5AVBB

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbB00
3WKJA 5JA4B 4XUJB 4J8UB 4G92C 1P34A 4WU8B 3MNNC 4H9QA 4NE5A 5AV6A 4LD9D 3X1TB 5E5AD 4QLCD 4WV4B 5KDMB 4XUJC 4J8UC 3MGQB 4WU8C 3AZJA 4Z2MH 5B1MD 5B40C 2F8NG 5AV5D 5B33B 3X1TC 1P3LC 3AZGA 2CV5D 2FJ7A 3AZED 3B6GD 5CPKA 4X23A 3WKJD 1P34D 1AOIA 5B32A 5AV6D 4J8XA 3AZMB 3AZJD 3REJA 3AZMC 3AZGD 2FJ7D 1P3MD 1F66A 5AVCB 3VH5A 4YM6B 2HIOA 2RVQD 3V9RB 5B32D 1P3AC 4HGAB 1KX4A 4J8XD 5AVCC 4KGCB 4YM6C 3RELA 3LELD 4HGAC 3B6FA 3REJD 4KGCC 1KX5B 4Z66A 1U35A 4H9OA 1F66D 3C1BC 3WTPE 2HIOD 4WU9A 3W96B 3W98B 3AFAA 3AZFB 2F8ND 3RELD 3LZ0B 3W96C 3W98C 2YFVA 3B6FD 5CPJA 3AZFC 5B2JD 4Z66D 1U35D 4E45A 1ID3C 3LZ0C 1JFIB 1P3BC 4WU9D 3MGPB 3REKC 3KWQA 3AYWA 3AFAD 5B2ID 3KUYA 2PYOA 4J8VA 5AVBA 5FUGB 3REIA 5G49A 5CPJD 1BH9A 5CP6A 1M1AD 1P3IB 3WTPB 3O62B 3MGRB 1B67A 5GXQB 3KWQD 4J8WB 4H9RA 3AYWD 4YS3B 3WTPC 5GT0A 3B0CW 3MGRC 1HQ3D 3KUYD 1ZLAC 2PYOD 5GXQC 5AVBD 4J8VD 4J8WC 1P3GC 4YS3C 3REID 3MGSA 5BO0B 5CP6D 5CPIA 1KX3B 2F8NK 5B24B 3REHA 4H9NA 3VH6A 3AV2A 3UT9B 4R8PA 1KX3C 3AZKA 5GT0D 5B24C 4ZBJB 4Z5TB 2JSSA 2BYMB 3UT9C 3WAAB 5B0ZD 2NZDC 2NQBA 1M19B 1EQZA 3MGSD 1TZYB 4ZBJC 4XZQA 4Z5TC 5CPID 5DNMA 3WAAC 5BT1D 4CAYB 3REHD 3AN2D 1TZYC 3AV2D 4R8PD 1TAFA 3AV1A 4LD9B 5E5AB 4QLCB 5DNNC 2YFWB 1WWSA 4WZSB 3B0CT 5AV5B 4LD9C 5E5AC 4QLCC 5AV9C 2NQBD 1N1JA 2CV5B 1EQZD 3UTAB 3AZEB 3B6GB 4XZQD 5DNMD 1M18A 3X1VB 5AV5C 1P34B 2CV5C 3UTAC 4KHAB 5AV6B 3B6GC 3AV1D 2F8NH 3X1VC 3C1CB 1WWIA 3AZJB 5GT3A 5AV6C 3AZGB 3C1CC 3LZ1A 3NQJA 3LJAA 3AZJC 1M18D 3AZLA 3AZHA 5AV8B 3AZGC 5B32B 4ZUXD 3MGQC 3UTBA 5BS7A 5AV8C 5B33C 3LELB 5B32C 5GT3D 3LZ1D 2BYKB 1P3OB 3LJAD 3LELC 3AZLD 3AZHD 3MNNA 3B0BA 1P3OC 4XUJA 5JA4A 5JRGA 4J8UA 3UTBD 5CPKD 4WU8A 2F8NB 4X23D 4CSRB 5B40A 4JJNA 1AOID 1P3LA 1P3FB 5B2JB 4Z66B 1U35B 1S32B 1F1EA 4WU9B 1P3FC 5F99A 5B2JC 3VH5W 3AZIB 4XUJD 3NQUB 5JRGD 1S32C 4WU8D 5B2IB 1P3KA 5B40D 4JJND 1KX5C 3AZMA 3AZIC 1P3LD 1KX4D 2YFVB 1M1AB 5B2IC 3W97A 3KXBA 5F99D 1P3AA 4NE6A 3KWQB 1M1AC 5AVCA 4YM6A 4UUZB 3A6NA 5BNXB 1HQ3B 3KUYB 1P3KD 3KWQC 5AVBB 4M6BA 4KGCA 3AZMD 3WA9A 3REIB 1BH9B 3C1BA 1HQ3C 3KUYC 3W97D 3MGPC 4WNNB 1BH8A 5B0YB 3KXBD 5C3IB 1P3AD 5B31G 3AZNB 5AVCD 5GSUB 3W99B 3X1UB 3VH5T 3A6ND 5B0YC 5GT0B 3W96A 2LY8A 5C3IC 3W98A 4KUDA 1Q9CA 3AZNC 5B0ZB 3W99C 5GSUC 4KGCD 3X1UC 3R45B 5B1LB 3WA9D 1P3IC 3MGSB 1ID3A 5CPIB 3C1BD 3O62C 1P3BA 5B0ZC 3REKA 5B1LC 3MGSC 3REHB 3AN2B 4DRBA 5CPIC 4R8PB 1JFIA 5BT1C 3W98D 3REHC 3TU4B 3AN2C 4KUDD 4R8PC 1P3PB 1B6WA 1ID3D 5FUGA 4XZQB 3TU4C 1P3BD 5B31A 5AY8B 3REKD 1P3PC 2AROA 1P3MB 4XZQC 1HTAA 3WTPA 5AY8C 3MGRA 1ZLAA 4J8WA 3VH6W 1P3GA 1M19C 4E44A 1P3MC 3AZKD 5B31D 5B1MB 2AROD 5BO0A 4ZUXB 1KX3A 3WTPD 5B1MC 1ZLAD 3WKJB 4J8WD 4ZUXC 5GT3B 1P3GD 2NZDA 4H9SC 3AZEC 4H9QB 4Z5TA 3WKJC 3MVDA 3WAAA 5GT3C 1P34C 5BNVA 3AZLB 3AZHB 1TZYA 4DRAA 5DNNA 2FJ7B 3X1SA 5CPKB 3AZLC 4X23B 5CHLB 3VH6T 2NZDD 1AOIB 4LD9A 5E5AA 5AV9A 2FJ7C 1ULYA 5CPKC 4J8XB 4Z5TD 4X23C 2RVQC 3MVDD 3WAAD 4G92B 5AV5A 1AOIC 3UTAA 4J8XC 1TZYD 3REJB 1H3OA 5DNND 3X1VA 5JRGB 3X1SD 1F66B 4H9PA 2HIOB 4KHAA 3REJC 5B40B 4JJNB 5AV9D 1P3LB 5JRGC 1KX4B 3C1CA 1F66C 2HIOC 4JJNC 3RELB 1KX4C 3X1TA 5F99B 5KDMA 3UTAD 3B6FB 3MGQA 3X1VD 4H9OB 5AV8A 3RELC 2L5AA 5B33A 5F99C 1P3KB 3B6FC 3MNND 4Z2MG 4Z66C 1U35C 3C1CD 4J8UD 3LELA 3AFAB 4WU9C 1P3KC 3W97B 3KXBB 3X1TD 1P3AB 2BYKA 1P3OA 3MGQD 3AFAC 3W97C 5CPJB 5AV8D 3A6NB 3KXBC 5B33D 5CPJC 3WA9B 2F8NA 3A6NC 3AYWB 4CSRA 3C1BB 3V9RA 2PYOB 1BH8B 4J8VB 1P3FA 3WA9C 5B2JA 3AYWC 1P3OD 5G49B 3KSYA 1S32A 5CP6B 4NFTA 2PYOC 4J8VC 5AVBC 1KX5A 3REIC 4EO5B 3AZIA 3NQUA 4KUDB 5CP6C 5B2IA 4YM6D 4H9RB 1ID3B 4G91B 1P3BB 4EO5C 4KUDC 1P3FD 3REKB 1M1AA 1R4VA 3AZFA 4G91C 5GT0C 1S32D 3LZ0A 2HUEB 1KX5D 3AZID 4UUZA 4H9NB 3AV2B 5BNXA 3AZKB 1HQ3A 3MGPA 2HUEC 3W96D 5B31B 3AV2C 1KU5A 2AROB 4AWLB 3AZKC 2NQBB 3AZFD 1EQZB 4WNNA 2CWEA 5B0YA 3LZ0D 5B31C 5DNMB 1ZLAB 2AROC 4AWLC 3AZNA 1P3GB 2NQBC 5GSUA 3W99A 3X1UA 1EQZC 1P3IA 2IO5B 1TAFB 3AV1B 5DNMC 3O62A 3MGPD 5B0ZA 5GXQA 3R45A 5B1LA 4YS3A 2IO5C 3AV1C 1N1JB 5B0YD 1M18B 3AN2A 3AZND 2NZDB 3W99D 5GSUD 3X1UD 1P3ID 1M18C 5B24A 3O62D 3MGRD 3TU4A 3MVDB 5GXQD 3UT9A 1P3PA 5B1LD 5BNVB 4YS3D 5DNNB 3LZ1B 5AY8A 3X1SB 3MVDC 2BYMA 3NQJB 3LJAB 1M19A 1P3MA 5AV9B 3LZ1C 3X1SC 1KX3D 3LJAC 3UTBB 5B24D 3TU4D 3AZHC 4CAYA 3UT9D 1P3PD 4QLCA 3B0DB 5B32G 3UTBC 2YFWA 5BS7C 4NE3A 1H3OB 5AY8D 5B1MA 4H9PB 1BFMA 4ZUXA 3B0DC 4H9SA 1M19D 1A7WA 3MNNB 2CV5A 3AZEA 3B6GA
