3KXBB

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 74
sequence length 74
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbB00
1ULYA 5GT0C 3AV1C 4UUZB 4H9QA 4JJNB 3AZFA 4H9RA 5AV6B 1A7WA 5AVCA 5AV9C 1KX3B 3VH6T 1M1AC 3WAAA 3W96A 1KX5C 3B0CT 1P3BA 1P3OC 2CV5C 3RELC 5GT3B 3W99A 4LD9D 2HIOD 3UTBA 2NZDB 5BS7A 3MNNA 1P3MB 4KGCC 3REIB 4UUZA 4JJNA 5B1LB 3VH5T 5AY8B 5AV6A 4H9OB 3REJB 2F8NB 3AZIA 4J8VB 3WTPB 3AZLD 3LELC 3AZEB 3NQJB 4J8XB 5CP6D 4CAYA 5KDMB 5GT3A 4X23D 5B40C 2NZDA 5AV8D 5B2IC 1P3AC 1ZLAC 3R45B 3WA9C 3LJAD 4HGAB 1EQZD 3KXBC 4E45A 3O62D 5B24C 3REIA 3REHD 5E5AC 5F99B 5B1LA 5AY8A 3MGSD 1P3PB 5B31C 3AFAC 2FJ7B 3REJA 2F8NA 1HQ3D 4DRBA 1P3GC 3AZHD 4J8VA 5B0YB 3MGRC 5GT0B 3AYWA 3WTPA 5CHLB 5JA4A 5B0ZD 3AZEA 3B0CW 3NQJA 2AROD 3KSYA 3MVDC 4J8XA 4WU8C 5KDMA 3A6NC 1M1AB 3UT9C 3LZ1D 3AN2B 3R45A 2HUEB 3AZKB 1P3FC 3KUYC 3W97D 3AZJA 5F99A 3REKC 5B1MD 5DNMC 3UTAC 5AVCD 4E44A 1P3PA 4ZUXC 5B33B 3LZ0B 3C1CC 3WAAD 5AVBB 5GSUD 1P3BD 5B0YA 1N1JB 5GT0A 3AV1A 3WKJD 2PYOC 4YM6D 3UTBD 1M1AA 5CPIC 1P3OA 4Z5TD 1P3IC 1P3KC 1ID3C 3RELA 5BO0B 5CPJD 4JJND 4QLCB 5B32G 1KX3D 5B33A 3MGPB 5AVBA 4KGCA 1F66D 1TZYD 4Z66B 3W98D 2NQBB 1AOIB 5B31B 1P3LB 4WU9B 1S32C 3KWQC 1P3GB 4J8WB 3X1TB 3MGRB 3AV2B 1P34C 4H9QB 3MVDB 3AZFB 1P3MD 5G49B 5BO0A 3REID 5B40A 3VH6A 3UT9B 5B1LD 5AY8D 5JRGD 1P3AA 1M18C 1ZLAA 4QLCA 3AZMD 1KX4C 3W96B 3REJD 5CPKC 4EO5C 3KUYB 3MGPA 4J8VD 3WTPD 4J8UC 2YFWB 5B24A 3AZED 3W99B 5B2JB 5BT1C 3B6GB 4J8XD 1AOIA 5B31A 3X1UC 1P3LA 4ZUXB 4YS3C 4XUJD 1P3GA 4R8PC 3X1TA 3MGRA 3B6FC 2PYOB 3AV2A 3VH5A 3MVDA 1H3OB 5G49A 3B0BA 3X1SC 3AZIB 3UT9A 3X1VC 1P3PD 2FJ7D 5C3IC 3MGQB 3KUYA 1P3KB 1P3FA 1ID3B 5B0YD 4CAYB 2YFWA 5B2JA 3B6GA 2LY8A 5DNMA 3UTAA 4ZUXA 3AN2D 4XZQD 3AZKD 4LD9C 2PYOA 2HIOC 5B32D 1H3OA 1S32B 3KWQB 3C1BB 3AYWB 1M19D 5JA4B 5B33D 3LZ0D 3MGQA 1BH8B 5AVBD 1P3IA 1P3KA 1ID3A 1KU5A 1M18B 4G92C 1KX4B 3AZLC 4EO5B 2RVQD 1U35B 3AZJB 4KUDD 4X23C 5AV8C 3X1UB 1S32A 4YS3B 3KWQA 1EQZC 4NE3A 3V9RB 4R8PB 3C1BA 4QLCD 3B6FB 4WNNB 3O62C 4G91C 3AV1B 3REHC 3MGPD 1BH8A 2F8NG 3MGSC 3X1SB 5AV9B 4Z66D 2IO5C 3AZND 5DNND 1M18A 1AOID 2NQBD 3AZHC 1B67A 1KX5B 1P3LD 1P3OB 4WU9D 1KX4A 5GXQD 2F8NH 5B0ZC 4J8WD 3X1TD 3RELB 2CV5B 2AROC 1U35A 3AV2D 3MVDD 3AZFD 3LZ1C 3X1UA 4YS3A 3UT9D 3V9RA 4R8PA 3W96D 3TU4C 1JFIB 1Q9CA 3W97C 3B6FA 4WNNA 4KGCB 4NFTA 5B1MC 3W99D 3X1SA 5AV9A 5B2JD 3AZGC 3B6GD 5GSUC 1P3BC 1KX5A 3LELB 3WKJC 2CV5A 3MNND 2PYOD 5B40B 4YM6C 3UTBC 4G92B 5B2IB 5AV6D 1P3AB 1ZLAB 3WA9B 3AZLB 4Z5TC 3AZID 3KXBB 1JFIA 5B24B 3MGQD 5E5AB 5CPJC 5AV8B 5GT3D 3NQUB 3AFAB 1KX3C 1EQZB 2NZDD 3O62B 3LELA 1F66C 1TZYC 4WU8B 3W98C 3MGSB 3A6NB 5B2IA 2BYMA 3WA9A 3AZLA 2F8ND 2JSSA 5B0ZB 1P3FB 3KXBA 3C1BD 1BH9B 2AROB 3AYWD 1P3MC 5E5AA 5B1LC 5AY8C 5JRGC 5AV8A 3LZ1B 5DNMB 3REKB 3UTAB 3NQUA 3AFAA 3REJC 3AZMC 4Z2MG 1EQZA 4H9PB 3C1CB 1M18D 4J8VC 3TU4B 3W97B 1B6WA 3O62A 3B0DC 4H9NB 5B31G 3REHA 4WU8A 3MGSA 4Z2MH 1U35D 3AZJD 5AV5C 3AZGB 3A6NA 5F99D 5CPIB 4XUJC 5GSUB 4AWLC 4HGAC 1R4VA 5B0ZA 1P3IB 1BH9A 2AROA 3B6FD 5GT0D 3AV1D 1F1EA 3REKA 3LZ1A 3X1SD 5AV9D 2FJ7C 1M1AD 1TAFB 4H9PA 3C1CA 3TU4A 5B0YC 3W97A 4WV4B 1P3OD 1KX5D 4H9NA 5CPJB 2CV5D 3RELD 5B1MA 1BFMA 3AZGA 5CPIA 4WZSB 5GSUA 3AN2C 4XZQC 1F66B 2HUEC 3AZKC 3WKJA 1TZYB 4DRAA 1P34B 3W98B 5B32C 4KGCD 4YM6A 4KHAB 5CPKB 4Z5TA 1M19C 5B33C 3LZ0C 1TAFA 5AVBC 5CP6C 3LELD 4J8UB 5CPJA 5JRGB 3AZMB 5B40D 1KX3A 3LJAC 2RVQC 2F8NK 5B2ID 1P3AD 1ZLAD 3WA9D 3B0DB 1F66A 4H9SC 4KUDC 1TZYA 3KXBD 1P34A 3W98A 5B24D 5AV5B 5E5AD 4XUJB 1HQ3C 3X1VB 4QLCC 5B31D 4AWLB 3AFAD 4KHAA 5C3IB 5CPKA 4NE6A 1P3GD 2YFVB 3MGPC 3MGRD 1P3MA 4J8UA 2CWEA 4Z66C 4WU8D 3AZNC 5DNNC 4M6BA 5JRGA 1AOIC 2NQBC 4H9OA 3AZMA 1P3LC 4WU9C 5GXQC 3A6ND 4J8WC 3X1TC 3VH6W 4LD9B 1P3FD 3KUYD 3AV2C 2HIOB 3AZFC 5FUGB 2L5AA 1WWSA 5AVCC 5AV5A 5BNVB 4XUJA 3WAAC 3REKD 3W96C 5DNMD 3UTAD 3X1VA 4XZQB 4ZUXD 3C1CD 2YFVA 3TU4D 5B32B 3W99C 5B2JC 3B6GC 5BS7C 4ZBJC 2BYMB 3AZGD 2FJ7A 1M19B 5CPID 3VH5W 3MNNC 5CP6B 4CSRB 4X23B 1P3ID 4LD9A 1P3KD 1ID3D 2BYKB 2HIOA 4JJNC 5FUGA 5BNXB 5AV6C 3LJAB 5BNVA 3AZIC 3AN2A 4XZQA 4G91B 4KUDB 3AZKA 3MGQC 3REHB 5B32A 3WTPE 5GT3C 2IO5B 1HQ3B 2NZDC 3AZHB 1S32D 3KWQD 1M19A 3LZ0A 1N1JA 4NE5A 5CP6A 4CSRA 3REIC 4X23A 1P34D 2BYKA 3AZNB 1HTAA 5DNNB 5BNXA 5GXQB 3LJAA 3C1BC 1KX4D 3AYWC 3WTPC 5CPKD 4H9SA 4KUDA 3AZEC 4H9RB 4J8XC 5B1MB 4J8UD 5AVCB 5BT1D 1HQ3A 3WAAB 3AZHA 1P3BB 3X1UD 4YS3D 3WKJB 4R8PD 1U35C 3AZJC 4YM6B 4Z66A 3UTBB 5F99C 1WWIA 3AZNA 5DNNA 2NQBA 1P3PC 4ZBJB 5AV5D 4WU9A 5GXQA 4Z5TB 4J8WA 3X1VD 3MNNB
