K A;  3MGQ B;  3AZJ B;  3AYW B;  5GXQ D;  3B6F A;  3B0C T;  4WU8 A;  3C1B D;  5FUG A;  4M6B A;  1EQZ B;  4H9P A;  3W98 B;  4J8W D;  5BO0 A;  1ID3 A;  3X1U A;  3C1C B;  2PYO B;  5CPK D;  1TZY A;  3B6F C;  4CSR B;  3UTB D;  5B33 B;  4WU8 C;  3LZ0 B;  3WKJ D;  5E5A C;  5B1M B;  1ID3 C;  4HGA B;  3X1U C;  3W97 D;  1TZY C;  3AN2 D;  3EPL A;  1M18 C;  4J8V D;  4G91 C;  5GXQ A;  4H9R A;  5BS7 A;  3C1B A;  4Z5T B;  1P3I D;  3LJA B;  4WNN B;  3AZH B;  5CPI D;  1JFI A;  5GXQ C;  5CPK A;  3UTB A;  5BS7 C;  3C1B C;  3KSY A;  1H3O A;  3WKJ A;  4Z66 D;  3AZN C;  4J8W C;  3H0R C;  5AY8 D;  3B0B A;  3W97 A;  5AV5 D;  5CPK C;  5AV6 B;  4YM6 D;  3UTB C;  3TU4 D;  3AN2 A;  5CPJ B;  2F8N B;  3MGP B;  3WKJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...