chains in the Genus database with same CATH superfamily
3WKJA 5JA4B 4XUJB 4J8UB 4G92C 1P34A 4WU8B 3MNNC 1PZRA 4H9QA 4NE5A 5AV6A 4LD9D 3X1TB 5E5AD 4QLCD 4WV4B 5KDMB 4XUJC 4J8UC 3MGQB 4WU8C 3AZJA 4Z2MH 5B1MD 5B40C 2F8NG 5AV5D 5B33B 3X1TC 1P3LC 3AZGA 2CV5D 2FJ7A 3AZED 3B6GD 5CPKA 4X23A 3WKJD 3IP4C 2J8PA 1P34D 1AOIA 5B32A 5AV6D 4J8XA 3AZMB 3P5JB 2DQNC 2Y2OA 3AZJD 3REJA 3FDDA 3AZMC 3AZGD 2FJ7D 1P3MD 1F66A 5AVCB 3VH5A 4YM6B 2HIOA 2RVQD 3V9RB 5B32D 1P3AC 4HGAB 2Y2QA 1KX4A 4J8XD 5AVCC 4KGCB 2RIQA 4YM6C 3RELA 3LELD 4HGAC 3B6FA 3REJD 4KGCC 1KX5B 4Z66A 1U35A 4H9OA 1F66D 3C1BC 3F6TA 3WTPE 2HIOD 4WU9A 3W96B 3W98B 3AFAA 3AZFB 2F8ND 3RELD 3LZ0B 3W96C 3W98C 2ZY4A 2YFVA 3B6FD 5CPJA 3AZFC 5B2JD 4Z66D 1U35D 4E45A 1ID3C 3LZ0C 1JFIB 1P3BC 4WU9D 3MGPB 3REKC 3KWQA 3AYWA 3AFAD 3A1IA 5B2ID 3KUYA 2PYOA 4J8VA 5AVBA 5FUGB 3REIA 5G49A 5CPJD 1BH9A 5CP6A 1M1AD 1P3IB 1T3UA 3WTPB 3O62B 3MGRB 1B67A 5GXQB 3KWQD 4J8WB 4H9RA 3AYWD 4YS3B 3WTPC 5GT0A 3B0CW 3MGRC 1HQ3D 3KUYD 1ZLAC 2PYOD 2Y2IA 5GXQC 5AVBD 4J8VD 4J8WC 1P3GC 4YS3C 3REID 3MGSA 5BO0B 5CP6D 5CPIA 1KX3B 2F8NK 5B24B 3REHA 4H9NA 3VH6A 3AV2A 3UT9B 4R8PA 1KX3C 2Y2LA 3AZKA 5GT0D 5B24C 4ZBJB 4Z5TB 2JSSA 2BYMB 3UT9C 3WAAB 5B0ZD 2NZDC 2NQBA 1M19B 1EQZA 3MGSD 1TZYB 4ZBJC 4XZQA 4Z5TC 5CPID 5DNMA 4DQYB 3WAAC 5BT1D 2ZM5A 4CAYB 3REHD 3AN2D 1TZYC 3AV2D 4R8PD 1TAFA 3AV1A 4LD9B 5E5AB 4QLCB 5DNNC 2Y2MA 2YFWB 1WWSA 4WZSB 3B0CT 5AV5B 4LD9C 5E5AC 4QLCC 5AV9C 2DF4C 2NQBD 1N1JA 2CV5B 1EQZD 3UTAB 3AZEB 3B6GB 4XZQD 3EPJA 5DNMD 1M18A 3X1VB 5AV5C 2UWXA 1P34B 2CV5C 3UTAC 4KHAB 5AV6B 3B6GC 2Y2GA 3AV1D 2F8NH 3X1VC 3C1CB 1WWIA 3AZJB 5GT3A 5AV6C 4WJ3C 2Y2NA 3AZGB 3C1CC 3LZ1A 3H0RC 3NQJA 3LJAA 2G5IC 3AZJC 1M18D 3AZLA 3AZHA 5AV8B 3AZGC 2XD5A 5B32B 4ZUXD 3MGQC 3UTBA 5BS7A 2F2AC 2W8SA 5AV8C 5B33C 3LELB 5B32C 5GT3D 3LZ1D 2BYKB 1P3OB 3LJAD 3LELC 3AZLD 3AZHD 3MNNA 3B0BA 1P3OC 2JCHA 4XUJA 5JA4A 5JRGA 4J8UA 3UTBD 5CPKD 4WU8A 2F8NB 4X23D 4CSRB 5B40A 4JJNA 1AOID 1P3LA 1P3FB 2Y2JA 5B2JB 3EPLA 4Z66B 1U35B 2Y2KA 1S32B 1F1EA 4WU9B 1P3FC 5F99A 5B2JC 3VH5W 3AZIB 4XUJD 3NQUB 5JRGD 1S32C 4WU8D 5B2IB 1P3KA 2JE5A 5B40D 4JJND 1KX5C 3AZMA 3AZIC 1P3LD 1KX4D 2YFVB 1M1AB 5B2IC 3W97A 3KXBA 5F99D 1P3AA 4NE6A 3KWQB 1M1AC 5AVCA 4YM6A 4UUZB 3A6NA 5BNXB 1HQ3B 3KUYB 1P3KD 3KWQC 5AVBB 3EPKA 4M6BA 4KGCA 3AZMD 3WA9A 3REIB 2XD1A 1BH9B 3C1BA 1HQ3C 3KUYC 3W97D 3MGPC 4WNNB 1BH8A 5B0YB 3KXBD 5C3IB 1P3AD 5B31G 3AZNB 5GSUB 5AVCD 3W99B 3X1UB 3VH5T 3A6ND 5B0YC 5GT0B 3W96A 2LY8A 5C3IC 3W98A 4KUDA 1Q9CA 3AZNC 5B0ZB 3W99C 5GSUC 4KGCD 3X1UC 3R45B 5B1LB 3EG5B 1P3IC 3WA9D 3MGSB 1ID3A 5CPIB 3C1BD 3O62C 2VQRA 1P3BA 5B0ZC 3REKA 5B1LC 3MGSC 3REHB 3AN2B 4DRBA 5CPIC 4R8PB 1JFIA 5BT1C 3W98D 3REHC 3TU4B 3AN2C 2ZY3A 4KUDD 4R8PC 1P3PB 1B6WA 1ID3D 5FUGA 4XZQB 3TU4C 1P3BD 2G5HC 5B31A 5AY8B 3REKD 1P3PC 2AROA 1P3MB 4XZQC 1HTAA 3WTPA 5AY8C 3MGRA 1ZLAA 4J8WA 3VH6W 1P3GA 1M19C 4E44A 1P3MC 3AZKD 5B31D 5B1MB 2AROD 5BO0A 4ZUXB 1KX3A 3WTPD 5B1MC 1ZLAD 3WKJB 4J8WD 4ZUXC 5GT3B 1P3GD 3AL0C 4H9SC 2NZDA 3AZEC 4H9QB 1Z2CB 4Z5TA 3WKJC 3MVDA 3WAAA 5GT3C 1P34C 5BNVA 3AZLB 3AZHB 1TZYA 4DRAA 5DNNA 2FJ7B 3X1SA 5CPKB 3AZLC 4X23B 5CHLB 3VH6T 2NZDD 1AOIB 4LD9A 5E5AA 5AV9A 2FJ7C 1ULYA 3A1KA 5CPKC 4J8XB 4Z5TD 4X23C 2RVQC 3MVDD 3WAAD 4G92B 5AV5A 1AOIC 3UTAA 4J8XC 1TZYD 3REJB 1H3OA 5DNND 3X1VA 5JRGB 3X1SD 1F66B 4H9PA 2HIOB 4KHAA 3REJC 5B40B 4JJNB 5AV9D 1P3LB 5JRGC 1KX4B 3C1CA 1F66C 2HIOC 4JJNC 3RELB 1KX4C 3X1TA 5F99B 5KDMA 3UTAD 3B6FB 3MGQA 2ZY5A 3X1VD 4H9OB 5AV8A 3RELC 2L5AA 5B33A 5F99C 1P3KB 3B6FC 2Y2HA 3MNND 4Z2MG 4Z66C 1U35C 3C1CD 4J8UD 3EPHA 3LELA 3AFAB 4WU9C 1P3KC 3W97B 3KXBB 3X1TD 1P3AB 2BYKA 1P3OA 3MGQD 4UPKA 3AFAC 5CPJB 3W97C 5AV8D 3A6NB 3KXBC 5B33D 5CPJC 3WA9B 2F8NA 3A6NC 3AYWB 4CSRA 2BG1A 3C1BB 3V9RA 2PYOB 1BH8B 4J8VB 1P3FA 3KFUG 3WA9C 5B2JA 3AYWC 1P3OD 5G49B 3KSYA 1S32A 5CP6B 4NFTA 2PYOC 4J8VC 5AVBC 1KX5A 3REIC 4EO5B 3AZIA 3NQUA 4KUDB 5CP6C 5B2IA 4YM6D 4H9RB 1ID3B 4G91B 1P3BB 4EO5C 4KUDC 1P3FD 3REKB 2ZY2A 1M1AA 1R4VA 3AZFA 4G91C 5GT0C 1S32D 3LZ0A 2HUEB 1KX5D 3AZID 4UUZA 4H9NB 3AV2B 5BNXA 3AZKB 1HQ3A 1W2EA 2Y2PA 3MGPA 2HUEC 3W96D 5B31B 3AV2C 1KU5A 2AROB 4AWLB 3AZKC 2NQBB 3AZFD 1EQZB 4WNNA 2CWEA 3H0MC 5B0YA 3LZ0D 3H0LC 5B31C 5DNMB 1ZLAB 2AROC 4AWLC 3AZNA 1P3GB 2NQBC 5GSUA 3W99A 3X1UA 1EQZC 1P3IA 2IO5B 1TAFB 3AV1B 5DNMC 3O62A 3MGPD 5B0ZA 5GXQA 3R45A 5B1LA 4YS3A 2IO5C 3AV1C 1N1JB 5B0YD 1M18B 3AN2A 3AZND 2NZDB 3W99D 5GSUD 3X1UD 1P3ID 1M18C 5B24A 3O62D 3MGRD 3TU4A 3MVDB 5GXQD 3UT9A 1P3PA 5B1LD 5BNVB 4YS3D 5DNNB 3LZ1B 5AY8A 3X1SB 3MVDC 2BYMA 3NQJB 3LJAB 1M19A 1P3MA 5AV9B 3LZ1C 3X1SC 1KX3D 3LJAC 3UTBB 5B24D 3TU4D 3AZHC 4CAYA 3UT9D 1P3PD 4QLCA 3B0DB 5B32G 3UTBC 2YFWA 5BS7C 4NE3A 1H3OB 5AY8D 5B1MA 4H9PB 1BFMA 4ZUXA 3B0DC 4H9SA 1M19D 1A7WA 3MNNB 2CV5A 3AZEA 3B6GA 2FFFB