chains in the Genus database with same CATH superfamily
1ULYA 5GT0C 3AV1C 4UUZB 4H9QA 4JJNB 3AZFA 4H9RA 5AV6B 1A7WA 5AVCA 5AV9C 1KX3B 3VH6T 1M1AC 3WAAA 3W96A 1KX5C 3B0CT 1P3BA 1P3OC 2CV5C 3RELC 5GT3B 3W99A 4LD9D 2HIOD 3UTBA 2W8SA 2NZDB 5BS7A 3MNNA 1P3MB 4KGCC 3REIB 4UUZA 4JJNA 5B1LB 3VH5T 5AY8B 2XD1A 4H9OB 5AV6A 3REJB 2F8NB 3AZIA 2UWXA 4J8VB 3WTPB 3AZLD 3LELC 3AZEB 3NQJB 4J8XB 5CP6D 4CAYA 5KDMB 5GT3A 4X23D 2Y2IA 3FDDA 5B40C 2NZDA 5AV8D 1PZRA 5B2IC 1P3AC 3R45B 1ZLAC 3WA9C 3LJAD 4HGAB 1EQZD 3KXBC 2ZY3A 4E45A 3O62D 5B24C 3REIA 3REHD 5E5AC 5F99B 5B1LA 5AY8A 3MGSD 1P3PB 5B31C 3AFAC 2FJ7B 3REJA 2F8NA 2Y2KA 1HQ3D 4DRBA 1P3GC 3AZHD 4J8VA 5B0YB 3MGRC 5GT0B 3AYWA 3WTPA 3KFUG 5CHLB 5JA4A 5B0ZD 3AZEA 3B0CW 3NQJA 2AROD 3KSYA 3MVDC 4J8XA 4WU8C 5KDMA 2ZM5A 3A6NC 1M1AB 3UT9C 3LZ1D 3AN2B 3R45A 2HUEB 3AZKB 3EG5B 3EPKA 1P3FC 3KUYC 3W97D 3AZJA 5F99A 3REKC 5B1MD 5DNMC 3UTAC 5AVCD 4E44A 1P3PA 3H0LC 2DF4C 4ZUXC 5B33B 3LZ0B 3C1CC 3WAAD 5AVBB 5GSUD 1P3BD 5B0YA 1N1JB 5GT0A 3AV1A 3WKJD 2PYOC 4YM6D 3UTBD 1M1AA 5CPIC 2Y2JA 1P3OA 2XD5A 4Z5TD 1P3IC 1P3KC 1ID3C 3RELA 5BO0B 5CPJD 4JJND 4QLCB 5B32G 1KX3D 5B33A 3MGPB 5AVBA 4KGCA 1F66D 1TZYD 4Z66B 3W98D 2NQBB 1AOIB 5B31B 1P3LB 4WU9B 1S32C 3KWQC 1P3GB 4J8WB 3X1TB 3P5JB 3MGRB 3AV2B 1P34C 4H9QB 3MVDB 3AZFB 1P3MD 5G49B 5BO0A 3REID 5B40A 3VH6A 3UT9B 5B1LD 5AY8D 5JRGD 1P3AA 1M18C 1ZLAA 4QLCA 3AZMD 1KX4C 3W96B 3REJD 5CPKC 4EO5C 3KUYB 3MGPA 4J8VD 3H0RC 3WTPD 4J8UC 2YFWB 5B24A 3AZED 3W99B 5B2JB 5BT1C 3B6GB 4J8XD 1AOIA 2DQNC 5B31A 3X1UC 1P3LA 4ZUXB 2FFFB 4YS3C 4XUJD 1P3GA 4R8PC 3X1TA 2G5HC 2Y2LA 3MGRA 3B6FC 2BG1A 2PYOB 3AV2A 3VH5A 3MVDA 1H3OB 5G49A 3B0BA 3X1SC 3AZIB 3UT9A 3X1VC 1P3PD 2FJ7D 5C3IC 3MGQB 3KUYA 1P3KB 1P3FA 1ID3B 5B0YD 4CAYB 2YFWA 5B2JA 3B6GA 2LY8A 5DNMA 3UTAA 4ZUXA 3AN2D 4XZQD 3AZKD 4LD9C 2PYOA 1T3UA 2HIOC 5B32D 1H3OA 1W2EA 1S32B 3KWQB 3C1BB 3AYWB 2RIQA 1M19D 5JA4B 5B33D 3LZ0D 3MGQA 1BH8B 5AVBD 1P3IA 1P3KA 1ID3A 1KU5A 3AL0C 3EPJA 2J8PA 1M18B 4G92C 1KX4B 3AZLC 4EO5B 2RVQD 1U35B 3AZJB 4KUDD 4X23C 5AV8C 3X1UB 1S32A 4YS3B 3KWQA 1EQZC 4NE3A 3V9RB 4R8PB 3C1BA 4QLCD 3B6FB 4WNNB 3O62C 4G91C 2VQRA 3AV1B 3REHC 3MGPD 1BH8A 2F8NG 3MGSC 3X1SB 5AV9B 4Z66D 2IO5C 3AZND 5DNND 1M18A 1AOID 2NQBD 3AZHC 1B67A 1KX5B 1P3LD 1P3OB 4WU9D 1KX4A 5GXQD 2F8NH 5B0ZC 4J8WD 3X1TD 3RELB 2CV5B 2AROC 3A1IA 1U35A 3AV2D 3MVDD 3AZFD 3LZ1C 3X1UA 4YS3A 3UT9D 3V9RA 4R8PA 3W96D 3TU4C 1JFIB 1Q9CA 3W97C 3B6FA 4WNNA 4KGCB 4NFTA 5B1MC 3W99D 3X1SA 5AV9A 5B2JD 3AZGC 3B6GD 5GSUC 1P3BC 1KX5A 3LELB 3WKJC 2CV5A 3MNND 2PYOD 5B40B 4YM6C 3UTBC 4G92B 5B2IB 5AV6D 1P3AB 1ZLAB 3WA9B 3AZLB 4Z5TC 3AZID 3KXBB 1JFIA 4WJ3C 5B24B 3MGQD 2G5IC 5E5AB 5CPJC 5AV8B 5GT3D 3NQUB 3AFAB 1KX3C 1EQZB 2NZDD 3O62B 3LELA 1F66C 1TZYC 4WU8B 2JE5A 3W98C 3MGSB 2Y2HA 3A6NB 1Z2CB 5B2IA 2BYMA 3WA9A 3AZLA 2F8ND 2JSSA 5B0ZB 1P3FB 3KXBA 3C1BD 1BH9B 2AROB 3EPLA 3AYWD 1P3MC 5E5AA 5B1LC 5AY8C 5JRGC 5AV8A 3LZ1B 5DNMB 3REKB 3UTAB 3NQUA 3AFAA 3REJC 3AZMC 4Z2MG 1EQZA 4H9PB 3C1CB 1M18D 4J8VC 3TU4B 3W97B 1B6WA 3O62A 3B0DC 4H9NB 5B31G 3REHA 4WU8A 3MGSA 4Z2MH 1U35D 3AZJD 5AV5C 2ZY2A 3A6NA 5F99D 3AZGB 5CPIB 3IP4C 4XUJC 5GSUB 4AWLC 4HGAC 1R4VA 5B0ZA 1P3IB 1BH9A 2AROA 3B6FD 5GT0D 3AV1D 1F1EA 3REKA 3LZ1A 3X1SD 5AV9D 2FJ7C 1M1AD 2JCHA 1TAFB 4H9PA 3C1CA 3TU4A 5B0YC 3W97A 4WV4B 1P3OD 1KX5D 4H9NA 5CPJB 2CV5D 3RELD 5B1MA 1BFMA 3AZGA 5CPIA 4WZSB 5GSUA 3AN2C 4XZQC 1F66B 2HUEC 3AZKC 3WKJA 1TZYB 4DRAA 1P34B 3W98B 5B32C 4KGCD 4YM6A 4UPKA 4KHAB 5CPKB 4Z5TA 1M19C 5B33C 3LZ0C 1TAFA 5AVBC 5CP6C 3LELD 4J8UB 2ZY5A 5CPJA 5JRGB 3AZMB 5B40D 1KX3A 3LJAC 2RVQC 2F8NK 5B2ID 1P3AD 1ZLAD 3WA9D 3B0DB 1F66A 4H9SC 4KUDC 1TZYA 3KXBD 1P34A 3W98A 5B24D 5AV5B 5E5AD 2Y2OA 4XUJB 1HQ3C 3X1VB 4QLCC 5B31D 4AWLB 3AFAD 4KHAA 5C3IB 5CPKA 4NE6A 2Y2NA 2YFVB 1P3GD 3MGPC 3MGRD 1P3MA 4J8UA 2CWEA 4Z66C 4WU8D 3AZNC 5DNNC 2ZY4A 4M6BA 5JRGA 1AOIC 3F6TA 4H9OA 3AZMA 1P3LC 4WU9C 5GXQC 3A6ND 4J8WC 3X1TC 3EPHA 3VH6W 4LD9B 1P3FD 3KUYD 3AV2C 2HIOB 3AZFC 5FUGB 2L5AA 1WWSA 5AVCC 5AV5A 5BNVB 4XUJA 3WAAC 3REKD 3W96C 5DNMD 3UTAD 3X1VA 2F2AC 4XZQB 4ZUXD 3C1CD 2YFVA 3TU4D 5B32B 3W99C 5B2JC 3B6GC 5BS7C 4ZBJC 2BYMB 3AZGD 2FJ7A 1M19B 5CPID 3VH5W 3MNNC 5CP6B 4CSRB 4X23B 1P3ID 4LD9A 1P3KD 1ID3D 2BYKB 2HIOA 4JJNC 5FUGA 5BNXB 5AV6C 3A1KA 3LJAB 5BNVA 3AZIC 3AN2A 4XZQA 4G91B 4KUDB 3AZKA 3MGQC 3REHB 5B32A 3WTPE 2Y2QA 5GT3C 2IO5B 1HQ3B 2NZDC 3AZHB 1S32D 3KWQD 1M19A 3LZ0A 1N1JA 4NE5A 5CP6A 4CSRA 3REIC 4X23A 1P34D 2BYKA 3AZNB 1HTAA 5DNNB 5BNXA 5GXQB 2Y2PA 3LJAA 4DQYB 3C1BC 1KX4D 3AYWC 3WTPC 5CPKD 4H9SA 4KUDA 3AZEC 3H0MC 4H9RB 4J8XC 5B1MB 4J8UD 5AVCB 5BT1D 1HQ3A 3WAAB 3AZHA 1P3BB 3X1UD 4YS3D 3WKJB 2NQBC 4R8PD 1U35C 3AZJC 4YM6B 4Z66A 3UTBB 5F99C 1WWIA 3AZNA 5DNNA 2Y2MA 2Y2GA 2NQBA 1P3PC 4ZBJB 5AV5D 4WU9A 5GXQA 4Z5TB 4J8WA 3X1VD 3MNNB
