3KXBB

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
molecule keywords Histone H3.2
total genus 25
structure length 74
sequence length 74
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbB00
4XUJD 4ZUXC 5BNVA 2YFWA 2CV5A 4H9QB 5BS7A 4YM6A 2CWEA 3TU4A 2AROA 3REIC 3REJC 5KDMA 3AZJC 1ZLAD 4NE3A 1TZYC 3VH5T 5DNMD 5JRGA 3AZND 5DNNA 1P3LC 4WNNA 1AOIB 4J8XB 2NZDC 1P3OD 4EO5B 5B1LB 3AZMA 3LJAB 4XUJA 3C1CC 3O62D 4X23B 3KWQC 2IO5C 2AROD 5GT3C 4J8VB 4NE6A 3AYWC 3B0BA 4XZQB 3KWQB 1KX5A 3MGSB 5DNMB 1HQ3B 4YS3D 3W99B 5FUGB 3WA9A 3AZID 3C1CA 5B2JB 2NZDB 4ZUXD 3NQUB 1TZYA 3KXBA 3WAAB 3UTAC 1F66B 3X1SD 4H9NA 1KX5C 3AZIB 4ZUXB 3AZFB 1S32A 3X1TA 3AFAA 5CPKB 3X1UD 1BH9A 1H3OB 4CAYB 3X1UC 1P34C 2NQBA 3MGSD 1B6WA 3W99D 3AZGC 3RELA 3KSYA 3AV2D 2HUEB 4J8UB 5G49A 3UTBC 4Z66B 2FJ7A 4G92B 1F1EA 1P3KB 5B0ZA 1EQZB 1U35C 1P3ID 1KX4B 1ZLAC 3REJA 3X1TD 5AV6B 5B1LD 4E45A 1P3PD 4NE5A 3W96C 5GT0B 3C1BC 4AWLC 3AZNB 3AV2A 4J8XD 1ID3A 5E5AA 3WKJA 4UUZB 5CP6D 5B0YA 1P3AA 3AN2C 5GSUA 1N1JB 5B2JC 3LZ0B 4LD9A 3R45B 1B67A 1P3PA 4JJND 3LELD 4WU9A 2NZDD 2F8ND 3B6FD 1P3FA 1P3IA 4XUJC 1P3MB 3W98B 3VH5A 5CP6B 3AV1A 3AZEC 1A7WA 3VH6W 5AVBC 4R8PA 3AZKD 5AV8A 5B0YC 5JA4A 3MGRC 3UTBB 1M19A 4YM6D 1M18B 3LJAD 3VH6A 5BO0B 3TU4C 3RELC 2BYMA 3REHC 3MGQD 3REKB 5B40C 3AN2B 4H9SC 1P3OB 1P3BC 5GT3D 3X1VB 3AZFC 3WTPC 4WU9C 5B2IA 5AY8A 3AZKA 3AZMD 5GT0D 4KGCC 3LELC 3MGPD 1P3OC 3W98A 3REIA 1P3MA 4H9RB 5C3IB 1M18D 3AZGA 1M18C 1P3GC 1U35B 5BT1C 4ZBJC 3MGRB 4J8WC 1HQ3C 1P3BD 5B2JD 4J8UC 3R45A 4XZQC 3A6NC 5CPIA 3MNNB 4KHAB 3AYWB 1JFIB 2PYOC 1S32D 3AZEB 5B33B 1P3PC 2CV5D 3KXBC 3LJAC 3LZ1C 3W96D 1TAFB 5B40D 3REHD 5AV9C 4J8XC 3WAAC 1AOIC 3O62B 1U35D 3AFAD 1KX4D 3X1UA 5CPID 3REJB 3AZLD 1KX3B 3LZ0C 2BYKB 3B6GD 2HIOC 4WZSB 4JJNC 4YS3B 5AV8C 2FJ7D 5G49B 4J8UA 1P3GD 5AV9A 5E5AD 2NQBB 5B31A 4X23C 3AZEA 3AN2D 3AFAB 3WA9D 1JFIA 4WV4B 4QLCC 5CPIB 3AZIA 5AVCD 1EQZC 4LD9D 5B24D 2HIOA 1KX5D 2F8NH 4Z66D 4YS3A 1TZYB 1U35A 3B0CT 2HUEC 1P3AD 3AZGB 3AZHC 3REIB 1P34B 1KX3A 3X1UB 1HQ3D 4HGAC 3MGSA 5AVCA 1KX5B 3B0DC 5B24A 3WTPE 4J8VA 3X1VA 5AV8D 5B31D 3AN2A 1P3LD 2BYMB 5B33A 3AV1D 5BO0A 3AYWA 4Z5TC 3MNNA 3AZMB 5JA4B 3W99C 1AOIA 5JRGB 1P3FC 3MGRA 4CSRB 3AZMC 5GT3B 4J8VC 3X1VD 3REJD 3AV1B 5CP6A 5B0YD 3NQJA 3NQJB 5GSUD 1S32C 5GT3A 5AY8C 3AV2C 1P3IB 3TU4D 4CSRA 4KUDD 4EO5C 1ID3D 1P3KD 5B2IB 1AOID 5F99B 2F8NA 3AZJB 1P3FD 1P3OA 4DRAA 3W98D 3AYWD 3UTAD 1M18A 2LY8A 5B31G 1BH8B 1P3AB 3WKJB 1ZLAA 3UTBA 2FJ7C 5B2IC 3B6GC 1ID3B 5B24B 4R8PB 4Z5TD 3A6NA 5AVCB 3UT9B 3AZHA 3WAAD 3B6FC 5B1MC 1M1AD 3AFAC 5AV6A 3MGPB 1P34A 2NQBC 3LZ0D 1EQZA 4R8PC 3AZJD 1P3FB 5F99D 4H9PA 3KXBD 4LD9C 2FJ7B 5B0ZC 2HIOB 5AY8D 5GXQC 5AV5B 4KUDC 3AZHD 1BH9B 4CAYA 4X23D 1N1JA 3X1TB 5CPKA 5B31B 4ZUXA 3V9RA 3UTBD 3MGQC 4UUZA 5AV9B 5E5AB 1EQZD 2NQBD 1F66A 3AV2B 1P3IC 2HIOD 5JRGD 3AZNA 5GT0A 3KXBB 4G91C 3NQUA 2BYKA 5B2JA 2RVQC 4QLCA 3W97B 3AZLB 1M19C 1KX3D 3W99A 3RELD 5B0ZB 3O62A 5DNMA 4Z66A 3W96A 1TAFA 2F8NK 5CPIC 5AVBD 3AZKC 3WKJD 3AZFA 4KHAA 2CV5C 3MNND 3B0CW 4J8WD 4J8XA 5B1MA 1P3BB 4XZQD 5KDMB 2NZDA 2AROB 3TU4B 4H9RA 4H9QA 4YM6B 5F99C 3WA9B 4M6BA 3AZKB 4WU8C 3KWQA 5CPJA 5AY8B 5B1MD 5B33C 5CP6C 3REKA 3W98C 1P3MC 3AZFD 4XUJB 1WWIA 3LJAA 3AZLC 1M19B 3X1SB 5JRGC 5B1LA 5AV8B 4R8PD 4YS3C 4JJNB 5DNNB 1BFMA 2L5AA 5GXQD 1HTAA 3WTPA 4Z5TB 5B0ZD 1ULYA 5C3IC 1M19D 1KX3C 3W97D 1M1AA 3MVDA 3KUYA 2YFWB 3O62C 3MGQA 5B33D 4KGCB 1WWSA 2YFVB 1P3MD 3LZ1B 3A6ND 4WU9B 4KUDB 3X1VC 4J8VD 4HGAB 3VH5W 3LELA 5DNND 5DNNC 3REKC 1P3PB 1P3LA 4LD9B 4NFTA 3LZ0A 1KU5A 2F8NG 5GSUB 3MVDD 3MVDC 1M1AC 5AV5D 5B0YB 1P3KC 4G92C 2JSSA 4ZBJB 4WU9D 4KUDA 4E44A 3B6FA 4WU8B 5B24C 3B6GB 5CPKC 5CPKD 1KX4A 3MVDB 5GSUC 1P3AC 1M1AB 5BS7C 4YM6C 3UT9D 1F66D 3W97C 5CHLB 3C1CD 1P3KA 5B40A 3WTPB 3REHA 3C1BA 3RELB 4J8UD 4QLCD 3X1SA 3UTAA 1H3OA 1S32B 1P34D 1TZYD 5DNMC 5AVBB 4H9NB 3AZGD 5B2ID 1P3GA 4H9OA 3VH6T 5AV5C 3WAAA 5AV9D 5GXQB 2PYOB 3C1CB 3X1SC 5FUGA 2PYOA 3MGPC 1HQ3A 1P3BA 4G91B 4XZQA 5B1MB 1P3GB 3UT9C 3B0DB 4X23A 5E5AC 5B32G 3WA9C 2AROC 2PYOD 3AZNC 5GT0C 3C1BB 4WNNB 4AWLB 3W96B 5B40B 3REHB 5AV6C 4Z2MG 2RVQD 3AZLA 2CV5B 4H9SA 5BNVB 3W97A 3AZED 4QLCB 3B6GA 5GXQA 3B6FB 3WTPD 4H9OB 5AVCC 5AVBA 3KUYC 3KUYD 3V9RB 3WKJC 5B32B 5BNXA 3AZIC 3UTAB 1F66C 4WU8D 4J8WA 5AV5A 5BT1D 4Z2MH 3KWQD 4H9PB 5B32C 5B32D 4KGCA 3MGQB 3REKD 5AV6D 3MGPA 3KUYB 5B31C 3X1TC 3MGSC 3AV1C 1Q9CA 4DRBA 4WU8A 5CPJD 3AZHB 3UT9A 4Z5TA 3MNNC 5CPJC 3LZ1D 2IO5B 3A6NB 4JJNA 4J8WB 1KX4C 1ZLAB 1R4VA 1BH8A 3REID 5BNXB 5B1LC 5B32A 4KGCD 3AZJA 5F99A 4Z66C 2F8NB 1P3LB 3LELB 3MGRD 3C1BD 5CPJB 3LZ1A 1ID3C 2YFVA