chains in the Genus database with same CATH topology
3WKJA 5JA4B 4XUJB 4J8UB 4G92C 1P34A 4WU8B 3MNNC 1PZRA 4H9QA 4NE5A 5AV6A 4LD9D 3X1TB 5E5AD 4QLCD 4WV4B 5KDMB 4XUJC 4J8UC 3MGQB 4WU8C 3AZJA 4Z2MH 5B1MD 5B40C 2F8NG 5AV5D 5B33B 3X1TC 1P3LC 3AZGA 2CV5D 2FJ7A 3AZED 3B6GD 5CPKA 4X23A 3WKJD 3IP4C 2J8PA 1P34D 1AOIA 5B32A 5AV6D 4J8XA 3AZMB 3P5JB 2DQNC 2Y2OA 3AZJD 3REJA 3FDDA 3AZMC 3AZGD 2FJ7D 1P3MD 1F66A 5AVCB 3VH5A 4YM6B 2HIOA 2RVQD 3V9RB 5B32D 1P3AC 4HGAB 2Y2QA 1KX4A 4J8XD 5AVCC 4KGCB 2RIQA 4YM6C 3RELA 3LELD 4HGAC 3B6FA 3REJD 4KGCC 1KX5B 4Z66A 1U35A 4H9OA 1F66D 3C1BC 3F6TA 3WTPE 2HIOD 4WU9A 3W96B 3W98B 3AFAA 3AZFB 2F8ND 3RELD 3LZ0B 3W96C 3W98C 2ZY4A 2YFVA 3B6FD 5CPJA 3AZFC 5B2JD 4Z66D 1U35D 4E45A 1ID3C 3LZ0C 1JFIB 1P3BC 4WU9D 3MGPB 3REKC 3KWQA 3AYWA 3AFAD 3A1IA 5B2ID 3KUYA 2PYOA 4J8VA 5AVBA 5FUGB 3REIA 5G49A 5CPJD 1BH9A 5CP6A 1M1AD 1P3IB 1T3UA 3WTPB 3O62B 3MGRB 1B67A 5GXQB 3KWQD 4J8WB 4H9RA 3AYWD 4YS3B 3WTPC 5GT0A 3B0CW 3MGRC 1HQ3D 3KUYD 1ZLAC 2PYOD 2Y2IA 5GXQC 5AVBD 4J8VD 4J8WC 1P3GC 4YS3C 3REID 3MGSA 5BO0B 5CP6D 5CPIA 1KX3B 2F8NK 5B24B 3REHA 4H9NA 3VH6A 3AV2A 3UT9B 4R8PA 1KX3C 2Y2LA 3AZKA 5GT0D 5B24C 4ZBJB 4Z5TB 2JSSA 2BYMB 3UT9C 3WAAB 5B0ZD 2NZDC 2NQBA 1M19B 1EQZA 3MGSD 1TZYB 4ZBJC 4XZQA 4Z5TC 5CPID 5DNMA 4DQYB 3WAAC 5BT1D 2ZM5A 4CAYB 3REHD 3AN2D 1TZYC 3AV2D 4R8PD 1TAFA 3AV1A 4LD9B 5E5AB 4QLCB 5DNNC 2Y2MA 2YFWB 1WWSA 4WZSB 3B0CT 5AV5B 4LD9C 5E5AC 4QLCC 5AV9C 2DF4C 2NQBD 1N1JA 2CV5B 1EQZD 3UTAB 3AZEB 3B6GB 4XZQD 3EPJA 5DNMD 1M18A 3X1VB 5AV5C 2UWXA 1P34B 2CV5C 3UTAC 4KHAB 5AV6B 3B6GC 2Y2GA 3AV1D 2F8NH 3X1VC 3C1CB 1WWIA 3AZJB 5GT3A 5AV6C 4WJ3C 2Y2NA 3AZGB 3C1CC 3LZ1A 3H0RC 3NQJA 3LJAA 2G5IC 3AZJC 1M18D 3AZLA 3AZHA 5AV8B 3AZGC 2XD5A 5B32B 4ZUXD 3MGQC 3UTBA 5BS7A 2F2AC 2W8SA 5AV8C 5B33C 3LELB 5B32C 5GT3D 3LZ1D 2BYKB 1P3OB 3LJAD 3LELC 3AZLD 3AZHD 3MNNA 3B0BA 1P3OC 2JCHA 4XUJA 5JA4A 5JRGA 4J8UA 3UTBD 5CPKD 4WU8A 2F8NB 4X23D 4CSRB 5B40A 4JJNA 1AOID 1P3LA 1P3FB 2Y2JA 5B2JB 3EPLA 4Z66B 1U35B 2Y2KA 1S32B 1F1EA 4WU9B 1P3FC 5F99A 5B2JC 3VH5W 3AZIB 4XUJD 3NQUB 5JRGD 1S32C 4WU8D 5B2IB 1P3KA 2JE5A 5B40D 4JJND 1KX5C 3AZMA 3AZIC 1P3LD 1KX4D 2YFVB 1M1AB 5B2IC 3W97A 3KXBA 5F99D 1P3AA 4NE6A 3KWQB 1M1AC 5AVCA 4YM6A 4UUZB 3A6NA 5BNXB 1HQ3B 3KUYB 1P3KD 3KWQC 5AVBB 3EPKA 4M6BA 4KGCA 3AZMD 3WA9A 3REIB 2XD1A 1BH9B 3C1BA 1HQ3C 3KUYC 3W97D 3MGPC 4WNNB 1BH8A 5B0YB 3KXBD 5C3IB 1P3AD 5B31G 3AZNB 5GSUB 5AVCD 3W99B 3X1UB 3VH5T 3A6ND 5B0YC 5GT0B 3W96A 2LY8A 5C3IC 3W98A 4KUDA 1Q9CA 3AZNC 5B0ZB 3W99C 5GSUC 4KGCD 3X1UC 3R45B 5B1LB 3EG5B 1P3IC 3WA9D 3MGSB 1ID3A 5CPIB 3C1BD 3O62C 2VQRA 1P3BA 5B0ZC 3REKA 5B1LC 3MGSC 3REHB 3AN2B 4DRBA 5CPIC 4R8PB 1JFIA 5BT1C 3W98D 3REHC 3TU4B 3AN2C 2ZY3A 4KUDD 4R8PC 1P3PB 1B6WA 1ID3D 5FUGA 4XZQB 3TU4C 1P3BD 2G5HC 5B31A 5AY8B 3REKD 1P3PC 2AROA 1P3MB 4XZQC 1HTAA 3WTPA 5AY8C 3MGRA 1ZLAA 4J8WA 3VH6W 1P3GA 1M19C 4E44A 1P3MC 3AZKD 5B31D 5B1MB 2AROD 5BO0A 4ZUXB 1KX3A 3WTPD 5B1MC 1ZLAD 3WKJB 4J8WD 4ZUXC 5GT3B 1P3GD 3AL0C 4H9SC 2NZDA 3AZEC 4H9QB 1Z2CB 4Z5TA 3WKJC 3MVDA 3WAAA 5GT3C 1P34C 5BNVA 3AZLB 3AZHB 1TZYA 4DRAA 5DNNA 2FJ7B 3X1SA 5CPKB 3AZLC 4X23B 5CHLB 3VH6T 2NZDD 1AOIB 4LD9A 5E5AA 5AV9A 2FJ7C 1ULYA 3A1KA 5CPKC 4J8XB 4Z5TD 4X23C 2RVQC 3MVDD 3WAAD 4G92B 5AV5A 1AOIC 3UTAA 4J8XC 1TZYD 3REJB 1H3OA 5DNND 3X1VA 5JRGB 3X1SD 1F66B 4H9PA 2HIOB 4KHAA 3REJC 5B40B 4JJNB 5AV9D 1P3LB 5JRGC 1KX4B 3C1CA 1F66C 2HIOC 4JJNC 3RELB 1KX4C 3X1TA 5F99B 5KDMA 3UTAD 3B6FB 3MGQA 2ZY5A 3X1VD 4H9OB 5AV8A 3RELC 2L5AA 5B33A 5F99C 1P3KB 3B6FC 2Y2HA 3MNND 4Z2MG 4Z66C 1U35C 3C1CD 4J8UD 3EPHA 3LELA 3AFAB 4WU9C 1P3KC 3W97B 3KXBB 3X1TD 1P3AB 2BYKA 1P3OA 3MGQD 4UPKA 3AFAC 5CPJB 3W97C 5AV8D 3A6NB 3KXBC 5B33D 5CPJC 3WA9B 2F8NA 3A6NC 3AYWB 4CSRA 2BG1A 3C1BB 3V9RA 2PYOB 1BH8B 4J8VB 1P3FA 3KFUG 3WA9C 5B2JA 3AYWC 1P3OD 5G49B 3KSYA 1S32A 5CP6B 4NFTA 2PYOC 4J8VC 5AVBC 1KX5A 3REIC 4EO5B 3AZIA 