chains in the Genus database with same CATH topology
1ULYA 5GT0C 3AV1C 4UUZB 4H9QA 4JJNB 3AZFA 4H9RA 5AV6B 1A7WA 5AVCA 5AV9C 1KX3B 3VH6T 1M1AC 3WAAA 3W96A 1KX5C 3B0CT 1P3BA 1P3OC 2CV5C 3RELC 5GT3B 3W99A 4LD9D 2HIOD 3UTBA 2W8SA 2NZDB 5BS7A 3MNNA 1P3MB 4KGCC 3REIB 4UUZA 4JJNA 5B1LB 3VH5T 5AY8B 2XD1A 4H9OB 5AV6A 3REJB 2F8NB 3AZIA 2UWXA 4J8VB 3WTPB 3AZLD 3LELC 3AZEB 3NQJB 4J8XB 5CP6D 4CAYA 5KDMB 5GT3A 4X23D 2Y2IA 3FDDA 5B40C 2NZDA 5AV8D 1PZRA 5B2IC 1P3AC 3R45B 1ZLAC 3WA9C 3LJAD 4HGAB 1EQZD 3KXBC 2ZY3A 4E45A 3O62D 5B24C 3REIA 3REHD 5E5AC 5F99B 5B1LA 5AY8A 3MGSD 1P3PB 5B31C 3AFAC 2FJ7B 3REJA 2F8NA 2Y2KA 1HQ3D 4DRBA 1P3GC 3AZHD 4J8VA 5B0YB 3MGRC 5GT0B 3AYWA 3WTPA 3KFUG 5CHLB 5JA4A 5B0ZD 3AZEA 3B0CW 3NQJA 2AROD 3KSYA 3MVDC 4J8XA 4WU8C 5KDMA 2ZM5A 3A6NC 1M1AB 3UT9C 3LZ1D 3AN2B 3R45A 2HUEB 3AZKB 3EG5B 3EPKA 1P3FC 3KUYC 3W97D 3AZJA 5F99A 3REKC 5B1MD 5DNMC 3UTAC 5AVCD 4E44A 1P3PA 3H0LC 2DF4C 4ZUXC 5B33B 3LZ0B 3C1CC 3WAAD 5AVBB 5GSUD 1P3BD 5B0YA 1N1JB 5GT0A 3AV1A 3WKJD 2PYOC 4YM6D 3UTBD 1M1AA 5CPIC 2Y2JA 1P3OA 2XD5A 4Z5TD 1P3IC 1P3KC 1ID3C 3RELA 5BO0B 5CPJD 4JJND 4QLCB 5B32G 1KX3D 5B33A 3MGPB 5AVBA 4KGCA 1F66D 1TZYD 4Z66B 3W98D 2NQBB 1AOIB 5B31B 1P3LB 4WU9B 1S32C 3KWQC 1P3GB 4J8WB 3X1TB 3P5JB 3MGRB 3AV2B 1P34C 4H9QB 3MVDB 3AZFB 1P3MD 5G49B 5BO0A 3REID 5B40A 3VH6A 3UT9B 5B1LD 5AY8D 5JRGD 1P3AA 1M18C 1ZLAA 4QLCA 3AZMD 1KX4C 3W96B 3REJD 5CPKC 4EO5C 3KUYB 3MGPA 4J8VD 3H0RC 3WTPD 4J8UC 2YFWB 5B24A 3AZED 3W99B 5B2JB 5BT1C 3B6GB 4J8XD 1AOIA 2DQNC 5B31A 3X1UC 1P3LA 4ZUXB 2FFFB 4YS3C 4XUJD 1P3GA 4R8PC 3X1TA 2G5HC 2Y2LA 3MGRA 3B6FC 2BG1A 2PYOB 3AV2A 3VH5A 3MVDA 1H3OB 5G49A 3B0BA 3X1SC 3AZIB 3UT9A 3X1VC 1P3PD 2FJ7D 5C3IC 3MGQB 3KUYA 1P3KB 1P3FA 1ID3B 5B0YD 4CAYB 2YFWA 5B2JA 3B6GA 2LY8A 5DNMA 3UTAA 4ZUXA 3AN2D 4XZQD 3AZKD 4LD9C 2PYOA 1T3UA 2HIOC 5B32D 1H3OA 1W2EA 1S32B 3KWQB 3C1BB 3AYWB 2RIQA 1M19D 5JA4B 5B33D 3LZ0D 3MGQA 1BH8B 5AVBD 1P3IA 1P3KA 1ID3A 1KU5A 3AL0C 3EPJA 2J8PA 1M18B 4G92C 1KX4B 3AZLC 4EO5B 2RVQD 1U35B 3AZJB 4KUDD 4X23C 5AV8C 3X1UB 1S32A 4YS3B 3KWQA 1EQZC 4NE3A 3V9RB 4R8PB 3C1BA 4QLCD 3B6FB 4WNNB 3O62C 4G91C 2VQRA 3AV1B 3REHC 3MGPD 1BH8A 2F8NG 3MGSC 3X1SB 5AV9B 4Z66D 2IO5C 3AZND 5DNND 1M18A 1AOID 2NQBD 3AZHC 1B67A 1KX5B 1P3LD 1P3OB 4WU9D 1KX4A 5GXQD 2F8NH 5B0ZC 4J8WD 3X1TD 3RELB 2CV5B 2AROC 3A1IA 1U35A 3AV2D 3MVDD 3AZFD 3LZ1C 3X1UA 4YS3A 3UT9D 3V9RA 4R8PA 3W96D 3TU4C 1JFIB 1Q9CA 3W97C 3B6FA 4WNNA 4KGCB 4NFTA 5B1MC 3W99D 3X1SA 5AV9A 5B2JD 3AZGC 3B6GD 5GSUC 1P3BC 1KX5A 3LELB 3WKJC 2CV5A 3MNND 2PYOD 5B40B 4YM6C 3UTBC 4G92B 5B2IB 5AV6D 1P3AB 1ZLAB 3WA9B 3AZLB 4Z5TC 3AZID 3KXBB 1JFIA 4WJ3C 5B24B 3MGQD 2G5IC 5E5AB 5CPJC 5AV8B 5GT3D 3NQUB 3AFAB 1KX3C 1EQZB 2NZDD 3O62B 3LELA 1F66C 1TZYC 4WU8B 2JE5A 3W98C 3MGSB 2Y2HA 3A6NB 1Z2CB 5B2IA 2BYMA 3WA9A 3AZLA 2F8ND 2JSSA 5B0ZB 1P3FB 3KXBA 3C1BD 1BH9B 2AROB 3EPLA 3AYWD 1P3MC 5E5AA 5B1LC 5AY8C 5JRGC 5AV8A 3LZ1B 5DNMB 3REKB 3UTAB 3NQUA 3AFAA 3REJC 3AZMC 4Z2MG 1EQZA 4H9PB 3C1CB 1M18D 4J8VC 3TU4B 3W97B 1B6WA 3O62A 3B0DC 4H9NB 5B31G 3REHA 4WU8A 3MGSA 4Z2MH 1U35D 3AZJD 5AV5C 2ZY2A 3A6NA 5F99D 3AZGB 5CPIB 3IP4C 4XUJC 5GSUB 4AWLC 4HGAC 1R4VA 5B0ZA 1P3IB 1BH9A 2AROA 3B6FD 5GT0D 3AV1D 1F1EA 3REKA 3LZ1A 3X1SD 5AV9D 2FJ7C 1M1AD 2JCHA 1TAFB 4H9PA 3C1CA 3TU4A 5B0YC 3W97A 4WV4B 1P3OD 1KX5D 4H9NA 5CPJB 2CV5D 3RELD 5B1MA 1BFMA 3AZGA 5CPIA 4WZSB 5GSUA 3AN2C 4XZQC 1F66B 2HUEC 3AZKC 3WKJA 1TZYB 4DRAA 1P34B 3W98B 5B32C 4KGCD 4YM6A 4UPKA 4KHAB 5CPKB 4Z5TA 1M19C 5B33C 3LZ0C 1TAFA 5AVBC 5CP6C 3LELD 4J8UB 2ZY5A 5CPJA 5JRGB 3AZMB 5B40D 1KX3A 3LJAC 2RVQC 2F8NK 5B2ID 1P3AD 1ZLAD 3WA9D 3B0DB 1F66A 4H9SC 4KUDC 1TZYA 3KXBD 1P34A 3W98A 5B24D 5AV5B 5E5AD 2Y2OA 4XUJB 1HQ3C 3X1VB 4QLCC 5B31D 4AWLB 3AFAD 4KHAA 5C3IB 5CPKA 4NE6A 2Y2NA 2YFVB 1P3GD 3MGPC 3MGRD 1P3MA 4J8UA 2CWEA 4Z66C 4WU8D 3AZNC 