3REJA

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejA00
4J8WD 5E5AA 3MGSC 3MGPA 3AZLD 3W99C 5B0ZB 4YS3B 4H9NB 5CPIA 2NZDC 1P3KB 3X1TC 4YM6C 3REKB 3W98D 3NQUB 3MVDA 3AZJC 1M19D 2PYOD 5B2IC 3X1SB 3A6NA 4XZQC 3KXBA 4XUJC 3V9RA 3WAAA 4R8PD 5AV5C 3VH5A 3B0BA 4DRBA 5AVCB 5F99D 3UTAC 1AOIC 2RVQC 3AZEA 3VH6A 3AYWA 4H9QB 5B0YD 5E5AC 5AVBB 3TU4B 2AROA 3MGPC 3MGSD 3B6GB 5B33C 4JJNA 5CPIC 4DRAA 4G92B 2NZDD 4CAYA 3X1TD 3MVDC 1P3MB 1M18A 3RELB 3AZJD 1BH9A 1KX3A 3B6FB 5B2ID 3KXBC 3REHB 4XZQD 4XUJD 3KUYB 5CPKD 1R4VA 1H3OB 3AV1B 4J8XB 3LELD 1KX4B 3UTAD 3LZ1A 3UTBB 4J8VB 3AZEC 2RVQD 3AZIB 1EQZB 3AZFA 5E5AD 1P3LB 3MGQC 5C3IB 4UUZB 5B33D 4HGAC 3WTPA 5CPID 5B40B 1M18C 3AZHD 5B32A 3AZKB 4ZBJB 4E44A 4WU8B 3AZED 3REIA 3AZFC 1ZLAB 4E45A 3MGQD 1B67A 3W96A 4WU9B 3WTPC 1TZYB 5BO0A 3B0DB 5AY8A 5GXQA 5GT0A 1S32A 3REKD 5CPJA 3X1SD 4AWLB 5DNMA 5KDMA 3REIC 1P3GB 3B0CW 5AVCD 4EO5B 3UT9B 3W96C 4X23B 4Z5TB 3MNNB 3NQJA 3O62B 3WTPD 3LZ0B 5AY8C 5GXQC 3R45B 5C3IC 3AZMC 3B6GD 3W97A 3AZLA 1HQ3B 5GT0C 1P3MD 3W98A 1P34A 3AZGA 3REHD 2HUEB 5DNMC 3KUYD 3AV1D 4J8XD 5G49A 5JA4B 3X1UB 2F8NK 1P3BA 5F99A 3UTBD 5GT3B 5JRGB 1EQZD 5GXQD 5B0YA 3MGSA 3AZMD 3AZLC 1P3FA 3W97C 4Z2MH 1TAFB 5B40D 3AFAB 3WTPE 3X1TA 1P34C 3AZGC 5B2IA 5DNNA 5DNMD 4XUJA 1M1AB 5CPKA 5CP6B 3WA9B 1P3IA 3LELA 5F99C 1P3BC 5B24C 3UTAA 5BNVB 5B0YC 1P3FC 3W97D 4Z2MG 5B33A 3REJB 3A6NB 3C1CA 3WAAB 1P34D 4CSRB 3AZGD 3AZHA 1A7WA 3X1VB 5DNNC 1KX5B 5CPKC 4H9OB 1F66B 3AYWB 4H9SA 4NE5A 1P3IC 3LELC 2BYKA 1WWIA 2AROB 5B2JB 2HUEC 5B24D 4G91B 3KWQA 1P3BD 2IO5C 3LJAB 5AV8A 4JJNB 3MGQA 1P3FD 3MGRB 1N1JA 3MNND 1P3PA 1KX3B 2NQBC 4Z66A 3C1CC 5B0ZA 3AZHC 4H9NA 5DNND 4KGCB 3LZ1B 3REKA 4H9SC 1P3ID 3KWQC 3X1SA 5AV9B 5AV8C 1Q9CA 5CP6C 1P3OC 2F8NB 2CWEA 4NE3A 5AVCA 5GT3D 1P3PC 2NQBD 4Z66C 5JRGD 4NE6A 3TU4A 5B32B 2CV5B 5AVBA 3C1CD 3B6GA 4YS3C 5B0ZC 2F8NH 4J8UB 3REJC 1P3KC 3REKC 