3NQUA 4KUDB 5CP6C 5B2IA 4YM6D 4H9RB 1ID3B 4G91B 1P3BB 4EO5C 4KUDC 1P3FD 3REKB 2ZY2A 1M1AA 1R4VA 3AZFA 4G91C 5GT0C 1S32D 3LZ0A 2HUEB 1KX5D 3AZID 4UUZA 4H9NB 3AV2B 5BNXA 3AZKB 1HQ3A 1W2EA 2Y2PA 3MGPA 2HUEC 3W96D 5B31B 3AV2C 1KU5A 2AROB 4AWLB 3AZKC 2NQBB 3AZFD 1EQZB 4WNNA 2CWEA 3H0MC 5B0YA 3LZ0D 3H0LC 5B31C 5DNMB 1ZLAB 2AROC 4AWLC 3AZNA 1P3GB 2NQBC 5GSUA 3W99A 3X1UA 1EQZC 1P3IA 2IO5B 1TAFB 3AV1B 5DNMC 3O62A 3MGPD 5B0ZA 5GXQA 3R45A 5B1LA 4YS3A 2IO5C 3AV1C 1N1JB 5B0YD 1M18B 3AN2A 3AZND 2NZDB 3W99D 5GSUD 3X1UD 1P3ID 1M18C 5B24A 3O62D 3MGRD 3TU4A 3MVDB 5GXQD 3UT9A 1P3PA 5B1LD 5BNVB 4YS3D 5DNNB 3LZ1B 5AY8A 3X1SB 3MVDC 2BYMA 3NQJB 3LJAB 1M19A 1P3MA 5AV9B 3LZ1C 3X1SC 1KX3D 3LJAC 3UTBB 5B24D 3TU4D 3AZHC 4CAYA 3UT9D 1P3PD 4QLCA 3B0DB 5B32G 3UTBC 2YFWA 5BS7C 4NE3A 1H3OB 5AY8D 5B1MA 4H9PB 1BFMA 4ZUXA 3B0DC 4H9SA 1M19D 1A7WA 3MNNB 2CV5A 3AZEA 3B6GA 2FFFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ A;  5JA4 B;  4XUJ B;  4J8U B;  4G92 C;  1P34 A;  4WU8 B;  3MNN C;  4H9Q A;  4NE5 A;  5AV6 A;  4LD9 D;  3X1T B;  5E5A D;  4QLC D;  4WV4 B;  5KDM B;  4XUJ C;  4J8U C;  3MGQ B;  4WU8 C;  3AZJ A;  4Z2M H;  5B1M D;  5B40 C;  2F8N G;  5AV5 D;  5B33 B;  3X1T C;  1P3L C;  3AZG A;  2CV5 D;  2FJ7 A;  3AZE D;  3B6G D;  5CPK A;  4X23 A;  3WKJ D;  1P34 D;  1AOI A;  5B32 A;  5AV6 D;  4J8X A;  3AZM B;  3AZJ D;  3REJ A;  3AZM C;  3AZG D;  2FJ7 D;  1P3M D;  1F66 A;  5AVC B;  3VH5 A;  4YM6 B;  2HIO A;  2RVQ D;  3V9R B;  5B32 D;  1P3A C;  4HGA B;  1KX4 A;  4J8X D;  5AVC C;  4KGC B;  4YM6 C;  3REL A;  3LEL D;  4HGA C;  3B6F A;  3REJ D;  4KGC C;  1KX5 B;  4Z66 A;  1U35 A;  4H9O A;  1F66 D;  3C1B C;  3WTP E;  2HIO D;  4WU9 A;  3W96 B;  3W98 B;  3AFA A;  3AZF B;  2F8N D;  3REL D;  3LZ0 B;  3W96 C;  3W98 C;  2YFV A;  3B6F D;  5CPJ A;  3AZF C;  5B2J D;  4Z66 D;  1U35 D;  4E45 A;  1ID3 C;  3LZ0 C;  1JFI B;  1P3B C;  4WU9 D;  3MGP B;  3REK C;  3KWQ A;  3AYW A;  3AFA D;  5B2I D;  3KUY A;  2PYO A;  4J8V A;  5AVB A;  5FUG B;  3REI A;  5G49 A;  5CPJ D;  1BH9 A;  5CP6 A;  1M1A D;  1P3I B;  3WTP B;  3O62 B;  3MGR B;  1B67 A;  5GXQ B;  3KWQ D;  4J8W B;  4H9R A;  3AYW D;  4YS3 B;  3WTP C;  5GT0 A;  3B0C W;  3MGR C;  1HQ3 D;  3KUY D;  1ZLA C;  2PYO D;  5GXQ C;  5AVB D;  4J8V D;  4J8W C;  1P3G C;  4YS3 C;  3REI D;  3MGS A;  5BO0 B;  5CP6 D;  5CPI A;  1KX3 B;  2F8N K;  5B24 B;  3REH A;  4H9N A;  3VH6 A;  3AV2 A;  3UT9 B;  4R8P A;  1KX3 C;  3AZK A;  5GT0 D;  5B24 C;  4ZBJ B;  4Z5T B;  2JSS A;  2BYM B;  3UT9 C;  3WAA B;  5B0Z D;  2NZD C;  2NQB A;  1M19 B;  1EQZ A;  3MGS D;  1TZY B;  4ZBJ C;  4XZQ A;  4Z5T C;  5CPI D;  5DNM A;  3WAA C;  5BT1 D;  4CAY B;  3REH D;  3AN2 D;  1TZY C;  3AV2 D;  4R8P D;  1TAF A;  3AV1 A;  4LD9 B;  5E5A B;  4QLC B;  5DNN C;  2YFW B;  1WWS A;  4WZS B;  3B0C T;  5AV5 B;  4LD9 C;  5E5A C;  4QLC C;  5AV9 C;  2NQB D;  1N1J A;  2CV5 B;  1EQZ D;  3UTA B;  3AZE B;  3B6G B;  4XZQ D;  5DNM D;  1M18 A;  3X1V B;  5AV5 C;  1P34 B;  2CV5 C;  3UTA C;  4KHA B;  5AV6 B;  3B6G C;  3AV1 D;  2F8N H;  3X1V C;  3C1C B;  1WWI A;  3AZJ B;  5GT3 A;  5AV6 C;  3AZG B;  3C1C C;  3LZ1 A;  3NQJ A;  3LJA A;  3AZJ C;  1M18 D;  3AZL A;  3AZH A;  5AV8 B;  3AZG C;  5B32 B;  4ZUX D;  3MGQ C;  3UTB A;  5BS7 A;  5AV8 C;  5B33 C;  3LEL B;  5B32 C;  5GT3 D;  3LZ1 D;  2BYK B;  1P3O B;  3LJA D;  3LEL C;  3AZL D;  3AZH D;  3MNN A;  3B0B A;  1P3O C;  4XUJ A;  5JA4 A;  5JRG A;  4J8U A;  3UTB D;  5CPK D;  4WU8 A;  2F8N B;  4X23 D;  4CSR B;  5B40 A;  4JJN A;  1AOI D;  1P3L A;  1P3F B;  5B2J B;  4Z66 B;  1U35 B;  1S32 B;  1F1E A;  4WU9 B;  1P3F C;  5F99 A;  5B2J C;  3VH5 W;  3AZI B;  4XUJ D;  3NQU B;  5JRG D;  1S32 C;  4WU8 D;  5B2I B;  1P3K A;  5B40 D;  4JJN D;  1KX5 C;  3AZM A;  3AZI C;  1P3L D;  1KX4 D;  2YFV B;  1M1A B;  5B2I C;  3W97 A;  3KXB A;  5F99 D;  1P3A A;  4NE6 A;  3KWQ B;  1M1A C;  5AVC A;  4YM6 A;  4UUZ B;  3A6N A;  5BNX B;  1HQ3 B;  3KUY B;  1P3K D;  3KWQ C;  5AVB B;  4M6B A;  4KGC A;  3AZM D;  3WA9 A;  3REI B;  1BH9 B;  3C1B A;  1HQ3 C;  3KUY C;  3W97 D;  3MGP C;  4WNN B;  1BH8 A;  5B0Y B;  3KXB D;  5C3I B;  1P3A D;  5B31 G;  3AZN B;  5AVC D;  5GSU B;  3W99 B;  3X1U B;  3VH5 T;  3A6N D;  5B0Y C;  5GT0 B;  3W96 A;  2LY8 A;  5C3I C;  3W98 A;  4KUD A;  1Q9C A;  3AZN C;  5B0Z B;  3W99 C;  5GSU C;  4KGC D;  3X1U C;  3R45 B;  5B1L B;  3WA9 D;  1P3I