5DNNC 2ZY4A 4M6BA 5JRGA 1AOIC 3F6TA 4H9OA 3AZMA 1P3LC 4WU9C 5GXQC 3A6ND 4J8WC 3X1TC 3EPHA 3VH6W 4LD9B 1P3FD 3KUYD 3AV2C 2HIOB 3AZFC 5FUGB 2L5AA 1WWSA 5AVCC 5AV5A 5BNVB 4XUJA 3WAAC 3REKD 3W96C 5DNMD 3UTAD 3X1VA 2F2AC 4XZQB 4ZUXD 3C1CD 2YFVA 3TU4D 5B32B 3W99C 5B2JC 3B6GC 5BS7C 4ZBJC 2BYMB 3AZGD 2FJ7A 1M19B 5CPID 3VH5W 3MNNC 5CP6B 4CSRB 4X23B 1P3ID 4LD9A 1P3KD 1ID3D 2BYKB 2HIOA 4JJNC 5FUGA 5BNXB 5AV6C 3A1KA 3LJAB 5BNVA 3AZIC 3AN2A 4XZQA 4G91B 4KUDB 3AZKA 3MGQC 3REHB 5B32A 3WTPE 2Y2QA 5GT3C 2IO5B 1HQ3B 2NZDC 3AZHB 1S32D 3KWQD 1M19A 3LZ0A 1N1JA 4NE5A 5CP6A 4CSRA 3REIC 4X23A 1P34D 2BYKA 3AZNB 1HTAA 5DNNB 5BNXA 5GXQB 2Y2PA 3LJAA 4DQYB 3C1BC 1KX4D 3AYWC 3WTPC 5CPKD 4H9SA 4KUDA 3AZEC 3H0MC 4H9RB 4J8XC 5B1MB 4J8UD 5AVCB 5BT1D 1HQ3A 3WAAB 3AZHA 1P3BB 3X1UD 4YS3D 3WKJB 2NQBC 4R8PD 1U35C 3AZJC 4YM6B 4Z66A 3UTBB 5F99C 1WWIA 3AZNA 5DNNA 2Y2MA 2Y2GA 2NQBA 1P3PC 4ZBJB 5AV5D 4WU9A 5GXQA 4Z5TB 4J8WA 3X1VD 3MNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  5GT0 C;  3AV1 C;  4UUZ B;  4H9Q A;  4JJN B;  3AZF A;  4H9R A;  5AV6 B;  1A7W A;  5AVC A;  5AV9 C;  1KX3 B;  3VH6 T;  1M1A C;  3WAA A;  3W96 A;  1KX5 C;  3B0C T;  1P3B A;  1P3O C;  2CV5 C;  3REL C;  5GT3 B;  3W99 A;  4LD9 D;  2HIO D;  3UTB A;  2NZD B;  5BS7 A;  3MNN A;  1P3M B;  4KGC C;  3REI B;  4UUZ A;  4JJN A;  5B1L B;  3VH5 T;  5AY8 B;  5AV6 A;  4H9O B;  3REJ B;  2F8N B;  3AZI A;  4J8V B;  3WTP B;  3AZL D;  3LEL C;  3AZE B;  3NQJ B;  4J8X B;  5CP6 D;  4CAY A;  5KDM B;  5GT3 A;  4X23 D;  5B40 C;  2NZD A;  5AV8 D;  5B2I C;  1P3A C;  1ZLA C;  3R45 B;  3WA9 C;  3LJA D;  4HGA B;  1EQZ D;  3KXB C;  4E45 A;  3O62 D;  5B24 C;  3REI A;  3REH D;  5E5A C;  5F99 B;  5B1L A;  5AY8 A;  3MGS D;  1P3P B;  5B31 C;  3AFA C;  2FJ7 B;  3REJ A;  2F8N A;  1HQ3 D;  4DRB A;  1P3G C;  3AZH D;  4J8V A;  5B0Y B;  3MGR C;  5GT0 B;  3AYW A;  3WTP A;  5CHL B;  5JA4 A;  5B0Z D;  3AZE A;  3B0C W;  3NQJ A;  2ARO D;  3KSY A;  3MVD C;  4J8X A;  4WU8 C;  5KDM A;  3A6N C;  1M1A B;  3UT9 C;  3LZ1 D;  3AN2 B;  3R45 A;  2HUE B;  3AZK B;  1P3F C;  3KUY C;  3W97 D;  3AZJ A;  5F99 A;  3REK C;  5B1M D;  5DNM C;  3UTA C;  5AVC D;  4E44 A;  1P3P A;  4ZUX C;  5B33 B;  3LZ0 B;  3C1C C;  3WAA D;  5AVB B;  5GSU D;  1P3B D;  5B0Y A;  1N1J B;  5GT0 A;  3AV1 A;  3WKJ D;  2PYO C;  4YM6 D;  3UTB D;  1M1A A;  5CPI C;  1P3O A;  4Z5T D;  1P3I C;  1P3K C;  1ID3 C;  3REL A;  5BO0 B;  5CPJ D;  4JJN D;  4QLC B;  5B32 G;  1KX3 D;  5B33 A;  3MGP B;  5AVB A;  4KGC A;  1F66 D;  1TZY D;  4Z66 B;  3W98 D;  2NQB B;  1AOI B;  5B31 B;  1P3L B;  4WU9 B;  1S32 C;  3KWQ C;  1P3G B;  4J8W B;  3X1T B;  3MGR B;  3AV2 B;  1P34 C;  4H9Q B;  3MVD B;  3AZF B;  1P3M D;  5G49 B;  5BO0 A;  3REI D;  5B40 A;  3VH6 A;  3UT9 B;  5B1L D;  5AY8 D;  5JRG D;  1P3A A;  1M18 C;  1ZLA A;  4QLC A;  3AZM D;  1KX4 C;  3W96 B;  3REJ D;  5CPK C;  4EO5 C;  3KUY B;  3MGP A;  4J8V D;  3WTP D;  4J8U C;  2YFW B;  5B24 A;  3AZE D;  3W99 B;  5B2J B;  5BT1 C;  3B6G B;  4J8X D;  1AOI A;  5B31 A;  3X1U C;  1P3L A;  4ZUX B;  4YS3 C;  4XUJ D;  1P3G A;  4R8P C;  3X1T A;  3MGR A;  3B6F C;  2PYO B;  3AV2 A;  3VH5 A;  3MVD A;  1H3O B;  5G49 A;  3B0B A;  3X1S C;  3AZI B;  3UT9 A;  3X1V C;  1P3P D;  2FJ7 D;  5C3I C;  3MGQ B;  3KUY A;  1P3K B;  1P3F A;  1ID3 B;  5B0Y D;  4CAY B;  2YFW A;  5B2J A;  3B6G A;  2LY8 A;  5DNM A;  3UTA A;  4ZUX A;  3AN2 D;  4XZQ D;  3AZK D;  4LD9 C;  2PYO A;  2HIO C;  5B32 D;  1H3O A;  1S32 B;  3KWQ B;  3C1B B;  3AYW B;  1M19 D;  5JA4 B;  5B33 D;  3LZ0 D;  3MGQ A;  1BH8 B;  5AVB D;  1P3I A;  1P3K A;  1ID3 A;  1KU5 A;  1M18 B;  4G92 C;  1KX4 B;  3AZL C;  4EO5 B;  2RVQ D;  1U35 B;  3AZJ B;  4KUD D;  4X23 C;  5AV8 C;  3X1U B;  1S32 A;  4YS3 B;  3KWQ A;  1EQZ C;  4NE3 A;  3V9R B;  4R8P B;  3C1B A;  4QLC D;  3B6F B;  4WNN B;  3O62 C;  4G91 C;  3AV1 B;  3REH C;  3MGP D;  1BH8 A;  2F8N G;  3MGS C;  3X1S B;  5AV9 B;  4Z66 D;  2IO5 C;  3AZN D;  5DNN D;  1M18 A;  1AOI D;  2NQB D;  3AZH C;  1B67 A;  1KX5 B;  1P3L D;  1P3O B;  4WU9 D;  1KX4 A;  5GXQ D;  2F8N H;  5B0Z C;  4J8W D;  3X1T D;  3REL B;  2CV5 B;  2ARO C;  1U35 A;  3AV2 D;  3MVD D;  3AZF D;  3LZ1 C;  3X1U A;  4YS3 A;  3UT9 D;  3V9R A;  4R8P A;  3W96 D;  3TU4 C;  1JFI B;  1Q9C A;  3W97 C;  3B6F A;  4WNN A;  4KGC B;  4NFT A;  5B1M C;  3W99 D;  3X1S A;  5AV9 A;  5B2J D;  3AZG C;  3B6G D;  5GSU C;  1P3B