chains in the Genus database with same CATH superfamily
4XUJD 4ZUXC 5BNVA 2YFWA 2CV5A 4H9QB 5BS7A 4YM6A 2CWEA 3TU4A 2AROA 3REIC 3REJC 5KDMA 3AZJC 1ZLAD 2Y2HA 1TZYC 4NE3A 3VH5T 5DNMD 5JRGA 5DNNA 3AZND 4WNNA 1P3LC 2FFFB 4J8XB 1AOIB 2NZDC 1P3OD 4EO5B 5B1LB 3AZMA 3LJAB 4XUJA 3C1CC 3O62D 4X23B 2Y2MA 3KWQC 2IO5C 2AROD 5GT3C 4J8VB 4NE6A 3AYWC 3B0BA 4XZQB 3KWQB 1KX5A 3MGSB 5DNMB 1HQ3B 4YS3D 3W99B 5FUGB 3WA9A 2F2AC 3AZID 3C1CA 5B2JB 2NZDB 4ZUXD 3NQUB 1TZYA 3KXBA 2XD5A 3WAAB 3UTAC 1F66B 3X1SD 4H9NA 3EPKA 3AZIB 1KX5C 4ZUXB 3AZFB 1S32A 3X1TA 3AFAA 5CPKB 3X1UD 1BH9A 1H3OB 4CAYB 3X1UC 2Y2GA 1P34C 2NQBA 3MGSD 2ZY4A 1B6WA 2Y2JA 3W99D 3AZGC 3RELA 3KSYA 3AV2D 2HUEB 4J8UB 5G49A 3UTBC 4Z66B 2FJ7A 4G92B 1F1EA 1P3KB 5B0ZA 1EQZB 1U35C 1P3ID 1KX4B 1ZLAC 3REJA 3X1TD 5AV6B 5B1LD 2Y2LA 4E45A 1P3PD 4NE5A 3W96C 5GT0B 3C1BC 3IP4C 4AWLC 3AZNB 3AV2A 4J8XD 1ID3A 5E5AA 2Y2KA 3WKJA 4UUZB 5CP6D 5B0YA 1P3AA 3AN2C 5GSUA 1N1JB 5B2JC 3LZ0B 2DQNC 4LD9A 3R45B 1B67A 1P3PA 4JJND 3LELD 4WU9A 2NZDD 2F8ND 3B6FD 1P3FA 1P3IA 4XUJC 1P3MB 3W98B 3VH5A 5CP6B 3AV1A 3AZEC 2J8PA 1A7WA 3H0LC 3VH6W 5AVBC 4R8PA 3AZKD 5AV8A 3P5JB 5B0YC 3H0MC 5JA4A 3MGRC 3UTBB 1M19A 4YM6D 1M18B 3LJAD 3VH6A 5BO0B 3TU4C 3RELC 2BYMA 3REHC 3MGQD 3REKB 5B40C 3AN2B 4H9SC 1P3OB 1P3BC 5GT3D 3X1VB 3AZFC 3WTPC 4WU9C 5B2IA 5AY8A 4UPKA 3AZKA 3AZMD 5GT0D 4KGCC 3LELC 3MGPD 1P3OC 2XD1A 3REIA 1P3MA 3W98A 4H9RB 5C3IB 1M18D 3AZGA 1M18C 1P3GC 1U35B 5BT1C 4ZBJC 3MGRB 4J8WC 1HQ3C 1P3BD 5B2JD 4J8UC 3R45A 4XZQC 3A6NC 5CPIA 3MNNB 4KHAB 3AYWB 1JFIB 2PYOC 1S32D 3AZEB 5B33B 1P3PC 2CV5D 3KXBC 3LJAC 3LZ1C 3W96D 1TAFB 5B40D 3REHD 3F6TA 5AV9C 4J8XC 3WAAC 1AOIC 3O62B 1U35D 3AFAD 1KX4D 3X1UA 5CPID 3REJB 3AZLD 1KX3B 3LZ0C 2BYKB 3B6GD 2HIOC 2ZY3A 4WZSB 4JJNC 4YS3B 5AV8C 3EPLA 2FJ7D 5G49B 4J8UA 1P3GD 5AV9A 5E5AD 2NQBB 5B31A 4X23C 3AZEA 3AN2D 3AFAB 3WA9D 1JFIA 4WV4B 4QLCC 5CPIB 3AZIA 5AVCD 1EQZC 4LD9D 5B24D 2HIOA 1KX5D 2F8NH 4Z66D 4YS3A 1TZYB 1U35A 2HUEC 3B0CT 1P3AD 3AZGB 3AZHC 3REIB 1P34B 1KX3A 3X1UB 1HQ3D 4HGAC 3MGSA 2UWXA 5AVCA 1KX5B 3B0DC 5B24A 3WTPE 4J8VA 3X1VA 5AV8D 5B31D 3AN2A 1P3LD 2BYMB 5B33A 3AV1D 5BO0A 1T3UA 3AYWA 4Z5TC 3MNNA 3AZMB 5JA4B 3W99C 1AOIA 5JRGB 1P3FC 3MGRA 4CSRB 3AZMC 5GT3B 4J8VC 3X1VD 3REJD 3AV1B 5CP6A 5B0YD 3NQJA 3NQJB 5GSUD 1S32C 5GT3A 5AY8C 3AV2C 1P3IB 3TU4D 4CSRA 4KUDD 4EO5C 1ID3D 1P3KD 3A1KA 5B2IB 1AOID 5F99B 2F8NA 3AZJB 1P3FD 1P3OA 4DRAA 3W98D 3EPJA 3AYWD 3UTAD 1M18A 2LY8A 5B31G 1BH8B 1P3AB 3WKJB 1ZLAA 3UTBA 2FJ7C 5B2IC 3B6GC 1ID3B 5B24B 4R8PB 4Z5TD 3A6NA 5AVCB 3UT9B 3AZHA 3WAAD 3B6FC 5B1MC 1M1AD 3AFAC 2VQRA 5AV6A 3MGPB 1P34A 2NQBC 3LZ0D 2JCHA 1EQZA 4R8PC 3AZJD 1P3FB 5F99D 4H9PA 3KXBD 4LD9C 2FJ7B 5B0ZC 2HIOB 5AY8D 5GXQC 5AV5B 3A1IA 3AZHD 4KUDC 1BH9B 4CAYA 4X23D 1N1JA 3X1TB 5CPKA 5B31B 3H0RC 4ZUXA 3V9RA 3UTBD 3MGQC 4UUZA 5AV9B 5E5AB 1EQZD 2NQBD 1F66A 3AV2B 1P3IC 2HIOD 5JRGD 2ZY5A 5GT0A 3AZNA 3KXBB 4G91C 3NQUA 2BYKA 5B2JA 2RVQC 4QLCA 3W97B 3AZLB 1M19C 1KX3D 3W99A 3RELD 2Y2OA 5B0ZB 3O62A 5DNMA 2W8SA 4Z66A 3W96A 1TAFA 2ZY2A 2F8NK 5CPIC 5AVBD 3AZKC 3WKJD 3AZFA 4KHAA 2CV5C 3MNND 3B0CW 4J8WD 4J8XA 5B1MA 1P3BB 4XZQD 5KDMB 3EPHA 2NZDA 2AROB 3TU4B 4H9RA 4H9QA 4YM6B 5F99C 3WA9B 4M6BA 3AZKB 2ZM5A 4WU8C 3KWQA 5CPJA 5AY8B 5B1MD 5B33C 5CP6C 3REKA 2Y2PA 3W98C 1P3MC 3AZFD 4XUJB 1Z2CB 1WWIA 3LJAA 3AZLC 1M19B 3X1SB 5JRGC 5B1LA 5AV8B 4R8PD 4YS3C 4JJNB 2DF4C 5DNNB 1BFMA 2L5AA 5GXQD 1HTAA 3WTPA 4Z5TB 5B0ZD 1ULYA 5C3IC 1M19D 1KX3C 3W97D 1M1AA 3MVDA 3KUYA 2YFWB 3O62C 3MGQA 5B33D 4KGCB 1WWSA 2YFVB 1P3MD 3LZ1B 3A6ND 4WU9B 4KUDB 3X1VC 4J8VD 4HGAB 3VH5W 3LELA 5DNND 5DNNC 3REKC 1P3PB 1P3LA 4LD9B 4NFTA 3LZ0A 1KU5A 2F8NG 5GSUB 3MVDD 3MVDC 1M1AC 5AV5D 5B0YB 1P3KC 4G92C 2JSSA 4ZBJB 4WU9D 4KUDA 4E44A 3B6FA 4WU8B 5B24C 3B6GB 5CPKC 5CPKD 1KX4A 3MVDB 5GSUC 1P3AC 1M1AB 3EG5B 5BS7C 4YM6C 3UT9D 1F66D 3W97C 5CHLB 3C1CD 1P3KA 5B40A 3WTPB 3REHA 3FDDA 3C1BA 3RELB 4J8UD 4QLCD 3X1SA 3UTAA 1H3OA 1S32B 1P34D 1TZYD 5DNMC 5AVBB 2Y2QA 4H9NB 3AZGD 5B2ID 1P3GA 4H9OA 3VH6T 5AV5C 3WAAA 5AV9D 5GXQB 2PYOB 1PZRA 3C1CB 3X1SC 3AL0C 5FUGA 2PYOA 3MGPC 1HQ3A 1P3BA 4G91B 4XZQA 5B1MB 1P3GB 3UT9C 3B0DB 4X23A 5E5AC 1W2EA 5B32G 4DQYB 3WA9C 2AROC 2PYOD 3AZNC 5GT0C 3C1BB 4WNNB 4AWLB 3W96B 5B40B 3REHB 5AV6C 4Z2MG 2RVQD 3AZLA 2CV5B 4H9SA 5BNVB 3W97A 3AZED 4QLCB 2G5HC 3B6GA 5GXQA 3B6FB 3WTPD 4H9OB 5AVCC 5AVBA 3KUYC 3KUYD 3V9RB 3WKJC 5B32B 5BNXA 3AZIC 3UTAB 1F66C 4WU8D 4J8WA 5AV5A 5BT1D 4Z2MH 2BG1A 3KWQD 4H9PB 4WJ3C 3KFUG 5B32C 5B32D 4KGCA 3MGQB 3REKD 5AV6D 3MGPA 3KUYB 5B31C 2RIQA 3X1TC 3MGSC 3AV1C 1Q9CA 4DRBA 4WU8A 5CPJD 3AZHB 3UT9A 4Z5TA 2Y2IA 3MNNC 5CPJC 3LZ1D 2IO5B 3A6NB 4JJNA 2Y2NA 2G5IC 4J8WB 2JE5A 1KX4C 1ZLAB 1R4VA 1BH8A 3REID 5BNXB 5B1LC 5B32A 4KGCD 3AZJA 5F99A 4Z66C 2F8NB 1P3LB 3LELB 3MGRD 3C1BD 5CPJB 3LZ1A 1ID3C 2YFVA