C;  3MGS B;  1ID3 A;  5CPI B;  3C1B D;  3O62 C;  1P3B A;  5B0Z C;  3REK A;  5B1L C;  3MGS C;  3REH B;  3AN2 B;  4DRB A;  5CPI C;  4R8P B;  1JFI A;  5BT1 C;  3W98 D;  3REH C;  3TU4 B;  3AN2 C;  4KUD D;  4R8P C;  1P3P B;  1B6W A;  1ID3 D;  5FUG A;  4XZQ B;  3TU4 C;  1P3B D;  5B31 A;  5AY8 B;  3REK D;  1P3P C;  2ARO A;  1P3M B;  4XZQ C;  1HTA A;  3WTP A;  5AY8 C;  3MGR A;  1ZLA A;  4J8W A;  3VH6 W;  1P3G A;  1M19 C;  4E44 A;  1P3M C;  3AZK D;  5B31 D;  5B1M B;  2ARO D;  5BO0 A;  4ZUX B;  1KX3 A;  3WTP D;  5B1M C;  1ZLA D;  3WKJ B;  4J8W D;  4ZUX C;  5GT3 B;  1P3G D;  2NZD A;  4H9S C;  3AZE C;  4H9Q B;  4Z5T A;  3WKJ C;  3MVD A;  3WAA A;  5GT3 C;  1P34 C;  5BNV A;  3AZL B;  3AZH B;  1TZY A;  4DRA A;  5DNN A;  2FJ7 B;  3X1S A;  5CPK B;  3AZL C;  4X23 B;  5CHL B;  3VH6 T;  2NZD D;  1AOI B;  4LD9 A;  5E5A A;  5AV9 A;  2FJ7 C;  1ULY A;  5CPK C;  4J8X B;  4Z5T D;  4X23 C;  2RVQ C;  3MVD D;  3WAA D;  4G92 B;  5AV5 A;  1AOI C;  3UTA A;  4J8X C;  1TZY D;  3REJ B;  1H3O A;  5DNN D;  3X1V A;  5JRG B;  3X1S D;  1F66 B;  4H9P A;  2HIO B;  4KHA A;  3REJ C;  5B40 B;  4JJN B;  5AV9 D;  1P3L B;  5JRG C;  1KX4 B;  3C1C A;  1F66 C;  2HIO C;  4JJN C;  3REL B;  1KX4 C;  3X1T A;  5F99 B;  5KDM A;  3UTA D;  3B6F B;  3MGQ A;  3X1V D;  4H9O B;  5AV8 A;  3REL C;  2L5A A;  5B33 A;  5F99 C;  1P3K B;  3B6F C;  3MNN D;  4Z2M G;  4Z66 C;  1U35 C;  3C1C D;  4J8U D;  3LEL A;  3AFA B;  4WU9 C;  1P3K C;  3W97 B;  3KXB B;  3X1T D;  1P3A B;  2BYK A;  1P3O A;  3MGQ D;  3AFA C;  3W97 C;  5CPJ B;  5AV8 D;  3A6N B;  3KXB C;  5B33 D;  5CPJ C;  3WA9 B;  2F8N A;  3A6N C;  3AYW B;  4CSR A;  3C1B B;  3V9R A;  2PYO B;  1BH8 B;  4J8V B;  1P3F A;  3WA9 C;  5B2J A;  3AYW C;  1P3O D;  5G49 B;  3KSY A;  1S32 A;  5CP6 B;  4NFT A;  2PYO C;  4J8V C;  5AVB C;  1KX5 A;  3REI C;  4EO5 B;  3AZI A;  3NQU A;  4KUD B;  5CP6 C;  5B2I A;  4YM6 D;  4H9R B;  1ID3 B;  4G91 B;  1P3B B;  4EO5 C;  4KUD C;  1P3F D;  3REK B;  1M1A A;  1R4V A;  3AZF A;  4G91 C;  5GT0 C;  1S32 D;  3LZ0 A;  2HUE B;  1KX5 D;  3AZI D;  4UUZ A;  4H9N B;  3AV2 B;  5BNX A;  3AZK B;  1HQ3 A;  3MGP A;  2HUE C;  3W96 D;  5B31 B;  3AV2 C;  1KU5 A;  2ARO B;  4AWL B;  3AZK C;  2NQB B;  3AZF D;  1EQZ B;  4WNN A;  2CWE A;  5B0Y A;  3LZ0 D;  5B31 C;  5DNM B;  1ZLA B;  2ARO C;  4AWL C;  3AZN A;  1P3G B;  2NQB C;  5GSU A;  3W99 A;  3X1U A;  1EQZ C;  1P3I A;  2IO5 B;  1TAF B;  3AV1 B;  5DNM C;  3O62 A;  3MGP D;  5B0Z A;  5GXQ A;  3R45 A;  5B1L A;  4YS3 A;  2IO5 C;  3AV1 C;  1N1J B;  5B0Y D;  1M18 B;  3AN2 A;  3AZN D;  2NZD B;  3W99 D;  5GSU D;  3X1U D;  1P3I D;  1M18 C;  5B24 A;  3O62 D;  3MGR D;  3TU4 A;  3MVD B;  5GXQ D;  3UT9 A;  1P3P A;  5B1L D;  5BNV B;  4YS3 D;  5DNN B;  3LZ1 B;  5AY8 A;  3X1S B;  3MVD C;  2BYM A;  3NQJ B;  3LJA B;  1M19 A;  1P3M A;  5AV9 B;  3LZ1 C;  3X1S C;  1KX3 D;  3LJA C;  3UTB B;  5B24 D;  3TU4 D;  3AZH C;  4CAY A;  3UT9 D;  1P3P D;  4QLC A;  3B0D B;  5B32 G;  3UTB C;  2YFW A;  5BS7 C;  4NE3 A;  1H3O B;  5AY8 D;  5B1M A;  4H9P B;  1BFM A;  4ZUX A;  3B0D C;  4H9S A;  1M19 D;  1A7W A;  3MNN B;  2CV5 A;  3AZE A;  3B6G A; 
#chains in the Genus database with same CATH topology
 3WKJ A;  5JA4 B;  4XUJ B;  4J8U B;  4G92 C;  1P34 A;  4WU8 B;  3MNN C;  1PZR A;  4H9Q A;  4NE5 A;  5AV6 A;  4LD9 D;  3X1T B;  5E5A D;  4QLC D;  4WV4 B;  5KDM B;  4XUJ C;  4J8U C;  3MGQ B;  4WU8 C;  3AZJ A;  4Z2M H;  5B1M D;  5B40 C;  2F8N G;  5AV5 D;  5B33 B;  3X1T C;  1P3L C;  3AZG A;  2CV5 D;  2FJ7 A;  3AZE D;  3B6G D;  5CPK A;  4X23 A;  3WKJ D;  3IP4 C;  2J8P A;  1P34 D;  1AOI A;  5B32 A;  5AV6 D;  4J8X A;  3AZM B;  3P5J B;  2DQN C;  2Y2O A;  3AZJ D;  3REJ A;  3FDD A;  3AZM C;  3AZG D;  2FJ7 D;  1P3M D;  1F66 A;  5AVC B;  3VH5 A;  4YM6 B;  2HIO A;  2RVQ D;  3V9R B;  5B32 D;  1P3A C;  4HGA B;  2Y2Q A;  1KX4 A;  4J8X D;  5AVC C;  4KGC B;  2RIQ A;  4YM6 C;  3REL A;  3LEL D;  4HGA C;  3B6F A;  3REJ D;  4KGC C;  1KX5 B;  4Z66 A;  1U35 A;  4H9O A;  1F66 D;  3C1B C;  3F6T A;  3WTP E;  2HIO D;  4WU9 A;  3W96 B;  3W98 B;  3AFA A;  3AZF B;  2F8N D;  3REL D;  3LZ0 B;  3W96 C;  3W98 C;  2ZY4 A;  2YFV A;  3B6F D;  5CPJ A;  3AZF C;  5B2J D;  4Z66 D;  1U35 D;  4E45 A;  1ID3 C;  3LZ0 C;  1JFI B;  1P3B C;  4WU9 D;  3MGP B;  3REK C;  3KWQ A;  3AYW A;  3AFA D;  3A1I A;  5B2I D;  3KUY A;  2PYO A;  4J8V A;  5AVB A;  