1P3MA 5GSUB 3X1VC 1U35B 3B6FA 4H9RB 3KWQD 3X1SC 3REHA 3VH5T 5AV6B 1M1AD 3KUYA 5AV8D 1P3OD 5CP6D 2FJ7B 3AV1A 4J8XA 5AVCC 3C1BB 4LD9B 3VH6T 3AZNB 5BNXB 5B1MB 4QLCB 3UTBA 4J8VA 1P3PD 3AZIA 4Z66D 3TU4C 5AVBC 1EQZA 1P3LA 1S32B 1BH8B 3B6GC 4UUZA 4YS3D 5B0ZD 3AZMA 5CPJB 2F8NG 3REJD 4G92C 4ZUXB 1P3KD 5B40A 1P3MC 3RELC 3X1VD 3B6FC 2HIOB 3REHC 3KUYC 1F66D 3WKJB 3AV1C 1ULYA 3AZKA 4J8XC 1KX4C 4J8WB 5B1LB 4WU8A 3UTBC 4J8VC 1JFIB 3AZIC 4H9PB 2BYMB 2LY8A 3LJAD 1EQZC 3TU4D 5AVBD 1ZLAA 1P3LC 3MGRD 3W98B 4WU9A 1M19B 3AN2B 1ID3B 2PYOB 2CV5C 5B40C 4KHAB 4R8PB 3RELD 3B6FD 3AV2B 4WNNB 3AZKC 4ZBJC 5B31B 1P3AB 1KX4D 4WU8C 3MGSB 5B24A 4J8VD 5BS7C 3AZID 1P3GA 3W99B 2F8ND 1ZLAC 1P3LD 2YFWB 4LD9C 2NZDB 3X1TB 4YM6B 4WU9C 3LZ0A 1TZYC 4Z5TA 3MNNA 2YFVB 3O62A 3AZJB 3B0DC 3R45A 2CV5D 5B2IB 4KUDB 4XZQB 4XUJB 5AV5B 3UTAB 1AOIB 3AZKD 1U35D 5E5AB 3MGPB 4AWLC 4WU8D 5AV6D 1P3GC 5B33B 5CPIB 1ZLAD 4EO5C 5JA4A 3C1BD 3UT9C 3AZND 5B1MD 4LD9D 4X23C 3LZ0C 4Z5TC 3MNNC 4WU9D 5GT3A 1TZYD 5B31G 3O62C 3MVDB 2NQBA 5JRGA 5CHLB 3KXBB 3V9RB 1HQ3C 5FUGA 3AN2C 4ZUXD 1TAFA 3AFAA 3AZEB 5BT1C 3AV2C 3MGQB 1N1JB 1P3GD 1M1AA 3WKJD 1HTAA 1P3OA 5CP6A 4HGAB 3WA9A 4CAYB 3X1UC 3UT9D 5B1LD 1M18B 4X23D 4WV4B 4Z5TD 5BNVA 5GT3C 3O62D 3LZ0D 1BH9B 5JRGC 1H3OA 4YS3A 1HQ3D 3AN2D 1ID3D 3REJA 4WZSB 3AFAC 1P3KA 4KUDC 5BT1D 3NQUA 4CSRA 3AZFB 3AV2D 3X1VA 1BFMA 1KX5A 1M1AC 4H9OA 1F66A 3WTPB 5B31D 3WA9C 3X1UD 1P3AD 5B2JA 3W99D 3LJAA 4H9QA 3MGRA 4YM6D 3B0CT 3A6NC 4KUDD 3AFAD 3WAAC 3REIB 5AV5D 3RELA 1KX5C 4KGCA 1AOID 1F66C 3W96B 3AYWC 5BO0B 3WA9D 5AY8B 5GXQB 2AROC 5B2JC 3MGPD 4G91C 1KX4A 3AZMB 5AV9A 3LJAC 4JJNC 2F8NA 4M6BA 5GT0B 3MGRC 2JSSA 1B6WA 3MVDD 1KX3C 3A6ND 2CV5A 3KXBD 3KSYA 5DNMB 5KDMB 3WAAD 4J8UA 5B32G 1WWSA 4KGCC 3LZ1C 1KX5D 3NQJB 3AYWD 5GSUA 2AROD 1U35A 5B2JD 4H9RA 5AV9C 5AV6A 3AZLB 3W97B 5BS7A 4JJND 2FJ7A 3C1BA 4LD9A 3AZNA 1F1EA 5BNXA 5B1MA 