chains in the Genus database with same CATH topology
4XUJD 4ZUXC 5BNVA 2YFWA 2CV5A 4H9QB 5BS7A 4YM6A 2CWEA 3TU4A 2AROA 3REIC 3REJC 5KDMA 3AZJC 1ZLAD 2Y2HA 1TZYC 4NE3A 3VH5T 5DNMD 5JRGA 5DNNA 3AZND 4WNNA 1P3LC 2FFFB 4J8XB 1AOIB 2NZDC 1P3OD 4EO5B 5B1LB 3AZMA 3LJAB 4XUJA 3C1CC 3O62D 4X23B 2Y2MA 3KWQC 2IO5C 2AROD 5GT3C 4J8VB 4NE6A 3AYWC 3B0BA 4XZQB 3KWQB 1KX5A 3MGSB 5DNMB 1HQ3B 4YS3D 3W99B 5FUGB 3WA9A 2F2AC 3AZID 3C1CA 5B2JB 2NZDB 4ZUXD 3NQUB 1TZYA 3KXBA 2XD5A 3WAAB 3UTAC 1F66B 3X1SD 4H9NA 3EPKA 3AZIB 1KX5C 4ZUXB 3AZFB 1S32A 3X1TA 3AFAA 5CPKB 3X1UD 1BH9A 1H3OB 4CAYB 3X1UC 2Y2GA 1P34C 2NQBA 3MGSD 2ZY4A 1B6WA 2Y2JA 3W99D 3AZGC 3RELA 3KSYA 3AV2D 2HUEB 4J8UB 5G49A 3UTBC 4Z66B 2FJ7A 4G92B 1F1EA 1P3KB 5B0ZA 1EQZB 1U35C 1P3ID 1KX4B 1ZLAC 3REJA 3X1TD 5AV6B 5B1LD 2Y2LA 4E45A 1P3PD 4NE5A 3W96C 5GT0B 3C1BC 3IP4C 4AWLC 3AZNB 3AV2A 4J8XD 1ID3A 5E5AA 2Y2KA 3WKJA 4UUZB 5CP6D 5B0YA 1P3AA 3AN2C 5GSUA 1N1JB 5B2JC 3LZ0B 2DQNC 4LD9A 3R45B 1B67A 1P3PA 4JJND 3LELD 4WU9A 2NZDD 2F8ND 3B6FD 1P3FA 1P3IA 4XUJC 1P3MB 3W98B 3VH5A 5CP6B 3AV1A 3AZEC 2J8PA 1A7WA 3H0LC 3VH6W 5AVBC 4R8PA 3AZKD 5AV8A 3P5JB 5B0YC 3H0MC 5JA4A 3MGRC 3UTBB 1M19A 4YM6D 1M18B 3LJAD 3VH6A 5BO0B 3TU4C 3RELC 2BYMA 3REHC 3MGQD 3REKB 5B40C 3AN2B 4H9SC 1P3OB 1P3BC 5GT3D 3X1VB 3AZFC 3WTPC 4WU9C 5B2IA 5AY8A 4UPKA 3AZKA 3AZMD 5GT0D 4KGCC 3LELC 3MGPD 1P3OC 2XD1A 3REIA 1P3MA 3W98A 4H9RB 5C3IB 1M18D 3AZGA 1M18C 1P3GC 1U35B 5BT1C 4ZBJC 3MGRB 4J8WC 1HQ3C 1P3BD 5B2JD 4J8UC 3R45A 4XZQC 3A6NC 5CPIA 3MNNB 4KHAB 3AYWB 1JFIB 2PYOC 1S32D 3AZEB 5B33B 1P3PC 2CV5D 3KXBC 3LJAC 3LZ1C 3W96D 1TAFB 5B40D 3REHD 3F6TA 5AV9C 4J8XC 3WAAC 1AOIC 3O62B 1U35D 3AFAD 1KX4D 3X1UA 5CPID 3REJB 3AZLD 1KX3B 3LZ0C 2BYKB 3B6GD 2HIOC 2ZY3A 4WZSB 4JJNC 4YS3B 5AV8C 3EPLA 2FJ7D 5G49B 4J8UA 1P3GD 5AV9A 5E5AD 2NQBB 5B31A 4X23C 3AZEA 3AN2D 3AFAB 3WA9D 1JFIA 4WV4B 4QLCC 5CPIB 3AZIA 5AVCD 1EQZC 4LD9D 5B24D 2HIOA 1KX5D 2F8NH 4Z66D 4YS3A 1TZYB 1U35A 2HUEC 3B0CT 1P3AD 3AZGB 3AZHC 3REIB 1P34B 1KX3A 3X1UB 1HQ3D 4HGAC 3MGSA 2UWXA 5AVCA 1KX5B 3B0DC 5B24A 3WTPE 4J8VA 3X1VA 5AV8D 5B31D 3AN2A 1P3LD 2BYMB 5B33A 3AV1D 5BO0A 1T3UA 3AYWA 4Z5TC 3MNNA 3AZMB 5JA4B 3W99C 1AOIA 5JRGB 1P3FC 3MGRA 4CSRB 3AZMC 5GT3B 4J8VC 3X1VD 3REJD 3AV1B 5CP6A 5B0YD 3NQJA 3NQJB 5GSUD 1S32C 5GT3A 5AY8C 3AV2C 1P3IB 3TU4D 4CSRA 4KUDD 4EO5C 1ID3D 1P3KD 3A1KA 5B2IB 1AOID 5F99B 2F8NA 3AZJB 1P3FD 1P3OA 4DRAA 3W98D 3EPJA 3AYWD 3UTAD 1M18A 2LY8A 5B31G 1BH8B 1P3AB 3WKJB 1ZLAA 3UTBA 2FJ7C 5B2IC 3B6GC 1ID3B 5B24B 4R8PB 4Z5TD 3A6NA 5AVCB 3UT9B 3AZHA 3WAAD 3B6FC 5B1MC 1M1AD 3AFAC 2VQRA 5AV6A 3MGPB 1P34A 2NQBC 3LZ0D 2JCHA 1EQZA 4R8PC 3AZJD 1P3FB 5F99D 4H9PA 3KXBD 4LD9C 2FJ7B 5B0ZC 2HIOB 5AY8D 5GXQC 5AV5B 3A1IA 3AZHD 4KUDC 1BH9B 4CAYA 4X23D 1N1JA 3X1TB 5CPKA 5B31B 3H0RC 4ZUXA 3V9RA 3UTBD 3MGQC 4UUZA 5AV9B 5E5AB 1EQZD 2NQBD 1F66A 3AV2B 1P3IC 2HIOD 5JRGD 2ZY5A 5GT0A 3AZNA 3KXBB 4G91C 3NQUA 2BYKA 5B2JA 2RVQC 4QLCA 3W97B 3AZLB 1M19C 1KX3D 3W99A 3RELD 2Y2OA 5B0ZB 3O62A 5DNMA 2W8SA 4Z66A 3W96A 1TAFA 2ZY2A 2F8NK 5CPIC 5AVBD 3AZKC 3WKJD 3AZFA 4KHAA 2CV5C 3MNND 3B0CW 4J8WD 4J8XA 5B1MA 1P3BB 4XZQD 5KDMB 3EPHA 2NZDA 2AROB 3TU4B 4H9RA 4H9QA 4YM6B 5F99C 3WA9B 4M6BA 3AZKB 2ZM5A 4WU8C 3KWQA 5CPJA 5AY8B 5B1MD 5B33C 5CP6C 3REKA 2Y2PA 3W98C 1P3MC 3AZFD 4XUJB 1Z2CB 1WWIA 3LJAA 3AZLC 1M19B 3X1SB 5JRGC 5B1LA 5AV8B 4R8PD 4YS3C 4JJNB 2DF4C 5DNNB 1BFMA 2L5AA 5GXQD 1HTAA 3WTPA 4Z5TB 5B0ZD 1ULYA 5C3IC 1M19D 1KX3C 3W97D 1M1AA 3MVDA 3KUYA 2YFWB 3O62C 3MGQA 5B33D 4KGCB 1WWSA 2YFVB 1P3MD 3LZ1B 3A6ND 4WU9B 4KUDB 3X1VC 4J8VD 4HGAB 3VH5W 3LELA 5DNND 5DNNC 3REKC 1P3PB 1P3LA 4LD9B 4NFTA 3LZ0A 1KU5A 2F8NG 5GSUB 3MVDD 3MVDC 1M1AC 5AV5D 5B0YB 1P3KC 4G92C 2JSSA 4ZBJB 4WU9D 4KUDA 4E44A 3B6FA 4WU8B 5B24C 3B6GB 5CPKC 5CPKD 1KX4A 3MVDB 5GSUC 1P3AC 1M1AB 