5FUG B;  3REI A;  5G49 A;  5CPJ D;  1BH9 A;  5CP6 A;  1M1A D;  1P3I B;  1T3U A;  3WTP B;  3O62 B;  3MGR B;  1B67 A;  5GXQ B;  3KWQ D;  4J8W B;  4H9R A;  3AYW D;  4YS3 B;  3WTP C;  5GT0 A;  3B0C W;  3MGR C;  1HQ3 D;  3KUY D;  1ZLA C;  2PYO D;  2Y2I A;  5GXQ C;  5AVB D;  4J8V D;  4J8W C;  1P3G C;  4YS3 C;  3REI D;  3MGS A;  5BO0 B;  5CP6 D;  5CPI A;  1KX3 B;  2F8N K;  5B24 B;  3REH A;  4H9N A;  3VH6 A;  3AV2 A;  3UT9 B;  4R8P A;  1KX3 C;  2Y2L A;  3AZK A;  5GT0 D;  5B24 C;  4ZBJ B;  4Z5T B;  2JSS A;  2BYM B;  3UT9 C;  3WAA B;  5B0Z D;  2NZD C;  2NQB A;  1M19 B;  1EQZ A;  3MGS D;  1TZY B;  4ZBJ C;  4XZQ A;  4Z5T C;  5CPI D;  5DNM A;  4DQY B;  3WAA C;  5BT1 D;  2ZM5 A;  4CAY B;  3REH D;  3AN2 D;  1TZY C;  3AV2 D;  4R8P D;  1TAF A;  3AV1 A;  4LD9 B;  5E5A B;  4QLC B;  5DNN C;  2Y2M A;  2YFW B;  1WWS A;  4WZS B;  3B0C T;  5AV5 B;  4LD9 C;  5E5A C;  4QLC C;  5AV9 C;  2DF4 C;  2NQB D;  1N1J A;  2CV5 B;  1EQZ D;  3UTA B;  3AZE B;  3B6G B;  4XZQ D;  3EPJ A;  5DNM D;  1M18 A;  3X1V B;  5AV5 C;  2UWX A;  1P34 B;  2CV5 C;  3UTA C;  4KHA B;  5AV6 B;  3B6G C;  2Y2G A;  3AV1 D;  2F8N H;  3X1V C;  3C1C B;  1WWI A;  3AZJ B;  5GT3 A;  5AV6 C;  4WJ3 C;  2Y2N A;  3AZG B;  3C1C C;  3LZ1 A;  3H0R C;  3NQJ A;  3LJA A;  2G5I C;  3AZJ C;  1M18 D;  3AZL A;  3AZH A;  5AV8 B;  3AZG C;  2XD5 A;  5B32 B;  4ZUX D;  3MGQ C;  3UTB A;  5BS7 A;  2F2A C;  2W8S A;  5AV8 C;  5B33 C;  3LEL B;  5B32 C;  5GT3 D;  3LZ1 D;  2BYK B;  1P3O B;  3LJA D;  3LEL C;  3AZL D;  3AZH D;  3MNN A;  3B0B A;  1P3O C;  2JCH A;  4XUJ A;  5JA4 A;  5JRG A;  4J8U A;  3UTB D;  5CPK D;  4WU8 A;  2F8N B;  4X23 D;  4CSR B;  5B40 A;  4JJN A;  1AOI D;  1P3L A;  1P3F B;  2Y2J A;  5B2J B;  3EPL A;  4Z66 B;  1U35 B;  2Y2K A;  1S32 B;  1F1E A;  4WU9 B;  1P3F C;  5F99 A;  5B2J C;  3VH5 W;  3AZI B;  4XUJ D;  3NQU B;  5JRG D;  1S32 C;  4WU8 D;  5B2I B;  1P3K A;  2JE5 A;  5B40 D;  4JJN D;  1KX5 C;  3AZM A;  3AZI C;  1P3L D;  1KX4 D;  2YFV B;  1M1A B;  5B2I C;  3W97 A;  3KXB A;  5F99 D;  1P3A A;  4NE6 A;  3KWQ B;  1M1A C;  5AVC A;  4YM6 A;  4UUZ B;  3A6N A;  5BNX B;  1HQ3 B;  3KUY B;  1P3K D;  3KWQ C;  5AVB B;  3EPK A;  4M6B A;  4KGC A;  3AZM D;  3WA9 A;  3REI B;  2XD1 A;  1BH9 B;  3C1B A;  1HQ3 C;  3KUY C;  3W97 D;  3MGP C;  4WNN B;  1BH8 A;  5B0Y B;  3KXB D;  5C3I B;  1P3A D;  5B31 G;  3AZN B;  5GSU B;  5AVC D;  3W99 B;  3X1U B;  3VH5 T;  3A6N D;  5B0Y C;  5GT0 B;  3W96 A;  2LY8 A;  5C3I C;  3W98 A;  4KUD A;  1Q9C A;  3AZN C;  5B0Z B;  3W99 C;  5GSU C;  4KGC D;  3X1U C;  3R45 B;  5B1L B;  3EG5 B;  1P3I C;  3WA9 D;  3MGS B;  1ID3 A;  5CPI B;  3C1B D;  3O62 C;  2VQR A;  1P3B A;  5B0Z C;  3REK A;  5B1L C;  3MGS C;  3REH B;  3AN2 B;  4DRB A;  5CPI C;  4R8P B;  1JFI A;  5BT1 C;  3W98 D;  3REH C;  3TU4 B;  3AN2 C;  2ZY3 A;  4KUD D;  4R8P C;  1P3P B;  1B6W A;  1ID3 D;  5FUG A;  4XZQ B;  3TU4 C;  1P3B D;  2G5H C;  5B31 A;  5AY8 B;  3REK D;  1P3P C;  2ARO A;  1P3M B;  4XZQ C;  1HTA A;  3WTP A;  5AY8 C;  3MGR A;  1ZLA A;  4J8W A;  3VH6 W;  1P3G A;  1M19 C;  4E44 A;  1P3M C;  3AZK D;  5B31 D;  5B1M B;  2ARO D;  5BO0 A;  4ZUX B;  1KX3 A;  3WTP D;  5B1M C;  1ZLA D;  3WKJ B;  4J8W D;  4ZUX C;  5GT3 B;  1P3G D;  3AL0 C;  4H9S C;  2NZD A;  3AZE C;  4H9Q B;  1Z2C B;  4Z5T A;  3WKJ C;  3MVD A;  3WAA A;  5GT3 C;  1P34 C;  5BNV A;  3AZL B;  3AZH B;  1TZY A;  4DRA A;  5DNN A;  2FJ7 B;  3X1S A;  5CPK B;  3AZL C;  4X23 B;  5CHL B;  3VH6 T;  2NZD D;  1AOI B;  4LD9 A;  5E5A A;  5AV9 A;  2FJ7 C;  1ULY A;  3A1K A;  5CPK C;  4J8X B;  4Z5T D;  4X23 C;  2RVQ C;  3MVD D;  3WAA D;  4G92 B;  5AV5 A;  1AOI C;  3UTA A;  4J8X C;  1TZY D;  3REJ B;  1H3O A;  5DNN D;  3X1V A;  5JRG B;  3X1S D;  1F66 B;  4H9P A;  2HIO B;  4KHA A;  3REJ C;  5B40 B;  4JJN B;  5AV9 D;  1P3L B;  5JRG C;  1KX4 B;  3C1C A;  1F66 C;  2HIO C;  4JJN C;  3REL B;  1KX4 C;  3X1T A;  5F99 B;  5KDM A;  3UTA D;  3B6F B;  3MGQ A;  2ZY5 A;  3X1V D;  4H9O B;  5AV8 A;  3REL C;  2L5A A;  5B33 A;  5F99 C;  1P3K B;  3B6F C;  2Y2H A;  3MNN D;  4Z2M G;  4Z66 C;  1U35 C;  3C1C D;  4J8U D;  3EPH A;  3LEL A;  3AFA B;  4WU9 C;  1P3K C;  3W97 B;  3KXB B;  3X1T D;  1P3A B;  2BYK A;  1P3O A;  3MGQ D;  4UPK A;  3AFA C;  5CPJ B;  3W97 C;  5AV8 D;  3A6N B;  3KXB C;  5B33 D;  5CPJ C;  3WA9 B;  2F8N A;  3A6N C;  3AYW B;  4CSR A;  2BG1 A;  3C1B B;  3V9R