C;  1KX5 A;  3LEL B;  3WKJ C;  2CV5 A;  3MNN D;  2PYO D;  5B40 B;  4YM6 C;  3UTB C;  4G92 B;  5B2I B;  5AV6 D;  1P3A B;  1ZLA B;  3WA9 B;  3AZL B;  4Z5T C;  3AZI D;  3KXB B;  1JFI A;  5B24 B;  3MGQ D;  5E5A B;  5CPJ C;  5AV8 B;  5GT3 D;  3NQU B;  3AFA B;  1KX3 C;  1EQZ B;  2NZD D;  3O62 B;  3LEL A;  1F66 C;  1TZY C;  4WU8 B;  3W98 C;  3MGS B;  3A6N B;  5B2I A;  2BYM A;  3WA9 A;  3AZL A;  2F8N D;  2JSS A;  5B0Z B;  1P3F B;  3KXB A;  3C1B D;  1BH9 B;  2ARO B;  3AYW D;  1P3M C;  5E5A A;  5B1L C;  5AY8 C;  5JRG C;  5AV8 A;  3LZ1 B;  5DNM B;  3REK B;  3UTA B;  3NQU A;  3AFA A;  3REJ C;  3AZM C;  4Z2M G;  1EQZ A;  4H9P B;  3C1C B;  1M18 D;  4J8V C;  3TU4 B;  3W97 B;  1B6W A;  3O62 A;  3B0D C;  4H9N B;  5B31 G;  3REH A;  4WU8 A;  3MGS A;  4Z2M H;  1U35 D;  3AZJ D;  5AV5 C;  3AZG B;  3A6N A;  5F99 D;  5CPI B;  4XUJ C;  5GSU B;  4AWL C;  4HGA C;  1R4V A;  5B0Z A;  1P3I B;  1BH9 A;  2ARO A;  3B6F D;  5GT0 D;  3AV1 D;  1F1E A;  3REK A;  3LZ1 A;  3X1S D;  5AV9 D;  2FJ7 C;  1M1A D;  1TAF B;  4H9P A;  3C1C A;  3TU4 A;  5B0Y C;  3W97 A;  4WV4 B;  1P3O D;  1KX5 D;  4H9N A;  5CPJ B;  2CV5 D;  3REL D;  5B1M A;  1BFM A;  3AZG A;  5CPI A;  4WZS B;  5GSU A;  3AN2 C;  4XZQ C;  1F66 B;  2HUE C;  3AZK C;  3WKJ A;  1TZY B;  4DRA A;  1P34 B;  3W98 B;  5B32 C;  4KGC D;  4YM6 A;  4KHA B;  5CPK B;  4Z5T A;  1M19 C;  5B33 C;  3LZ0 C;  1TAF A;  5AVB C;  5CP6 C;  3LEL D;  4J8U B;  5CPJ A;  5JRG B;  3AZM B;  5B40 D;  1KX3 A;  3LJA C;  2RVQ C;  2F8N K;  5B2I D;  1P3A D;  1ZLA D;  3WA9 D;  3B0D B;  1F66 A;  4H9S C;  4KUD C;  1TZY A;  3KXB D;  1P34 A;  3W98 A;  5B24 D;  5AV5 B;  5E5A D;  4XUJ B;  1HQ3 C;  3X1V B;  4QLC C;  5B31 D;  4AWL B;  3AFA D;  4KHA A;  5C3I B;  5CPK A;  4NE6 A;  1P3G D;  2YFV B;  3MGP C;  3MGR D;  1P3M A;  4J8U A;  2CWE A;  4Z66 C;  4WU8 D;  3AZN C;  5DNN C;  4M6B A;  5JRG A;  1AOI C;  2NQB C;  4H9O A;  3AZM A;  1P3L C;  4WU9 C;  5GXQ C;  3A6N D;  4J8W C;  3X1T C;  3VH6 W;  4LD9 B;  1P3F D;  3KUY D;  3AV2 C;  2HIO B;  3AZF C;  5FUG B;  2L5A A;  1WWS A;  5AVC C;  5AV5 A;  5BNV B;  4XUJ A;  3WAA C;  3REK D;  3W96 C;  5DNM D;  3UTA D;  3X1V A;  4XZQ B;  4ZUX D;  3C1C D;  2YFV A;  3TU4 D;  5B32 B;  3W99 C;  5B2J C;  3B6G C;  5BS7 C;  4ZBJ C;  2BYM B;  3AZG D;  2FJ7 A;  1M19 B;  5CPI D;  3VH5 W;  3MNN C;  5CP6 B;  4CSR B;  4X23 B;  1P3I D;  4LD9 A;  1P3K D;  1ID3 D;  2BYK B;  2HIO A;  4JJN C;  5FUG A;  5BNX B;  5AV6 C;  3LJA B;  5BNV A;  3AZI C;  3AN2 A;  4XZQ A;  4G91 B;  4KUD B;  3AZK A;  3MGQ C;  3REH B;  5B32 A;  3WTP E;  5GT3 C;  2IO5 B;  1HQ3 B;  2NZD C;  3AZH B;  1S32 D;  3KWQ D;  1M19 A;  3LZ0 A;  1N1J A;  4NE5 A;  5CP6 A;  4CSR A;  3REI C;  4X23 A;  1P34 D;  2BYK A;  3AZN B;  1HTA A;  5DNN B;  5BNX A;  5GXQ B;  3LJA A;  3C1B C;  1KX4 D;  3AYW C;  3WTP C;  5CPK D;  4H9S A;  4KUD A;  3AZE C;  4H9R B;  4J8X C;  5B1M B;  4J8U D;  5AVC B;  5BT1 D;  1HQ3 A;  3WAA B;  3AZH A;  1P3B B;  3X1U D;  4YS3 D;  3WKJ B;  4R8P D;  1U35 C;  3AZJ C;  4YM6 B;  4Z66 A;  3UTB B;  5F99 C;  1WWI A;  3AZN A;  5DNN A;  2NQB A;  1P3P C;  4ZBJ B;  5AV5 D;  4WU9 A;  5GXQ A;  4Z5T B;  4J8W A;  3X1V D;  3MNN B; 
#chains in the Genus database with same CATH topology
 1ULY A;  5GT0 C;  3AV1 C;  4UUZ B;  4H9Q A;  4JJN B;  3AZF A;  4H9R A;  5AV6 B;  1A7W A;  5AVC A;  5AV9 C;  1KX3 B;  3VH6 T;  1M1A C;  3WAA A;  3W96 A;  1KX5 C;  3B0C T;  1P3B A;  1P3O C;  2CV5 C;  3REL C;  5GT3 B;  3W99 A;  4LD9 D;  2HIO D;  3UTB A;  2W8S A;  2NZD B;  5BS7 A;  3MNN A;  1P3M B;  4KGC C;  3REI B;  4UUZ A;  4JJN A;  5B1L B;  3VH5 T;  5AY8 B;  2XD1 A;  4H9O B;  5AV6 A;  3REJ B;  2F8N B;  3AZI A;  2UWX A;  4J8V B;  3WTP B;  3AZL D;  3LEL C;  3AZE B;  3NQJ B;  4J8X B;  5CP6 D;  4CAY A;  5KDM B;  5GT3 A;  4X23 D;  2Y2I A;  3FDD A;  5B40 C;  2NZD A;  5AV8 D;  1PZR A;  5B2I C;  1P3A C;  3R45 B;  1ZLA C;  3WA9 C;  3LJA D;  4HGA B;  1EQZ D;  3KXB C;  2ZY3 A;  4E45 A;  3O62 D;  5B24 C;  3REI A;  3REH D;  5E5A C;  5F99 B;  5B1L A;  5AY8 A;  3MGS D;  1P3P B;  5B31 C;  3AFA C;  2FJ7 B;  3REJ A;  2F8N A;  2Y2K A;  1HQ3 D;  4DRB A;  1P3G C;  3AZH D;  4J8V A;  5B0Y B;  3MGR C;  5GT0 B;  3AYW A;  3WTP A;  3KFU G;  5CHL B;  5JA4 A;  5B0Z D;  3AZE A;  3B0C W;  3NQJ A;  2ARO D;  3KSY A;  3MVD C;  4J8X A;  4WU8 C;  5KDM A;  2ZM5 A;  3A6N C;  1M1A B;  3UT9 C;  3LZ1 D;  3AN2 B;  