3EG5B 5BS7C 4YM6C 3UT9D 1F66D 3W97C 5CHLB 3C1CD 1P3KA 5B40A 3WTPB 3REHA 3FDDA 3C1BA 3RELB 4J8UD 4QLCD 3X1SA 3UTAA 1H3OA 1S32B 1P34D 1TZYD 5DNMC 5AVBB 2Y2QA 4H9NB 3AZGD 5B2ID 1P3GA 4H9OA 3VH6T 5AV5C 3WAAA 5AV9D 5GXQB 2PYOB 1PZRA 3C1CB 3X1SC 3AL0C 5FUGA 2PYOA 3MGPC 1HQ3A 1P3BA 4G91B 4XZQA 5B1MB 1P3GB 3UT9C 3B0DB 4X23A 5E5AC 1W2EA 5B32G 4DQYB 3WA9C 2AROC 2PYOD 3AZNC 5GT0C 3C1BB 4WNNB 4AWLB 3W96B 5B40B 3REHB 5AV6C 4Z2MG 2RVQD 3AZLA 2CV5B 4H9SA 5BNVB 3W97A 3AZED 4QLCB 2G5HC 3B6GA 5GXQA 3B6FB 3WTPD 4H9OB 5AVCC 5AVBA 3KUYC 3KUYD 3V9RB 3WKJC 5B32B 5BNXA 3AZIC 3UTAB 1F66C 4WU8D 4J8WA 5AV5A 5BT1D 4Z2MH 2BG1A 3KWQD 4H9PB 4WJ3C 3KFUG 5B32C 5B32D 4KGCA 3MGQB 3REKD 5AV6D 3MGPA 3KUYB 5B31C 2RIQA 3X1TC 3MGSC 3AV1C 1Q9CA 4DRBA 4WU8A 5CPJD 3AZHB 3UT9A 4Z5TA 2Y2IA 3MNNC 5CPJC 3LZ1D 2IO5B 3A6NB 4JJNA 2Y2NA 2G5IC 4J8WB 2JE5A 1KX4C 1ZLAB 1R4VA 1BH8A 3REID 5BNXB 5B1LC 5B32A 4KGCD 3AZJA 5F99A 4Z66C 2F8NB 1P3LB 3LELB 3MGRD 3C1BD 5CPJB 3LZ1A 1ID3C 2YFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ D;  4ZUX C;  5BNV A;  2YFW A;  2CV5 A;  4H9Q B;  5BS7 A;  4YM6 A;  2CWE A;  3TU4 A;  2ARO A;  3REI C;  3REJ C;  5KDM A;  3AZJ C;  1ZLA D;  4NE3 A;  1TZY C;  3VH5 T;  5DNM D;  5JRG A;  3AZN D;  5DNN A;  1P3L C;  4WNN A;  1AOI B;  4J8X B;  2NZD C;  1P3O D;  4EO5 B;  5B1L B;  3AZM A;  3LJA B;  4XUJ A;  3C1C C;  3O62 D;  4X23 B;  3KWQ C;  2IO5 C;  2ARO D;  5GT3 C;  4J8V B;  4NE6 A;  3AYW C;  3B0B A;  4XZQ B;  3KWQ B;  1KX5 A;  3MGS B;  5DNM B;  1HQ3 B;  4YS3 D;  3W99 B;  5FUG B;  3WA9 A;  3AZI D;  3C1C A;  5B2J B;  2NZD B;  4ZUX D;  3NQU B;  1TZY A;  3KXB A;  3WAA B;  3UTA C;  1F66 B;  3X1S D;  4H9N A;  1KX5 C;  3AZI B;  4ZUX B;  3AZF B;  1S32 A;  3X1T A;  3AFA A;  5CPK B;  3X1U D;  1BH9 A;  1H3O B;  4CAY B;  3X1U C;  1P34 C;  2NQB A;  3MGS D;  1B6W A;  3W99 D;  3AZG C;  3REL A;  3KSY A;  3AV2 D;  2HUE B;  4J8U B;  5G49 A;  3UTB C;  4Z66 B;  2FJ7 A;  4G92 B;  1F1E A;  1P3K B;  5B0Z A;  1EQZ B;  1U35 C;  1P3I D;  1KX4 B;  1ZLA C;  3REJ A;  3X1T D;  5AV6 B;  5B1L D;  4E45 A;  1P3P D;  4NE5 A;  3W96 C;  5GT0 B;  3C1B C;  4AWL C;  3AZN B;  3AV2 A;  4J8X D;  1ID3 A;  5E5A A;  3WKJ A;  4UUZ B;  5CP6 D;  5B0Y A;  1P3A A;  3AN2 C;  5GSU A;  1N1J B;  5B2J C;  3LZ0 B;  4LD9 A;  3R45 B;  1B67 A;  1P3P A;  4JJN D;  3LEL D;  4WU9 A;  2NZD D;  2F8N D;  3B6F D;  1P3F A;  1P3I A;  4XUJ C;  1P3M B;  3W98 B;  3VH5 A;  5CP6 B;  3AV1 A;  3AZE C;  1A7W A;  3VH6 W;  5AVB C;  4R8P A;  3AZK D;  5AV8 A;  5B0Y C;  5JA4 A;  3MGR C;  3UTB B;  1M19 A;  4YM6 D;  1M18 B;  3LJA D;  3VH6 A;  5BO0 B;  3TU4 C;  3REL C;  2BYM A;  3REH C;  3MGQ D;  3REK B;  5B40 C;  3AN2 B;  4H9S C;  1P3O B;  1P3B C;  5GT3 D;  3X1V B;  3AZF C;  3WTP C;  4WU9 C;  5B2I A;  5AY8 A;  3AZK A;  3AZM D;  5GT0 D;  4KGC C;  3LEL C;  3MGP D;  1P3O C;  3W98 A;  3REI A;  1P3M A;  4H9R B;  5C3I B;  1M18 D;  3AZG A;  1M18 C;  1P3G C;  1U35 B;  5BT1 C;  4ZBJ C;  3MGR B;  4J8W C;  1HQ3 C;  1P3B D;  5B2J D;  4J8U C;  3R45 A;  4XZQ C;  3A6N C;  5CPI A;  3MNN B;  4KHA B;  3AYW B;  1JFI B;  2PYO C;  1S32 D;  3AZE B;  5B33 B;  1P3P C;  2CV5 D;  3KXB C;  3LJA C;  3LZ1 C;  3W96 D;  1TAF B;  5B40 D;  3REH D;  5AV9 C;  4J8X C;  3WAA C;  1AOI C;  3O62 B;  1U35 D;  3AFA D;  1KX4 D;  3X1U A;  5CPI D;  3REJ B;  3AZL D;  1KX3 B;  3LZ0 C;  2BYK B;  3B6G D;  2HIO C;  4WZS B;  4JJN C;  4YS3 B;  5AV8 C;  2FJ7 D;  5G49 B;  4J8U A;  1P3G D;  5AV9 A;  5E5A D;  2NQB B;  5B31 A;  4X23 C;  3AZE A;  3AN2 D;  3AFA B;  3WA9 D;  1JFI A;  4WV4 B;  4QLC C;  5CPI B;  3AZI A;  5AVC D;  1EQZ C;  4LD9 D;  5B24 D;  2HIO A;  1KX5 D;  2F8N H;  4Z66 D;  4YS3 A;  1TZY B;  1U35 A;  3B0C T;  2HUE C;  1P3A D;  3AZG B;  3AZH C;  3REI B;  1P34 B;  1KX3 A;  3X1U B;  1HQ3 D;  4HGA C;  3MGS A;  5AVC A;  1KX5 B;  3B0D C;  5B24 A;  3WTP E;  4J8V A;  3X1V A;  5AV8 D;  5B31 D;  3AN2 A;  1P3L D;  2BYM B;  5B33 A;  3AV1 D;  5BO0 A;  3AYW A;  4Z5T C;  3MNN A;  3AZM B;  5JA4 B;  3W99 C;  1AOI A;  5JRG B;  1P3F C;  3MGR A;  4CSR B;  3AZM C;  5GT3 B;  4J8V C;  3X1V D;  3REJ D;  3AV1 B;  5CP6 A;  5B0Y D;  3NQJ A;  3NQJ B;  5GSU D;  1S32 C;  5GT3 A;  5AY8 C;  3AV2 C;  1P3I B;  3TU4 D;  4CSR A;  4KUD D;  4EO5 C;  1ID3 D;  1P3K D;  5B2I B;  1AOI D;  5F99 B;  2F8N A;  3AZJ B;  1P3F D;  1P3O A;  4DRA A;  3W98 D;  3AYW D;  3UTA D;  1M18 A;  2LY8 A;  5B31 G;  1BH8 