A;  2PYO B;  1BH8 B;  4J8V B;  1P3F A;  3KFU G;  3WA9 C;  5B2J A;  3AYW C;  1P3O D;  5G49 B;  3KSY A;  1S32 A;  5CP6 B;  4NFT A;  2PYO C;  4J8V C;  5AVB C;  1KX5 A;  3REI C;  4EO5 B;  3AZI A;  3NQU A;  4KUD B;  5CP6 C;  5B2I A;  4YM6 D;  4H9R B;  1ID3 B;  4G91 B;  1P3B B;  4EO5 C;  4KUD C;  1P3F D;  3REK B;  2ZY2 A;  1M1A A;  1R4V A;  3AZF A;  4G91 C;  5GT0 C;  1S32 D;  3LZ0 A;  2HUE B;  1KX5 D;  3AZI D;  4UUZ A;  4H9N B;  3AV2 B;  5BNX A;  3AZK B;  1HQ3 A;  1W2E A;  2Y2P A;  3MGP A;  2HUE C;  3W96 D;  5B31 B;  3AV2 C;  1KU5 A;  2ARO B;  4AWL B;  3AZK C;  2NQB B;  3AZF D;  1EQZ B;  4WNN A;  2CWE A;  3H0M C;  5B0Y A;  3LZ0 D;  3H0L C;  5B31 C;  5DNM B;  1ZLA B;  2ARO C;  4AWL C;  3AZN A;  1P3G B;  2NQB C;  5GSU A;  3W99 A;  3X1U A;  1EQZ C;  1P3I A;  2IO5 B;  1TAF B;  3AV1 B;  5DNM C;  3O62 A;  3MGP D;  5B0Z A;  5GXQ A;  3R45 A;  5B1L A;  4YS3 A;  2IO5 C;  3AV1 C;  1N1J B;  5B0Y D;  1M18 B;  3AN2 A;  3AZN D;  2NZD B;  3W99 D;  5GSU D;  3X1U D;  1P3I D;  1M18 C;  5B24 A;  3O62 D;  3MGR D;  3TU4 A;  3MVD B;  5GXQ D;  3UT9 A;  1P3P A;  5B1L D;  5BNV B;  4YS3 D;  5DNN B;  3LZ1 B;  5AY8 A;  3X1S B;  3MVD C;  2BYM A;  3NQJ B;  3LJA B;  1M19 A;  1P3M A;  5AV9 B;  3LZ1 C;  3X1S C;  1KX3 D;  3LJA C;  3UTB B;  5B24 D;  3TU4 D;  3AZH C;  4CAY A;  3UT9 D;  1P3P D;  4QLC A;  3B0D B;  5B32 G;  3UTB C;  2YFW A;  5BS7 C;  4NE3 A;  1H3O B;  5AY8 D;  5B1M A;  4H9P B;  1BFM A;  4ZUX A;  3B0D C;  4H9S A;  1M19 D;  1A7W A;  3MNN B;  2CV5 A;  3AZE A;  3B6G A;  2FFF B; 
#chains in the Genus database with same CATH homology
 3WKJ A;  5JA4 B;  4XUJ B;  4J8U B;  4G92 C;  1P34 A;  4WU8 B;  3MNN C;  1PZR A;  4H9Q A;  4NE5 A;  5AV6 A;  4LD9 D;  3X1T B;  5E5A D;  4QLC D;  4WV4 B;  5KDM B;  4XUJ C;  4J8U C;  3MGQ B;  4WU8 C;  3AZJ A;  4Z2M H;  5B1M D;  5B40 C;  2F8N G;  5AV5 D;  5B33 B;  3X1T C;  1P3L C;  3AZG A;  2CV5 D;  2FJ7 A;  3AZE D;  3B6G D;  5CPK A;  4X23 A;  3WKJ D;  3IP4 C;  2J8P A;  1P34 D;  1AOI A;  5B32 A;  5AV6 D;  4J8X A;  3AZM B;  3P5J B;  2DQN C;  2Y2O A;  3AZJ D;  3REJ A;  3FDD A;  3AZM C;  3AZG D;  2FJ7 D;  1P3M D;  1F66 A;  5AVC B;  3VH5 A;  4YM6 B;  2HIO A;  2RVQ D;  3V9R B;  5B32 D;  1P3A C;  4HGA B;  2Y2Q A;  1KX4 A;  4J8X D;  5AVC C;  4KGC B;  2RIQ A;  4YM6 C;  3REL A;  3LEL D;  4HGA C;  3B6F A;  3REJ D;  4KGC C;  1KX5 B;  4Z66 A;  1U35 A;  4H9O A;  1F66 D;  3C1B C;  3F6T A;  3WTP E;  2HIO D;  4WU9 A;  3W96 B;  3W98 B;  3AFA A;  3AZF B;  2F8N D;  3REL D;  3LZ0 B;  3W96 C;  3W98 C;  2ZY4 A;  2YFV A;  3B6F D;  5CPJ A;  3AZF C;  5B2J D;  4Z66 D;  1U35 D;  4E45 A;  1ID3 C;  3LZ0 C;  1JFI B;  1P3B C;  4WU9 D;  3MGP B;  3REK C;  3KWQ A;  3AYW A;  3AFA D;  3A1I A;  5B2I D;  3KUY A;  2PYO A;  4J8V A;  5AVB A;  5FUG B;  3REI A;  5G49 A;  5CPJ D;  1BH9 A;  5CP6 A;  1M1A D;  1P3I B;  1T3U A;  3WTP B;  3O62 B;  3MGR B;  1B67 A;  5GXQ B;  3KWQ D;  4J8W B;  4H9R A;  3AYW D;  4YS3 B;  3WTP C;  5GT0 A;  3B0C W;  3MGR C;  1HQ3 D;  3KUY D;  1ZLA C;  2PYO D;  2Y2I A;  5GXQ C;  5AVB D;  4J8V D;  4J8W C;  1P3G C;  4YS3 C;  3REI D;  3MGS A;  5BO0 B;  5CP6 D;  5CPI A;  1KX3 B;  2F8N K;  5B24 B;  3REH A;  4H9N A;  3VH6 A;  3AV2 A;  3UT9 B;  4R8P A;  1KX3 C;  2Y2L A;  3AZK A;  5GT0 D;  5B24 C;  4ZBJ B;  4Z5T B;  2JSS A;  2BYM B;  3UT9 C;  3WAA B;  5B0Z D;  2NZD C;  2NQB A;  1M19 B;  1EQZ A;  3MGS D;  1TZY B;  4ZBJ C;  4XZQ A;  4Z5T C;  5CPI D;  5DNM A;  4DQY B;  3WAA C;  5BT1 D;  2ZM5 A;  4CAY B;  3REH D;  3AN2 D;  1TZY C;  3AV2 D;  4R8P D;  1TAF A;  3AV1 A;  4LD9 B;  5E5A B;  4QLC B;  5DNN C;  2Y2M A;  2YFW B;  1WWS A;  4WZS B;  3B0C T;  5AV5 B;  4LD9 C;  5E5A C;  4QLC C;  5AV9 C;  2DF4 C;  2NQB D;  1N1J A;  2CV5 B;  1EQZ D;  3UTA B;  3AZE B;  3B6G B;  4XZQ D;  3EPJ A;  5DNM D;  1M18 A;  3X1V B;  5AV5 C;  2UWX A;  1P34 B;  2CV5 C;  3UTA C;  4KHA B;  5AV6 B;  3B6G C;  2Y2G A;  3AV1 D;  2F8N H;  3X1V C;  3C1C B;  1WWI A;  3AZJ B;  5GT3 A;  5AV6 C;  4WJ3 C;  2Y2N A;  3AZG B;  3C1C C;  3LZ1 A;  3H0R C;  3NQJ A;  3LJA A;  2G5I C;  3AZJ C;  1M18 D;  3AZL A;  3AZH A;  5AV8 B;  3AZG C;  2XD5 A;  5B32 B;  4ZUX D;  3MGQ C;  3UTB A;  5BS7 A;  2F2A C;  2W8S A;  5AV8 C;  5B33 C;  3LEL B;  5B32 C;  5GT3 D;  3LZ1 D;  2BYK B;  1P3O B;  3LJA D;  3LEL C;  3AZL D;  3AZH D;  3MNN A;  3B0B A;  1P3O C;  2JCH A;  4XUJ A;  5JA4 A;  5JRG A;  