3R45 A;  2HUE B;  3AZK B;  3EG5 B;  3EPK A;  1P3F C;  3KUY C;  3W97 D;  3AZJ A;  5F99 A;  3REK C;  5B1M D;  5DNM C;  3UTA C;  5AVC D;  4E44 A;  1P3P A;  3H0L C;  2DF4 C;  4ZUX C;  5B33 B;  3LZ0 B;  3C1C C;  3WAA D;  5AVB B;  5GSU D;  1P3B D;  5B0Y A;  1N1J B;  5GT0 A;  3AV1 A;  3WKJ D;  2PYO C;  4YM6 D;  3UTB D;  1M1A A;  5CPI C;  2Y2J A;  1P3O A;  2XD5 A;  4Z5T D;  1P3I C;  1P3K C;  1ID3 C;  3REL A;  5BO0 B;  5CPJ D;  4JJN D;  4QLC B;  5B32 G;  1KX3 D;  5B33 A;  3MGP B;  5AVB A;  4KGC A;  1F66 D;  1TZY D;  4Z66 B;  3W98 D;  2NQB B;  1AOI B;  5B31 B;  1P3L B;  4WU9 B;  1S32 C;  3KWQ C;  1P3G B;  4J8W B;  3X1T B;  3P5J B;  3MGR B;  3AV2 B;  1P34 C;  4H9Q B;  3MVD B;  3AZF B;  1P3M D;  5G49 B;  5BO0 A;  3REI D;  5B40 A;  3VH6 A;  3UT9 B;  5B1L D;  5AY8 D;  5JRG D;  1P3A A;  1M18 C;  1ZLA A;  4QLC A;  3AZM D;  1KX4 C;  3W96 B;  3REJ D;  5CPK C;  4EO5 C;  3KUY B;  3MGP A;  4J8V D;  3H0R C;  3WTP D;  4J8U C;  2YFW B;  5B24 A;  3AZE D;  3W99 B;  5B2J B;  5BT1 C;  3B6G B;  4J8X D;  1AOI A;  2DQN C;  5B31 A;  3X1U C;  1P3L A;  4ZUX B;  2FFF B;  4YS3 C;  4XUJ D;  1P3G A;  4R8P C;  3X1T A;  2G5H C;  2Y2L A;  3MGR A;  3B6F C;  2BG1 A;  2PYO B;  3AV2 A;  3VH5 A;  3MVD A;  1H3O B;  5G49 A;  3B0B A;  3X1S C;  3AZI B;  3UT9 A;  3X1V C;  1P3P D;  2FJ7 D;  5C3I C;  3MGQ B;  3KUY A;  1P3K B;  1P3F A;  1ID3 B;  5B0Y D;  4CAY B;  2YFW A;  5B2J A;  3B6G A;  2LY8 A;  5DNM A;  3UTA A;  4ZUX A;  3AN2 D;  4XZQ D;  3AZK D;  4LD9 C;  2PYO A;  1T3U A;  2HIO C;  5B32 D;  1H3O A;  1W2E A;  1S32 B;  3KWQ B;  3C1B B;  3AYW B;  2RIQ A;  1M19 D;  5JA4 B;  5B33 D;  3LZ0 D;  3MGQ A;  1BH8 B;  5AVB D;  1P3I A;  1P3K A;  1ID3 A;  1KU5 A;  3AL0 C;  3EPJ A;  2J8P A;  1M18 B;  4G92 C;  1KX4 B;  3AZL C;  4EO5 B;  2RVQ D;  1U35 B;  3AZJ B;  4KUD D;  4X23 C;  5AV8 C;  3X1U B;  1S32 A;  4YS3 B;  3KWQ A;  1EQZ C;  4NE3 A;  3V9R B;  4R8P B;  3C1B A;  4QLC D;  3B6F B;  4WNN B;  3O62 C;  4G91 C;  2VQR A;  3AV1 B;  3REH C;  3MGP D;  1BH8 A;  2F8N G;  3MGS C;  3X1S B;  5AV9 B;  4Z66 D;  2IO5 C;  3AZN D;  5DNN D;  1M18 A;  1AOI D;  2NQB D;  3AZH C;  1B67 A;  1KX5 B;  1P3L D;  1P3O B;  4WU9 D;  1KX4 A;  5GXQ D;  2F8N H;  5B0Z C;  4J8W D;  3X1T D;  3REL B;  2CV5 B;  2ARO C;  3A1I A;  1U35 A;  3AV2 D;  3MVD D;  3AZF D;  3LZ1 C;  3X1U A;  4YS3 A;  3UT9 D;  3V9R A;  4R8P A;  3W96 D;  3TU4 C;  1JFI B;  1Q9C A;  3W97 C;  3B6F A;  4WNN A;  4KGC B;  4NFT A;  5B1M C;  3W99 D;  3X1S A;  5AV9 A;  5B2J D;  3AZG C;  3B6G D;  5GSU C;  1P3B C;  1KX5 A;  3LEL B;  3WKJ C;  2CV5 A;  3MNN D;  2PYO D;  5B40 B;  4YM6 C;  3UTB C;  4G92 B;  5B2I B;  5AV6 D;  1P3A B;  1ZLA B;  3WA9 B;  3AZL B;  4Z5T C;  3AZI D;  3KXB B;  1JFI A;  4WJ3 C;  5B24 B;  3MGQ D;  2G5I C;  5E5A B;  5CPJ C;  5AV8 B;  5GT3 D;  3NQU B;  3AFA B;  1KX3 C;  1EQZ B;  2NZD D;  3O62 B;  3LEL A;  1F66 C;  1TZY C;  4WU8 B;  2JE5 A;  3W98 C;  3MGS B;  2Y2H A;  3A6N B;  1Z2C B;  5B2I A;  2BYM A;  3WA9 A;  3AZL A;  2F8N D;  2JSS A;  5B0Z B;  1P3F B;  3KXB A;  3C1B D;  1BH9 B;  2ARO B;  3EPL A;  3AYW D;  1P3M C;  5E5A A;  5B1L C;  5AY8 C;  5JRG C;  5AV8 A;  3LZ1 B;  5DNM B;  3REK B;  3UTA B;  3NQU A;  3AFA A;  3REJ C;  3AZM C;  4Z2M G;  1EQZ A;  4H9P B;  3C1C B;  1M18 D;  4J8V C;  3TU4 B;  3W97 B;  1B6W A;  3O62 A;  3B0D C;  4H9N B;  5B31 G;  3REH A;  4WU8 A;  3MGS A;  4Z2M H;  1U35 D;  3AZJ D;  5AV5 C;  2ZY2 A;  3A6N A;  5F99 D;  3AZG B;  5CPI B;  3IP4 C;  4XUJ C;  5GSU B;  4AWL C;  4HGA C;  1R4V A;  5B0Z A;  1P3I B;  1BH9 A;  2ARO A;  3B6F D;  5GT0 D;  3AV1 D;  1F1E A;  3REK A;  3LZ1 A;  3X1S D;  5AV9 D;  2FJ7 C;  1M1A D;  2JCH A;  1TAF B;  4H9P A;  3C1C A;  3TU4 A;  5B0Y C;  3W97 A;  4WV4 B;  1P3O D;  1KX5 D;  4H9N A;  5CPJ B;  2CV5 D;  3REL D;  5B1M A;  1BFM A;  3AZG A;  5CPI A;  4WZS B;  5GSU A;  3AN2 C;  4XZQ C;  1F66 B;  2HUE C;  3AZK C;  3WKJ A;  1TZY B;  4DRA A;  1P34 B;  3W98 B;  5B32 C;  4KGC D;  4YM6 A;  4UPK A;  4KHA B;  5CPK B;  4Z5T A;  1M19 C;  5B33 C;  3LZ0 C;  1TAF A;  5AVB C;  5CP6 C;  3LEL D;  4J8U B;  2ZY5 A;  5CPJ A;  5JRG B;  3AZM B;  5B40 D;  1KX3 A;  3LJA C;  2RVQ C;  2F8N K;  5B2I D;  1P3A D;  1ZLA D;  3WA9 D;  3B0D B;  1F66 A;  4H9S C;  4KUD C;  1TZY A;  3KXB D;  1P34 A;  3W98 A;  5B24 D;  5AV5 B;  5E5A D;  2Y2O A;  4XUJ B;  1HQ3 C;  3X1V B;  4QLC C;  5B31 D;  4AWL B;  3AFA D;  4KHA