B;  1P3A B;  3WKJ B;  1ZLA A;  3UTB A;  2FJ7 C;  5B2I C;  3B6G C;  1ID3 B;  5B24 B;  4R8P B;  4Z5T D;  3A6N A;  5AVC B;  3UT9 B;  3AZH A;  3WAA D;  3B6F C;  5B1M C;  1M1A D;  3AFA C;  5AV6 A;  3MGP B;  1P34 A;  2NQB C;  3LZ0 D;  1EQZ A;  4R8P C;  3AZJ D;  1P3F B;  5F99 D;  4H9P A;  3KXB D;  4LD9 C;  2FJ7 B;  5B0Z C;  2HIO B;  5AY8 D;  5GXQ C;  5AV5 B;  4KUD C;  3AZH D;  1BH9 B;  4CAY A;  4X23 D;  1N1J A;  3X1T B;  5CPK A;  5B31 B;  4ZUX A;  3V9R A;  3UTB D;  3MGQ C;  4UUZ A;  5AV9 B;  5E5A B;  1EQZ D;  2NQB D;  1F66 A;  3AV2 B;  1P3I C;  2HIO D;  5JRG D;  3AZN A;  5GT0 A;  3KXB B;  4G91 C;  3NQU A;  2BYK A;  5B2J A;  2RVQ C;  4QLC A;  3W97 B;  3AZL B;  1M19 C;  1KX3 D;  3W99 A;  3REL D;  5B0Z B;  3O62 A;  5DNM A;  4Z66 A;  3W96 A;  1TAF A;  2F8N K;  5CPI C;  5AVB D;  3AZK C;  3WKJ D;  3AZF A;  4KHA A;  2CV5 C;  3MNN D;  3B0C W;  4J8W D;  4J8X A;  5B1M A;  1P3B B;  4XZQ D;  5KDM B;  2NZD A;  2ARO B;  3TU4 B;  4H9R A;  4H9Q A;  4YM6 B;  5F99 C;  3WA9 B;  4M6B A;  3AZK B;  4WU8 C;  3KWQ A;  5CPJ A;  5AY8 B;  5B1M D;  5B33 C;  5CP6 C;  3REK A;  3W98 C;  1P3M C;  3AZF D;  4XUJ B;  1WWI A;  3LJA A;  3AZL C;  1M19 B;  3X1S B;  5JRG C;  5B1L A;  5AV8 B;  4R8P D;  4YS3 C;  4JJN B;  5DNN B;  1BFM A;  2L5A A;  5GXQ D;  1HTA A;  3WTP A;  4Z5T B;  5B0Z D;  1ULY A;  5C3I C;  1M19 D;  1KX3 C;  3W97 D;  1M1A A;  3MVD A;  3KUY A;  2YFW B;  3O62 C;  3MGQ A;  5B33 D;  4KGC B;  1WWS A;  2YFV B;  1P3M D;  3LZ1 B;  3A6N D;  4WU9 B;  4KUD B;  3X1V C;  4J8V D;  4HGA B;  3VH5 W;  3LEL A;  5DNN D;  5DNN C;  3REK C;  1P3P B;  1P3L A;  4LD9 B;  4NFT A;  3LZ0 A;  1KU5 A;  2F8N G;  5GSU B;  3MVD D;  3MVD C;  1M1A C;  5AV5 D;  5B0Y B;  1P3K C;  4G92 C;  2JSS A;  4ZBJ B;  4WU9 D;  4KUD A;  4E44 A;  3B6F A;  4WU8 B;  5B24 C;  3B6G B;  5CPK C;  5CPK D;  1KX4 A;  3MVD B;  5GSU C;  1P3A C;  1M1A B;  5BS7 C;  4YM6 C;  3UT9 D;  1F66 D;  3W97 C;  5CHL B;  3C1C D;  1P3K A;  5B40 A;  3WTP B;  3REH A;  3C1B A;  3REL B;  4J8U D;  4QLC D;  3X1S A;  3UTA A;  1H3O A;  1S32 B;  1P34 D;  1TZY D;  5DNM C;  5AVB B;  4H9N B;  3AZG D;  5B2I D;  1P3G A;  4H9O A;  3VH6 T;  5AV5 C;  3WAA A;  5AV9 D;  5GXQ B;  2PYO B;  3C1C B;  3X1S C;  5FUG A;  2PYO A;  3MGP C;  1HQ3 A;  1P3B A;  4G91 B;  4XZQ A;  5B1M B;  1P3G B;  3UT9 C;  3B0D B;  4X23 A;  5E5A C;  5B32 G;  3WA9 C;  2ARO C;  2PYO D;  3AZN C;  5GT0 C;  3C1B B;  4WNN B;  4AWL B;  3W96 B;  5B40 B;  3REH B;  5AV6 C;  4Z2M G;  2RVQ D;  3AZL A;  2CV5 B;  4H9S A;  5BNV B;  3W97 A;  3AZE D;  4QLC B;  3B6G A;  5GXQ A;  3B6F B;  3WTP D;  4H9O B;  5AVC C;  5AVB A;  3KUY C;  3KUY D;  3V9R B;  3WKJ C;  5B32 B;  5BNX A;  3AZI C;  3UTA B;  1F66 C;  4WU8 D;  4J8W A;  5AV5 A;  5BT1 D;  4Z2M H;  3KWQ D;  4H9P B;  5B32 C;  5B32 D;  4KGC A;  3MGQ B;  3REK D;  5AV6 D;  3MGP A;  3KUY B;  5B31 C;  3X1T C;  3MGS C;  3AV1 C;  1Q9C A;  4DRB A;  4WU8 A;  5CPJ D;  3AZH B;  3UT9 A;  4Z5T A;  3MNN C;  5CPJ C;  3LZ1 D;  2IO5 B;  3A6N B;  4JJN A;  4J8W B;  1KX4 C;  1ZLA B;  1R4V A;  1BH8 A;  3REI D;  5BNX B;  5B1L C;  5B32 A;  4KGC D;  3AZJ A;  5F99 A;  4Z66 C;  2F8N B;  1P3L B;  3LEL B;  3MGR D;  3C1B D;  5CPJ B;  3LZ1 A;  1ID3 C;  2YFV A; 
#chains in the Genus database with same CATH topology
 4XUJ D;  4ZUX C;  5BNV A;  2YFW A;  2CV5 A;  4H9Q B;  5BS7 A;  4YM6 A;  2CWE A;  3TU4 A;  2ARO A;  3REI C;  3REJ C;  5KDM A;  3AZJ C;  1ZLA D;  2Y2H A;  1TZY C;  4NE3 A;  3VH5 T;  5DNM D;  5JRG A;  5DNN A;  3AZN D;  4WNN A;  1P3L C;  2FFF B;  4J8X B;  1AOI B;  2NZD C;  1P3O D;  4EO5 B;  5B1L B;  3AZM A;  3LJA B;  4XUJ A;  3C1C C;  3O62 D;  4X23 B;  2Y2M A;  3KWQ C;  2IO5 C;  2ARO D;  5GT3 C;  4J8V B;  4NE6 A;  3AYW C;  3B0B A;  4XZQ B;  3KWQ B;  1KX5 A;  3MGS B;  5DNM B;  1HQ3 B;  4YS3 D;  3W99 B;  5FUG B;  3WA9 A;  2F2A C;  3AZI D;  3C1C A;  5B2J B;  2NZD B;  4ZUX D;  3NQU B;  1TZY A;  3KXB A;  2XD5 A;  3WAA B;  3UTA C;  1F66 B;  3X1S D;  4H9N A;  3EPK A;  3AZI B;  1KX5 C;  4ZUX B;  3AZF B;  1S32 A;  3X1T A;  3AFA A;  5CPK B;  3X1U D;  1BH9 A;  1H3O B;  4CAY B;  3X1U C;  2Y2G A;  1P34 C;  2NQB A;  3MGS D;  2ZY4 A;  1B6W A;  2Y2J A;  3W99 D;  3AZG C;  3REL A;  3KSY A;  3AV2 D;  2HUE B;  4J8U B;  5G49 A;  3UTB C;  4Z66 B;  2FJ7 A;  4G92 B;  1F1E A;  1P3K B;  5B0Z A;  1EQZ B;  1U35 C;  1P3I D;  1KX4 B;  1ZLA C;  3REJ A;  3X1T D;  5AV6 B;  5B1L D;  