4J8U A;  3UTB D;  5CPK D;  4WU8 A;  2F8N B;  4X23 D;  4CSR B;  5B40 A;  4JJN A;  1AOI D;  1P3L A;  1P3F B;  2Y2J A;  5B2J B;  3EPL A;  4Z66 B;  1U35 B;  2Y2K A;  1S32 B;  1F1E A;  4WU9 B;  1P3F C;  5F99 A;  5B2J C;  3VH5 W;  3AZI B;  4XUJ D;  3NQU B;  5JRG D;  1S32 C;  4WU8 D;  5B2I B;  1P3K A;  2JE5 A;  5B40 D;  4JJN D;  1KX5 C;  3AZM A;  3AZI C;  1P3L D;  1KX4 D;  2YFV B;  1M1A B;  5B2I C;  3W97 A;  3KXB A;  5F99 D;  1P3A A;  4NE6 A;  3KWQ B;  1M1A C;  5AVC A;  4YM6 A;  4UUZ B;  3A6N A;  5BNX B;  1HQ3 B;  3KUY B;  1P3K D;  3KWQ C;  5AVB B;  3EPK A;  4M6B A;  4KGC A;  3AZM D;  3WA9 A;  3REI B;  2XD1 A;  1BH9 B;  3C1B A;  1HQ3 C;  3KUY C;  3W97 D;  3MGP C;  4WNN B;  1BH8 A;  5B0Y B;  3KXB D;  5C3I B;  1P3A D;  5B31 G;  3AZN B;  5GSU B;  5AVC D;  3W99 B;  3X1U B;  3VH5 T;  3A6N D;  5B0Y C;  5GT0 B;  3W96 A;  2LY8 A;  5C3I C;  3W98 A;  4KUD A;  1Q9C A;  3AZN C;  5B0Z B;  3W99 C;  5GSU C;  4KGC D;  3X1U C;  3R45 B;  5B1L B;  3EG5 B;  1P3I C;  3WA9 D;  3MGS B;  1ID3 A;  5CPI B;  3C1B D;  3O62 C;  2VQR A;  1P3B A;  5B0Z C;  3REK A;  5B1L C;  3MGS C;  3REH B;  3AN2 B;  4DRB A;  5CPI C;  4R8P B;  1JFI A;  5BT1 C;  3W98 D;  3REH C;  3TU4 B;  3AN2 C;  2ZY3 A;  4KUD D;  4R8P C;  1P3P B;  1B6W A;  1ID3 D;  5FUG A;  4XZQ B;  3TU4 C;  1P3B D;  2G5H C;  5B31 A;  5AY8 B;  3REK D;  1P3P C;  2ARO A;  1P3M B;  4XZQ C;  1HTA A;  3WTP A;  5AY8 C;  3MGR A;  1ZLA A;  4J8W A;  3VH6 W;  1P3G A;  1M19 C;  4E44 A;  1P3M C;  3AZK D;  5B31 D;  5B1M B;  2ARO D;  5BO0 A;  4ZUX B;  1KX3 A;  3WTP D;  5B1M C;  1ZLA D;  3WKJ B;  4J8W D;  4ZUX C;  5GT3 B;  1P3G D;  3AL0 C;  4H9S C;  2NZD A;  3AZE C;  4H9Q B;  1Z2C B;  4Z5T A;  3WKJ C;  3MVD A;  3WAA A;  5GT3 C;  1P34 C;  5BNV A;  3AZL B;  3AZH B;  1TZY A;  4DRA A;  5DNN A;  2FJ7 B;  3X1S A;  5CPK B;  3AZL C;  4X23 B;  5CHL B;  3VH6 T;  2NZD D;  1AOI B;  4LD9 A;  5E5A A;  5AV9 A;  2FJ7 C;  1ULY A;  3A1K A;  5CPK C;  4J8X B;  4Z5T D;  4X23 C;  2RVQ C;  3MVD D;  3WAA D;  4G92 B;  5AV5 A;  1AOI C;  3UTA A;  4J8X C;  1TZY D;  3REJ B;  1H3O A;  5DNN D;  3X1V A;  5JRG B;  3X1S D;  1F66 B;  4H9P A;  2HIO B;  4KHA A;  3REJ C;  5B40 B;  4JJN B;  5AV9 D;  1P3L B;  5JRG C;  1KX4 B;  3C1C A;  1F66 C;  2HIO C;  4JJN C;  3REL B;  1KX4 C;  3X1T A;  5F99 B;  5KDM A;  3UTA D;  3B6F B;  3MGQ A;  2ZY5 A;  3X1V D;  4H9O B;  5AV8 A;  3REL C;  2L5A A;  5B33 A;  5F99 C;  1P3K B;  3B6F C;  2Y2H A;  3MNN D;  4Z2M G;  4Z66 C;  1U35 C;  3C1C D;  4J8U D;  3EPH A;  3LEL A;  3AFA B;  4WU9 C;  1P3K C;  3W97 B;  3KXB B;  3X1T D;  1P3A B;  2BYK A;  1P3O A;  3MGQ D;  4UPK A;  3AFA C;  5CPJ B;  3W97 C;  5AV8 D;  3A6N B;  3KXB C;  5B33 D;  5CPJ C;  3WA9 B;  2F8N A;  3A6N C;  3AYW B;  4CSR A;  2BG1 A;  3C1B B;  3V9R A;  2PYO B;  1BH8 B;  4J8V B;  1P3F A;  3KFU G;  3WA9 C;  5B2J A;  3AYW C;  1P3O D;  5G49 B;  3KSY A;  1S32 A;  5CP6 B;  4NFT A;  2PYO C;  4J8V C;  5AVB C;  1KX5 A;  3REI C;  4EO5 B;  3AZI A;  3NQU A;  4KUD B;  5CP6 C;  5B2I A;  4YM6 D;  4H9R B;  1ID3 B;  4G91 B;  1P3B B;  4EO5 C;  4KUD C;  1P3F D;  3REK B;  2ZY2 A;  1M1A A;  1R4V A;  3AZF A;  4G91 C;  5GT0 C;  1S32 D;  3LZ0 A;  2HUE B;  1KX5 D;  3AZI D;  4UUZ A;  4H9N B;  3AV2 B;  5BNX A;  3AZK B;  1HQ3 A;  1W2E A;  2Y2P A;  3MGP A;  2HUE C;  3W96 D;  5B31 B;  3AV2 C;  1KU5 A;  2ARO B;  4AWL B;  3AZK C;  2NQB B;  3AZF D;  1EQZ B;  4WNN A;  2CWE A;  3H0M C;  5B0Y A;  3LZ0 D;  3H0L C;  5B31 C;  5DNM B;  1ZLA B;  2ARO C;  4AWL C;  3AZN A;  1P3G B;  2NQB C;  5GSU A;  3W99 A;  3X1U A;  1EQZ C;  1P3I A;  2IO5 B;  1TAF B;  3AV1 B;  5DNM C;  3O62 A;  3MGP D;  5B0Z A;  5GXQ A;  3R45 A;  5B1L A;  4YS3 A;  2IO5 C;  3AV1 C;  1N1J B;  5B0Y D;  1M18 B;  3AN2 A;  3AZN D;  2NZD B;  3W99 D;  5GSU D;  3X1U D;  1P3I D;  1M18 C;  5B24 A;  3O62 D;  3MGR D;  3TU4 A;  3MVD B;  5GXQ D;  3UT9 A;  1P3P A;  5B1L D;  5BNV B;  4YS3 D;  5DNN B;  3LZ1 B;  5AY8 A;  3X1S B;  3MVD C;  2BYM A;  3NQJ B;  3LJA B;  1M19 A;  1P3M A;  5AV9 B;  3LZ1 C;  3X1S C;  1KX3 D;  3LJA C;  3UTB B;  5B24 D;  3TU4 D;  3AZH C;  4CAY A;  3UT9 D;  1P3P D;  4QLC A;  3B0D B;  5B32 G;  3UTB C;  2YFW A;  5BS7 C;  4NE3 A;  1H3O B;  5AY8 D;  5B1M A;  4H9P B;  1BFM A;  4ZUX A;  3B0D C;  4H9S A;  1M19 D;  1A7W A;  3MNN B;  2CV5 A;  3AZE A;  3B6G A;  2FFF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...