A;  5C3I B;  5CPK A;  4NE6 A;  2Y2N A;  2YFV B;  1P3G D;  3MGP C;  3MGR D;  1P3M A;  4J8U A;  2CWE A;  4Z66 C;  4WU8 D;  3AZN C;  5DNN C;  2ZY4 A;  4M6B A;  5JRG A;  1AOI C;  3F6T A;  4H9O A;  3AZM A;  1P3L C;  4WU9 C;  5GXQ C;  3A6N D;  4J8W C;  3X1T C;  3EPH A;  3VH6 W;  4LD9 B;  1P3F D;  3KUY D;  3AV2 C;  2HIO B;  3AZF C;  5FUG B;  2L5A A;  1WWS A;  5AVC C;  5AV5 A;  5BNV B;  4XUJ A;  3WAA C;  3REK D;  3W96 C;  5DNM D;  3UTA D;  3X1V A;  2F2A C;  4XZQ B;  4ZUX D;  3C1C D;  2YFV A;  3TU4 D;  5B32 B;  3W99 C;  5B2J C;  3B6G C;  5BS7 C;  4ZBJ C;  2BYM B;  3AZG D;  2FJ7 A;  1M19 B;  5CPI D;  3VH5 W;  3MNN C;  5CP6 B;  4CSR B;  4X23 B;  1P3I D;  4LD9 A;  1P3K D;  1ID3 D;  2BYK B;  2HIO A;  4JJN C;  5FUG A;  5BNX B;  5AV6 C;  3A1K A;  3LJA B;  5BNV A;  3AZI C;  3AN2 A;  4XZQ A;  4G91 B;  4KUD B;  3AZK A;  3MGQ C;  3REH B;  5B32 A;  3WTP E;  2Y2Q A;  5GT3 C;  2IO5 B;  1HQ3 B;  2NZD C;  3AZH B;  1S32 D;  3KWQ D;  1M19 A;  3LZ0 A;  1N1J A;  4NE5 A;  5CP6 A;  4CSR A;  3REI C;  4X23 A;  1P34 D;  2BYK A;  3AZN B;  1HTA A;  5DNN B;  5BNX A;  5GXQ B;  2Y2P A;  3LJA A;  4DQY B;  3C1B C;  1KX4 D;  3AYW C;  3WTP C;  5CPK D;  4H9S A;  4KUD A;  3AZE C;  3H0M C;  4H9R B;  4J8X C;  5B1M B;  4J8U D;  5AVC B;  5BT1 D;  1HQ3 A;  3WAA B;  3AZH A;  1P3B B;  3X1U D;  4YS3 D;  3WKJ B;  2NQB C;  4R8P D;  1U35 C;  3AZJ C;  4YM6 B;  4Z66 A;  3UTB B;  5F99 C;  1WWI A;  3AZN A;  5DNN A;  2Y2M A;  2Y2G A;  2NQB A;  1P3P C;  4ZBJ B;  5AV5 D;  4WU9 A;  5GXQ A;  4Z5T B;  4J8W A;  3X1V D;  3MNN B; 
#chains in the Genus database with same CATH homology
 1ULY A;  5GT0 C;  3AV1 C;  4UUZ B;  4H9Q A;  4JJN B;  3AZF A;  4H9R A;  5AV6 B;  1A7W A;  5AVC A;  5AV9 C;  1KX3 B;  3VH6 T;  1M1A C;  3WAA A;  3W96 A;  1KX5 C;  3B0C T;  1P3B A;  1P3O C;  2CV5 C;  3REL C;  5GT3 B;  3W99 A;  4LD9 D;  2HIO D;  3UTB A;  2W8S A;  2NZD B;  5BS7 A;  3MNN A;  1P3M B;  4KGC C;  3REI B;  4UUZ A;  4JJN A;  5B1L B;  3VH5 T;  5AY8 B;  2XD1 A;  4H9O B;  5AV6 A;  3REJ B;  2F8N B;  3AZI A;  2UWX A;  4J8V B;  3WTP B;  3AZL D;  3LEL C;  3AZE B;  3NQJ B;  4J8X B;  5CP6 D;  4CAY A;  5KDM B;  5GT3 A;  4X23 D;  2Y2I A;  3FDD A;  5B40 C;  2NZD A;  5AV8 D;  1PZR A;  5B2I C;  1P3A C;  3R45 B;  1ZLA C;  3WA9 C;  3LJA D;  4HGA B;  1EQZ D;  3KXB C;  2ZY3 A;  4E45 A;  3O62 D;  5B24 C;  3REI A;  3REH D;  5E5A C;  5F99 B;  5B1L A;  5AY8 A;  3MGS D;  1P3P B;  5B31 C;  3AFA C;  2FJ7 B;  3REJ A;  2F8N A;  2Y2K A;  1HQ3 D;  4DRB A;  1P3G C;  3AZH D;  4J8V A;  5B0Y B;  3MGR C;  5GT0 B;  3AYW A;  3WTP A;  3KFU G;  5CHL B;  5JA4 A;  5B0Z D;  3AZE A;  3B0C W;  3NQJ A;  2ARO D;  3KSY A;  3MVD C;  4J8X A;  4WU8 C;  5KDM A;  2ZM5 A;  3A6N C;  1M1A B;  3UT9 C;  3LZ1 D;  3AN2 B;  3R45 A;  2HUE B;  3AZK B;  3EG5 B;  3EPK A;  1P3F C;  3KUY C;  3W97 D;  3AZJ A;  5F99 A;  3REK C;  5B1M D;  5DNM C;  3UTA C;  5AVC D;  4E44 A;  1P3P A;  3H0L C;  2DF4 C;  4ZUX C;  5B33 B;  3LZ0 B;  3C1C C;  3WAA D;  5AVB B;  5GSU D;  1P3B D;  5B0Y A;  1N1J B;  5GT0 A;  3AV1 A;  3WKJ D;  2PYO C;  4YM6 D;  3UTB D;  1M1A A;  5CPI C;  2Y2J A;  1P3O A;  2XD5 A;  4Z5T D;  1P3I C;  1P3K C;  1ID3 C;  3REL A;  5BO0 B;  5CPJ D;  4JJN D;  4QLC B;  5B32 G;  1KX3 D;  5B33 A;  3MGP B;  5AVB A;  4KGC A;  1F66 D;  1TZY D;  4Z66 B;  3W98 D;  2NQB B;  1AOI B;  5B31 B;  1P3L B;  4WU9 B;  1S32 C;  3KWQ C;  1P3G B;  4J8W B;  3X1T B;  3P5J B;  3MGR B;  3AV2 B;  1P34 C;  4H9Q B;  3MVD B;  3AZF B;  1P3M D;  5G49 B;  5BO0 A;  3REI D;  5B40 A;  3VH6 A;  3UT9 B;  5B1L D;  5AY8 D;  5JRG D;  1P3A A;  1M18 C;  1ZLA A;  4QLC A;  3AZM D;  1KX4 C;  3W96 B;  3REJ D;  5CPK C;  4EO5 C;  3KUY B;  3MGP A;  4J8V D;  3H0R C;  3WTP D;  4J8U C;  2YFW B;  5B24 A;  3AZE D;  3W99 B;  5B2J B;  5BT1 C;  3B6G B;  4J8X D;  1AOI A;  2DQN C;  5B31 A;  3X1U C;  1P3L A;  4ZUX B;  2FFF B;  4YS3 C;  4XUJ D;  1P3G A;  4R8P C;  3X1T A;  2G5H C;  2Y2L A;  3MGR A;  3B6F C;  2BG1 A;  2PYO B;  3AV2 A;  3VH5 A;  3MVD A;  1H3O B;  5G49 A;  3B0B A;  3X1S C;  3AZI B;  3UT9 A;  3X1V C;  1P3P D;  2FJ7 D;  5C3I C;  3MGQ B;  3KUY A;  1P3K B;  1P3F A;  1ID3 B;  5B0Y D;  4CAY B;  2YFW A;  5B2J A;  3B6G A;  2LY8 A;  5DNM A;  3UTA A;  4ZUX A;  3AN2 D;  4XZQ D;  3AZK D;  4LD9 C;  2PYO A;  1T3U A;  2HIO C;  5B32 D;  1H3O A;  1W2E A;  1S32 B;  3KWQ B;  3C1B B;  3AYW B;  2RIQ A;  1M19 D;  