2Y2L A;  4E45 A;  1P3P D;  4NE5 A;  3W96 C;  5GT0 B;  3C1B C;  3IP4 C;  4AWL C;  3AZN B;  3AV2 A;  4J8X D;  1ID3 A;  5E5A A;  2Y2K A;  3WKJ A;  4UUZ B;  5CP6 D;  5B0Y A;  1P3A A;  3AN2 C;  5GSU A;  1N1J B;  5B2J C;  3LZ0 B;  2DQN C;  4LD9 A;  3R45 B;  1B67 A;  1P3P A;  4JJN D;  3LEL D;  4WU9 A;  2NZD D;  2F8N D;  3B6F D;  1P3F A;  1P3I A;  4XUJ C;  1P3M B;  3W98 B;  3VH5 A;  5CP6 B;  3AV1 A;  3AZE C;  2J8P A;  1A7W A;  3H0L C;  3VH6 W;  5AVB C;  4R8P A;  3AZK D;  5AV8 A;  3P5J B;  5B0Y C;  3H0M C;  5JA4 A;  3MGR C;  3UTB B;  1M19 A;  4YM6 D;  1M18 B;  3LJA D;  3VH6 A;  5BO0 B;  3TU4 C;  3REL C;  2BYM A;  3REH C;  3MGQ D;  3REK B;  5B40 C;  3AN2 B;  4H9S C;  1P3O B;  1P3B C;  5GT3 D;  3X1V B;  3AZF C;  3WTP C;  4WU9 C;  5B2I A;  5AY8 A;  4UPK A;  3AZK A;  3AZM D;  5GT0 D;  4KGC C;  3LEL C;  3MGP D;  1P3O C;  2XD1 A;  3REI A;  1P3M A;  3W98 A;  4H9R B;  5C3I B;  1M18 D;  3AZG A;  1M18 C;  1P3G C;  1U35 B;  5BT1 C;  4ZBJ C;  3MGR B;  4J8W C;  1HQ3 C;  1P3B D;  5B2J D;  4J8U C;  3R45 A;  4XZQ C;  3A6N C;  5CPI A;  3MNN B;  4KHA B;  3AYW B;  1JFI B;  2PYO C;  1S32 D;  3AZE B;  5B33 B;  1P3P C;  2CV5 D;  3KXB C;  3LJA C;  3LZ1 C;  3W96 D;  1TAF B;  5B40 D;  3REH D;  3F6T A;  5AV9 C;  4J8X C;  3WAA C;  1AOI C;  3O62 B;  1U35 D;  3AFA D;  1KX4 D;  3X1U A;  5CPI D;  3REJ B;  3AZL D;  1KX3 B;  3LZ0 C;  2BYK B;  3B6G D;  2HIO C;  2ZY3 A;  4WZS B;  4JJN C;  4YS3 B;  5AV8 C;  3EPL A;  2FJ7 D;  5G49 B;  4J8U A;  1P3G D;  5AV9 A;  5E5A D;  2NQB B;  5B31 A;  4X23 C;  3AZE A;  3AN2 D;  3AFA B;  3WA9 D;  1JFI A;  4WV4 B;  4QLC C;  5CPI B;  3AZI A;  5AVC D;  1EQZ C;  4LD9 D;  5B24 D;  2HIO A;  1KX5 D;  2F8N H;  4Z66 D;  4YS3 A;  1TZY B;  1U35 A;  2HUE C;  3B0C T;  1P3A D;  3AZG B;  3AZH C;  3REI B;  1P34 B;  1KX3 A;  3X1U B;  1HQ3 D;  4HGA C;  3MGS A;  2UWX A;  5AVC A;  1KX5 B;  3B0D C;  5B24 A;  3WTP E;  4J8V A;  3X1V A;  5AV8 D;  5B31 D;  3AN2 A;  1P3L D;  2BYM B;  5B33 A;  3AV1 D;  5BO0 A;  1T3U A;  3AYW A;  4Z5T C;  3MNN A;  3AZM B;  5JA4 B;  3W99 C;  1AOI A;  5JRG B;  1P3F C;  3MGR A;  4CSR B;  3AZM C;  5GT3 B;  4J8V C;  3X1V D;  3REJ D;  3AV1 B;  5CP6 A;  5B0Y D;  3NQJ A;  3NQJ B;  5GSU D;  1S32 C;  5GT3 A;  5AY8 C;  3AV2 C;  1P3I B;  3TU4 D;  4CSR A;  4KUD D;  4EO5 C;  1ID3 D;  1P3K D;  3A1K A;  5B2I B;  1AOI D;  5F99 B;  2F8N A;  3AZJ B;  1P3F D;  1P3O A;  4DRA A;  3W98 D;  3EPJ A;  3AYW D;  3UTA D;  1M18 A;  2LY8 A;  5B31 G;  1BH8 B;  1P3A B;  3WKJ B;  1ZLA A;  3UTB A;  2FJ7 C;  5B2I C;  3B6G C;  1ID3 B;  5B24 B;  4R8P B;  4Z5T D;  3A6N A;  5AVC B;  3UT9 B;  3AZH A;  3WAA D;  3B6F C;  5B1M C;  1M1A D;  3AFA C;  2VQR A;  5AV6 A;  3MGP B;  1P34 A;  2NQB C;  3LZ0 D;  2JCH A;  1EQZ A;  4R8P C;  3AZJ D;  1P3F B;  5F99 D;  4H9P A;  3KXB D;  4LD9 C;  2FJ7 B;  5B0Z C;  2HIO B;  5AY8 D;  5GXQ C;  5AV5 B;  3A1I A;  3AZH D;  4KUD C;  1BH9 B;  4CAY A;  4X23 D;  1N1J A;  3X1T B;  5CPK A;  5B31 B;  3H0R C;  4ZUX A;  3V9R A;  3UTB D;  3MGQ C;  4UUZ A;  5AV9 B;  5E5A B;  1EQZ D;  2NQB D;  1F66 A;  3AV2 B;  1P3I C;  2HIO D;  5JRG D;  2ZY5 A;  5GT0 A;  3AZN A;  3KXB B;  4G91 C;  3NQU A;  2BYK A;  5B2J A;  2RVQ C;  4QLC A;  3W97 B;  3AZL B;  1M19 C;  1KX3 D;  3W99 A;  3REL D;  2Y2O A;  5B0Z B;  3O62 A;  5DNM A;  2W8S A;  4Z66 A;  3W96 A;  1TAF A;  2ZY2 A;  2F8N K;  5CPI C;  5AVB D;  3AZK C;  3WKJ D;  3AZF A;  4KHA A;  2CV5 C;  3MNN D;  3B0C W;  4J8W D;  4J8X A;  5B1M A;  1P3B B;  4XZQ D;  5KDM B;  3EPH A;  2NZD A;  2ARO B;  3TU4 B;  4H9R A;  4H9Q A;  4YM6 B;  5F99 C;  3WA9 B;  4M6B A;  3AZK B;  2ZM5 A;  4WU8 C;  3KWQ A;  5CPJ A;  5AY8 B;  5B1M D;  5B33 C;  5CP6 C;  3REK A;  2Y2P A;  3W98 C;  1P3M C;  3AZF D;  4XUJ B;  1Z2C B;  1WWI A;  3LJA A;  3AZL C;  1M19 B;  3X1S B;  5JRG C;  5B1L A;  5AV8 B;  4R8P D;  4YS3 C;  4JJN B;  2DF4 C;  5DNN B;  1BFM A;  2L5A A;  5GXQ D;  1HTA A;  3WTP A;  4Z5T B;  5B0Z D;  1ULY A;  5C3I C;  1M19 D;  1KX3 C;  3W97 D;  1M1A A;  3MVD A;  3KUY A;  2YFW B;  3O62 C;  3MGQ A;  5B33 D;  4KGC B;  1WWS A;  2YFV B;  1P3M D;  3LZ1 B;  3A6N D;  4WU9 B;  4KUD B;  3X1V C;  4J8V D;  4HGA B;  3VH5 W;  3LEL A;  5DNN D;  5DNN C;  3REK C;  1P3P B;  1P3L A;  4LD9 B;  4NFT A;  3LZ0 A;  1KU5 A;  2F8N G;  5GSU B;  3MVD D;  3MVD C;  1M1A C;  5AV5 D;  5B0Y B;  1P3K C;  4G92 C;  2JSS A;  4ZBJ B;  4WU9 D;  4KUD A;  4E44 A;  3B6F A;  4WU8 B;  5B24 C;  3B6G B;  5CPK C;  5CPK D;  1KX4 A;  3MVD B;  5GSU C;  1P3A C;  1M1A B;  3EG5 B;  5BS7 C;  4YM6 C;  3UT9 D;  1F66 D;  3W97 C;  5CHL B;  3C1C D;  1P3K A;  5B40 A;  3WTP B;  3REH A;  3FDD A;  3C1B A;  3REL B;  4J8U D;  4QLC D;  3X1S A;  3UTA A;  1H3O A;  1S32 B;  1P34 D;  1TZY D;  5DNM C;  5AVB B;  2Y2Q A;  4H9N B;  3AZG D;  5B2I D;  1P3G A;  4H9O A;  3VH6 T;  5AV5 C;  3WAA A;  5AV9 D;  5GXQ B;  2PYO B;  1PZR A;  3C1C B;  3X1S C;  3AL0 C;  5FUG A;  2PYO A;  3MGP C;  1HQ3 A;  1P3B A;  4G91 B;  4XZQ A;  5B1M B;  1P3G B;  3UT9 C;  3B0D B;  4X23 A;  5E5A C;  1W2E A;  5B32 G;  4DQY B;  3WA9 C;  2ARO C;  2PYO D;  3AZN C;  5GT0 C;  3C1B B;  4WNN B;  4AWL B;  3W96 B;  5B40 B;  3REH B;  5AV6 C;  4Z2M G;  2RVQ D;  3AZL A;  2CV5 B;  4H9S A;  5BNV B;  3W97 A;  3AZE D;  4QLC B;  2G5H C;  3B6G A;  5GXQ A;  3B6F B;  3WTP D;  4H9O B;  5AVC C;  5AVB A;  3KUY C;  3KUY D;  3V9R B;  3WKJ C;  5B32 B;  5BNX A;  3AZI C;  3UTA B;  1F66 C;  4WU8 D;  4J8W A;  5AV5 A;  5BT1 D;  4Z2M H;  2BG1 A;  3KWQ D;  4H9P B;  4WJ3 C;  3KFU G;  5B32 C;  5B32 D;  4KGC A;  3MGQ B;  3REK D;  5AV6 D;  3MGP A;  3KUY B;  5B31 C;  2RIQ A;  3X1T C;  3MGS C;  3AV1 C;  1Q9C A;  4DRB A;  4WU8 A;  5CPJ D;  3AZH B;  3UT9 A;  4Z5T A;  2Y2I A;  3MNN C;  5CPJ C;  3LZ1 D;  2IO5 B;  3A6N B;  4JJN A;  2Y2N A;  2G5I C;  4J8W B;  2JE5 A;  1KX4 C;  1ZLA B;  1R4V A;  1BH8 A;  3REI D;  5BNX B;  5B1L C;  5B32 A;  4KGC D;  3AZJ A;  5F99 A;  4Z66 C;  2F8N B;  1P3L B;  3LEL B;  3MGR D;  3C1B D;  5CPJ B;  3LZ1 A;  1ID3 C;  2YFV A; 
#chains in the Genus database with same CATH homology
 4XUJ D;  4ZUX C;  5BNV A;  2YFW A;  2CV5 A;  4H9Q B;  5BS7 A;  4YM6 A;  2CWE A;  3TU4 A;  2ARO A;  3REI C;  3REJ C;  5KDM A;  3AZJ C;  1ZLA D;  2Y2H A;  1TZY C;  4NE3 A;  3VH5 T;  5DNM D;  5JRG A;  5DNN A;  3AZN D;  4WNN A;  1P3L C;  2FFF B;  4J8X B;  1AOI B;  2NZD C;  1P3O D;  4EO5 B;  5B1L B;  3AZM A;  3LJA B;  4XUJ A;  3C1C C;  3O62 D;  4X23 B;  2Y2M A;  3KWQ C;  2IO5 C;  2ARO D;  5GT3 C;  4J8V B;  4NE6 A;  3AYW C;  3B0B A;  4XZQ B;  3KWQ B;  1KX5 A;  3MGS B;  5DNM B;  1HQ3 B;  4YS3 D;  3W99 B;  5FUG B;  3WA9 A;  2F2A C;  3AZI D;  3C1C A;  5B2J B;  2NZD B;  4ZUX D;  3NQU B;  1TZY A;  3KXB A;  2XD5 A;  3WAA B;  3UTA C;  1F66 B;  3X1S D;  4H9N A;  3EPK A;  3AZI B;  1KX5 C;  4ZUX B;  3AZF B;  1S32 A;  3X1T A;  3AFA A;  5CPK B;  3X1U D;  1BH9 A;  1H3O B;  4CAY B;  3X1U C;  2Y2G A;  1P34 C;  2NQB A;  3MGS D;  2ZY4 A;  1B6W A;  2Y2J A;  3W99 D;  3AZG C;  3REL A;  3KSY A;  3AV2 D;  2HUE B;  4J8U B;  5G49 A;  3UTB C;  4Z66 B;  2FJ7 A;  4G92 B;  1F1E A;  1P3K B;  5B0Z A;  1EQZ B;  1U35 C;  1P3I D;  1KX4 B;  1ZLA C;  3REJ A;  3X1T D;  5AV6 B;  5B1L D;  2Y2L A;  4E45 A;  1P3P D;  4NE5 A;  3W96 C;  5GT0 B;  3C1B C;  3IP4 C;  4AWL C;  3AZN B;  3AV2 A;  4J8X D;  1ID3 A;  5E5A A;  2Y2K A;  3WKJ A;  4UUZ B;  5CP6 D;  5B0Y A;  1P3A A;  3AN2 C;  5GSU A;  1N1J B;  5B2J C;  3LZ0 B;  2DQN C;  4LD9 A;  3R45 B;  1B67 A;  1P3P A;  4JJN D;  3LEL D;  4WU9 A;  2NZD D;  2F8N D;  3B6F D;  1P3F A;  1P3I A;  4XUJ C;  1P3M B;  3W98 B;  3VH5 A;  5CP6 B;  3AV1 A;  3AZE C;  2J8P A;  1A7W A;  3H0L C;  3VH6 W;  5AVB C;  4R8P A;  3AZK D;  5AV8 A;  3P5J B;  5B0Y C;  3H0M C;  5JA4 A;  3MGR C;  3UTB B;  1M19 A;  4YM6 D;  1M18 B;  3LJA D;  3VH6 A;  5BO0 B;  3TU4 C;  3REL C;  2BYM A;  3REH C;  3MGQ D;  3REK B;  5B40 C;  3AN2 B;  4H9S C;  1P3O B;  1P3B C;  5GT3 D;  3X1V B;  3AZF C;  3WTP C;  4WU9 C;  5B2I A;  5AY8 A;  4UPK A;  3AZK A;  3AZM D;  5GT0 D;  4KGC C;  3LEL C;  3MGP D;  1P3O C;  2XD1 A;  3REI A;  1P3M A;  3W98 A;  4H9R B;  5C3I B;  1M18 D;  3AZG A;  1M18 C;  1P3G C;  1U35 B;  5BT1 C;  4ZBJ C;  3MGR B;  4J8W C;  1HQ3 C;  1P3B D;  5B2J D;  4J8U C;  3R45 A;  4XZQ C;  3A6N C;  5CPI A;  3MNN B;  4KHA B;  3AYW B;  1JFI B;  2PYO C;  1S32 D;  3AZE B;  5B33 B;  1P3P C;  2CV5 D;  3KXB C;  3LJA C;  3LZ1 C;  3W96 D;  1TAF B;  5B40 D;  3REH D;  3F6T A;  5AV9 C;  4J8X C;  3WAA C;  1AOI C;  3O62 B;  1U35 D;  3AFA D;  1KX4 D;  3X1U A;  5CPI D;  3REJ B;  3AZL D;  1KX3 B;  3LZ0 C;  2BYK B;  3B6G D;  2HIO C;  2ZY3 A;  4WZS B;  4JJN C;  4YS3 B;  5AV8 C;  3EPL A;  2FJ7 D;  5G49 B;  4J8U A;  1P3G D;  5AV9 A;  5E5A D;  2NQB B;  5B31 A;  4X23 C;  3AZE A;  3AN2 D;  3AFA B;  3WA9 D;  1JFI A;  4WV4 B;  4QLC C;  5CPI B;  3AZI A;  