5JA4 B;  5B33 D;  3LZ0 D;  3MGQ A;  1BH8 B;  5AVB D;  1P3I A;  1P3K A;  1ID3 A;  1KU5 A;  3AL0 C;  3EPJ A;  2J8P A;  1M18 B;  4G92 C;  1KX4 B;  3AZL C;  4EO5 B;  2RVQ D;  1U35 B;  3AZJ B;  4KUD D;  4X23 C;  5AV8 C;  3X1U B;  1S32 A;  4YS3 B;  3KWQ A;  1EQZ C;  4NE3 A;  3V9R B;  4R8P B;  3C1B A;  4QLC D;  3B6F B;  4WNN B;  3O62 C;  4G91 C;  2VQR A;  3AV1 B;  3REH C;  3MGP D;  1BH8 A;  2F8N G;  3MGS C;  3X1S B;  5AV9 B;  4Z66 D;  2IO5 C;  3AZN D;  5DNN D;  1M18 A;  1AOI D;  2NQB D;  3AZH C;  1B67 A;  1KX5 B;  1P3L D;  1P3O B;  4WU9 D;  1KX4 A;  5GXQ D;  2F8N H;  5B0Z C;  4J8W D;  3X1T D;  3REL B;  2CV5 B;  2ARO C;  3A1I A;  1U35 A;  3AV2 D;  3MVD D;  3AZF D;  3LZ1 C;  3X1U A;  4YS3 A;  3UT9 D;  3V9R A;  4R8P A;  3W96 D;  3TU4 C;  1JFI B;  1Q9C A;  3W97 C;  3B6F A;  4WNN A;  4KGC B;  4NFT A;  5B1M C;  3W99 D;  3X1S A;  5AV9 A;  5B2J D;  3AZG C;  3B6G D;  5GSU C;  1P3B C;  1KX5 A;  3LEL B;  3WKJ C;  2CV5 A;  3MNN D;  2PYO D;  5B40 B;  4YM6 C;  3UTB C;  4G92 B;  5B2I B;  5AV6 D;  1P3A B;  1ZLA B;  3WA9 B;  3AZL B;  4Z5T C;  3AZI D;  3KXB B;  1JFI A;  4WJ3 C;  5B24 B;  3MGQ D;  2G5I C;  5E5A B;  5CPJ C;  5AV8 B;  5GT3 D;  3NQU B;  3AFA B;  1KX3 C;  1EQZ B;  2NZD D;  3O62 B;  3LEL A;  1F66 C;  1TZY C;  4WU8 B;  2JE5 A;  3W98 C;  3MGS B;  2Y2H A;  3A6N B;  1Z2C B;  5B2I A;  2BYM A;  3WA9 A;  3AZL A;  2F8N D;  2JSS A;  5B0Z B;  1P3F B;  3KXB A;  3C1B D;  1BH9 B;  2ARO B;  3EPL A;  3AYW D;  1P3M C;  5E5A A;  5B1L C;  5AY8 C;  5JRG C;  5AV8 A;  3LZ1 B;  5DNM B;  3REK B;  3UTA B;  3NQU A;  3AFA A;  3REJ C;  3AZM C;  4Z2M G;  1EQZ A;  4H9P B;  3C1C B;  1M18 D;  4J8V C;  3TU4 B;  3W97 B;  1B6W A;  3O62 A;  3B0D C;  4H9N B;  5B31 G;  3REH A;  4WU8 A;  3MGS A;  4Z2M H;  1U35 D;  3AZJ D;  5AV5 C;  2ZY2 A;  3A6N A;  5F99 D;  3AZG B;  5CPI B;  3IP4 C;  4XUJ C;  5GSU B;  4AWL C;  4HGA C;  1R4V A;  5B0Z A;  1P3I B;  1BH9 A;  2ARO A;  3B6F D;  5GT0 D;  3AV1 D;  1F1E A;  3REK A;  3LZ1 A;  3X1S D;  5AV9 D;  2FJ7 C;  1M1A D;  2JCH A;  1TAF B;  4H9P A;  3C1C A;  3TU4 A;  5B0Y C;  3W97 A;  4WV4 B;  1P3O D;  1KX5 D;  4H9N A;  5CPJ B;  2CV5 D;  3REL D;  5B1M A;  1BFM A;  3AZG A;  5CPI A;  4WZS B;  5GSU A;  3AN2 C;  4XZQ C;  1F66 B;  2HUE C;  3AZK C;  3WKJ A;  1TZY B;  4DRA A;  1P34 B;  3W98 B;  5B32 C;  4KGC D;  4YM6 A;  4UPK A;  4KHA B;  5CPK B;  4Z5T A;  1M19 C;  5B33 C;  3LZ0 C;  1TAF A;  5AVB C;  5CP6 C;  3LEL D;  4J8U B;  2ZY5 A;  5CPJ A;  5JRG B;  3AZM B;  5B40 D;  1KX3 A;  3LJA C;  2RVQ C;  2F8N K;  5B2I D;  1P3A D;  1ZLA D;  3WA9 D;  3B0D B;  1F66 A;  4H9S C;  4KUD C;  1TZY A;  3KXB D;  1P34 A;  3W98 A;  5B24 D;  5AV5 B;  5E5A D;  2Y2O A;  4XUJ B;  1HQ3 C;  3X1V B;  4QLC C;  5B31 D;  4AWL B;  3AFA D;  4KHA A;  5C3I B;  5CPK A;  4NE6 A;  2Y2N A;  2YFV B;  1P3G D;  3MGP C;  3MGR D;  1P3M A;  4J8U A;  2CWE A;  4Z66 C;  4WU8 D;  3AZN C;  5DNN C;  2ZY4 A;  4M6B A;  5JRG A;  1AOI C;  3F6T A;  4H9O A;  3AZM A;  1P3L C;  4WU9 C;  5GXQ C;  3A6N D;  4J8W C;  3X1T C;  3EPH A;  3VH6 W;  4LD9 B;  1P3F D;  3KUY D;  3AV2 C;  2HIO B;  3AZF C;  5FUG B;  2L5A A;  1WWS A;  5AVC C;  5AV5 A;  5BNV B;  4XUJ A;  3WAA C;  3REK D;  3W96 C;  5DNM D;  3UTA D;  3X1V A;  2F2A C;  4XZQ B;  4ZUX D;  3C1C D;  2YFV A;  3TU4 D;  5B32 B;  3W99 C;  5B2J C;  3B6G C;  5BS7 C;  4ZBJ C;  2BYM B;  3AZG D;  2FJ7 A;  1M19 B;  5CPI D;  3VH5 W;  3MNN C;  5CP6 B;  4CSR B;  4X23 B;  1P3I D;  4LD9 A;  1P3K D;  1ID3 D;  2BYK B;  2HIO A;  4JJN C;  5FUG A;  5BNX B;  5AV6 C;  3A1K A;  3LJA B;  5BNV A;  3AZI C;  3AN2 A;  4XZQ A;  4G91 B;  4KUD B;  3AZK A;  3MGQ C;  3REH B;  5B32 A;  3WTP E;  2Y2Q A;  5GT3 C;  2IO5 B;  1HQ3 B;  2NZD C;  3AZH B;  1S32 D;  3KWQ D;  1M19 A;  3LZ0 A;  1N1J A;  4NE5 A;  5CP6 A;  4CSR A;  3REI C;  4X23 A;  1P34 D;  2BYK A;  3AZN B;  1HTA A;  5DNN B;  5BNX A;  5GXQ B;  2Y2P A;  3LJA A;  4DQY B;  3C1B C;  1KX4 D;  3AYW C;  3WTP C;  5CPK D;  4H9S A;  4KUD A;  3AZE C;  3H0M C;  4H9R B;  4J8X C;  5B1M B;  4J8U D;  5AVC B;  5BT1 D;  1HQ3 A;  3WAA B;  3AZH A;  1P3B B;  3X1U D;  4YS3 D;  3WKJ B;  2NQB C;  4R8P D;  1U35 C;  3AZJ C;  4YM6 B;  4Z66 A;  3UTB B;  5F99 C;  1WWI A;  3AZN A;  5DNN A;  2Y2M A;  2Y2G A;  2NQB A;  1P3P C;  4ZBJ B;  5AV5 D;  4WU9 A;  5GXQ A;  4Z5T B;  4J8W A;  3X1V D;  3MNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...