5AVC D;  1EQZ C;  4LD9 D;  5B24 D;  2HIO A;  1KX5 D;  2F8N H;  4Z66 D;  4YS3 A;  1TZY B;  1U35 A;  2HUE C;  3B0C T;  1P3A D;  3AZG B;  3AZH C;  3REI B;  1P34 B;  1KX3 A;  3X1U B;  1HQ3 D;  4HGA C;  3MGS A;  2UWX A;  5AVC A;  1KX5 B;  3B0D C;  5B24 A;  3WTP E;  4J8V A;  3X1V A;  5AV8 D;  5B31 D;  3AN2 A;  1P3L D;  2BYM B;  5B33 A;  3AV1 D;  5BO0 A;  1T3U A;  3AYW A;  4Z5T C;  3MNN A;  3AZM B;  5JA4 B;  3W99 C;  1AOI A;  5JRG B;  1P3F C;  3MGR A;  4CSR B;  3AZM C;  5GT3 B;  4J8V C;  3X1V D;  3REJ D;  3AV1 B;  5CP6 A;  5B0Y D;  3NQJ A;  3NQJ B;  5GSU D;  1S32 C;  5GT3 A;  5AY8 C;  3AV2 C;  1P3I B;  3TU4 D;  4CSR A;  4KUD D;  4EO5 C;  1ID3 D;  1P3K D;  3A1K A;  5B2I B;  1AOI D;  5F99 B;  2F8N A;  3AZJ B;  1P3F D;  1P3O A;  4DRA A;  3W98 D;  3EPJ A;  3AYW D;  3UTA D;  1M18 A;  2LY8 A;  5B31 G;  1BH8 B;  1P3A B;  3WKJ B;  1ZLA A;  3UTB A;  2FJ7 C;  5B2I C;  3B6G C;  1ID3 B;  5B24 B;  4R8P B;  4Z5T D;  3A6N A;  5AVC B;  3UT9 B;  3AZH A;  3WAA D;  3B6F C;  5B1M C;  1M1A D;  3AFA C;  2VQR A;  5AV6 A;  3MGP B;  1P34 A;  2NQB C;  3LZ0 D;  2JCH A;  1EQZ A;  4R8P C;  3AZJ D;  1P3F B;  5F99 D;  4H9P A;  3KXB D;  4LD9 C;  2FJ7 B;  5B0Z C;  2HIO B;  5AY8 D;  5GXQ C;  5AV5 B;  3A1I A;  3AZH D;  4KUD C;  1BH9 B;  4CAY A;  4X23 D;  1N1J A;  3X1T B;  5CPK A;  5B31 B;  3H0R C;  4ZUX A;  3V9R A;  3UTB D;  3MGQ C;  4UUZ A;  5AV9 B;  5E5A B;  1EQZ D;  2NQB D;  1F66 A;  3AV2 B;  1P3I C;  2HIO D;  5JRG D;  2ZY5 A;  5GT0 A;  3AZN A;  3KXB B;  4G91 C;  3NQU A;  2BYK A;  5B2J A;  2RVQ C;  4QLC A;  3W97 B;  3AZL B;  1M19 C;  1KX3 D;  3W99 A;  3REL D;  2Y2O A;  5B0Z B;  3O62 A;  5DNM A;  2W8S A;  4Z66 A;  3W96 A;  1TAF A;  2ZY2 A;  2F8N K;  5CPI C;  5AVB D;  3AZK C;  3WKJ D;  3AZF A;  4KHA A;  2CV5 C;  3MNN D;  3B0C W;  4J8W D;  4J8X A;  5B1M A;  1P3B B;  4XZQ D;  5KDM B;  3EPH A;  2NZD A;  2ARO B;  3TU4 B;  4H9R A;  4H9Q A;  4YM6 B;  5F99 C;  3WA9 B;  4M6B A;  3AZK B;  2ZM5 A;  4WU8 C;  3KWQ A;  5CPJ A;  5AY8 B;  5B1M D;  5B33 C;  5CP6 C;  3REK A;  2Y2P A;  3W98 C;  1P3M C;  3AZF D;  4XUJ B;  1Z2C B;  1WWI A;  3LJA A;  3AZL C;  1M19 B;  3X1S B;  5JRG C;  5B1L A;  5AV8 B;  4R8P D;  4YS3 C;  4JJN B;  2DF4 C;  5DNN B;  1BFM A;  2L5A A;  5GXQ D;  1HTA A;  3WTP A;  4Z5T B;  5B0Z D;  1ULY A;  5C3I C;  1M19 D;  1KX3 C;  3W97 D;  1M1A A;  3MVD A;  3KUY A;  2YFW B;  3O62 C;  3MGQ A;  5B33 D;  4KGC B;  1WWS A;  2YFV B;  1P3M D;  3LZ1 B;  3A6N D;  4WU9 B;  4KUD B;  3X1V C;  4J8V D;  4HGA B;  3VH5 W;  3LEL A;  5DNN D;  5DNN C;  3REK C;  1P3P B;  1P3L A;  4LD9 B;  4NFT A;  3LZ0 A;  1KU5 A;  2F8N G;  5GSU B;  3MVD D;  3MVD C;  1M1A C;  5AV5 D;  5B0Y B;  1P3K C;  4G92 C;  2JSS A;  4ZBJ B;  4WU9 D;  4KUD A;  4E44 A;  3B6F A;  4WU8 B;  5B24 C;  3B6G B;  5CPK C;  5CPK D;  1KX4 A;  3MVD B;  5GSU C;  1P3A C;  1M1A B;  3EG5 B;  5BS7 C;  4YM6 C;  3UT9 D;  1F66 D;  3W97 C;  5CHL B;  3C1C D;  1P3K A;  5B40 A;  3WTP B;  3REH A;  3FDD A;  3C1B A;  3REL B;  4J8U D;  4QLC D;  3X1S A;  3UTA A;  1H3O A;  1S32 B;  1P34 D;  1TZY D;  5DNM C;  5AVB B;  2Y2Q A;  4H9N B;  3AZG D;  5B2I D;  1P3G A;  4H9O A;  3VH6 T;  5AV5 C;  3WAA A;  5AV9 D;  5GXQ B;  2PYO B;  1PZR A;  3C1C B;  3X1S C;  3AL0 C;  5FUG A;  2PYO A;  3MGP C;  1HQ3 A;  1P3B A;  4G91 B;  4XZQ A;  5B1M B;  1P3G B;  3UT9 C;  3B0D B;  4X23 A;  5E5A C;  1W2E A;  5B32 G;  4DQY B;  3WA9 C;  2ARO C;  2PYO D;  3AZN C;  5GT0 C;  3C1B B;  4WNN B;  4AWL B;  3W96 B;  5B40 B;  3REH B;  5AV6 C;  4Z2M G;  2RVQ D;  3AZL A;  2CV5 B;  4H9S A;  5BNV B;  3W97 A;  3AZE D;  4QLC B;  2G5H C;  3B6G A;  5GXQ A;  3B6F B;  3WTP D;  4H9O B;  5AVC C;  5AVB A;  3KUY C;  3KUY D;  3V9R B;  3WKJ C;  5B32 B;  5BNX A;  3AZI C;  3UTA B;  1F66 C;  4WU8 D;  4J8W A;  5AV5 A;  5BT1 D;  4Z2M H;  2BG1 A;  3KWQ D;  4H9P B;  4WJ3 C;  3KFU G;  5B32 C;  5B32 D;  4KGC A;  3MGQ B;  3REK D;  5AV6 D;  3MGP A;  3KUY B;  5B31 C;  2RIQ A;  3X1T C;  3MGS C;  3AV1 C;  1Q9C A;  4DRB A;  4WU8 A;  5CPJ D;  3AZH B;  3UT9 A;  4Z5T A;  2Y2I A;  3MNN C;  5CPJ C;  3LZ1 D;  2IO5 B;  3A6N B;  4JJN A;  2Y2N A;  2G5I C;  4J8W B;  2JE5 A;  1KX4 C;  1ZLA B;  1R4V A;  1BH8 A;  3REI D;  5BNX B;  5B1L C;  5B32 A;  4KGC D;  3AZJ A;  5F99 A;  4Z66 C;  2F8N B;  1P3L B;  3LEL B;  3MGR D;  3C1B D;  5CPJ B;  3LZ1 A;  1ID3 C;  2YFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...