1M18D 4QLCA 1P34B 1TZYA 3AZGB 1KX3D 5B32C 1BH8A 4J8UC 5G49B 4ZUXA 5F99B 1P3BB 5B24B 3LZ1D 4KGCD 5GSUC 3AZFD 5B0YB 1U35C 2HIOA 5AV6C 1P3FB 5AV9D 2FJ7C 3WKJA 2L5AA 3C1BC 3AZNC 4J8WA 5B1MC 3UT9A 4QLCC 5B1LA 4X23A 1JFIA 3VH5W 4H9PA 2BYMA 5B32D 1S32C 5DNNB 5CPJC 5CPKB 3VH6W 4J8UD 1HQ3A 3AN2A 1P3IB 4ZUXC 3LELB 1M19A 1ID3A 2PYOA 3REID 4KHAA 5GSUD 4NFTA 2IO5B 4R8PA 2HIOC 1KU5A 3AV2A 3W96D 3WKJC 4WNNA 2FJ7D 2NQBB 5AY8D 5B31A 4J8WC 3X1UA 1P3AA 5B1LC 3C1CB 4QLCD 3W99A 3AZHB 5FUGB 5GT0D 2NZDA 2YFWA 1S32D 5CPJD 3W98C 4YM6A 1M19C 2YFVA 1ID3C 2BYKB 3AZJA 2PYOC 3KWQB 4KUDA 4XZQA 4R8PC 5AV8B 1P3OB 5AV5A 2HIOD 1AOIA 1P3PB 5B31C 4Z66B 1P3AC
chains in the Genus database with same CATH superfamily
4J8WD 5E5AA 3MGSC 3MGPA 3AZLD 3W99C 5B0ZB 4YS3B 4H9NB 5CPIA 2NZDC 1P3KB 3X1TC 4YM6C 3REKB 3W98D 3NQUB 3MVDA 3AZJC 2BG1A 1M19D 2PYOD 5B2IC 3X1SB 3A6NA 4XZQC 3KXBA 4XUJC 3V9RA 3WAAA 4R8PD 5AV5C 3VH5A 3B0BA 4DRBA 3EPKA 5AVCB 5F99D 3UTAC 1AOIC 2RVQC 3AZEA 3VH6A 3AYWA 4H9QB 5B0YD 5E5AC 5AVBB 3TU4B 2AROA 3MGPC 3MGSD 3B6GB 5B33C 4JJNA 5CPIC 4DRAA 4G92B 2NZDD 4CAYA 2F2AC 3X1TD 3MVDC 1P3MB 1M18A 3RELB 3AZJD 1BH9A 3H0LC 1KX3A 3B6FB 5B2ID 3KXBC 3REHB 4XZQD 1Z2CB 4XUJD 3KUYB 5CPKD 1R4VA 4DQYB 1H3OB 3AV1B 4J8XB 3LELD 3EPHA 1KX4B 3UTAD 3LZ1A 3UTBB 4J8VB 3AZEC 2RVQD 3AZIB 1EQZB 3AZFA 5E5AD 1P3LB 3MGQC 5C3IB 4UUZB 5B33D 4HGAC 3WTPA 5CPID 5B40B 1M18C 3AZHD 5B32A 2XD1A 3AZKB 4ZBJB 4E44A 4WU8B 3AZED 3REIA 3H0MC 3AZFC 2ZY4A 1ZLAB 4E45A 3MGQD 1B67A 3W96A 4WU9B 1TZYB 3WTPC 5BO0A 4UPKA 3B0DB 5AY8A 5GXQA 5GT0A 2JE5A 1S32A 3REKD 5CPJA 3EG5B 3X1SD 3P5JB 4AWLB 5DNMA 5KDMA 3REIC 1P3GB 3B0CW 5AVCD 4EO5B 3UT9B 3W96C 4X23B 4Z5TB 3MNNB 3NQJA 3O62B 3WTPD 3LZ0B 5AY8C 5GXQC 3R45B 5C3IC 3AZMC 3B6GD 3W97A 3AZLA 1HQ3B 5GT0C 1P3MD 3W98A 1P34A 3AZGA 3REHD 2HUEB 5DNMC 3KUYD 3AV1D 4J8XD 5G49A 5JA4B 3X1UB 2F8NK 1P3BA 5F99A 3UTBD 5GT3B 5JRGB 1EQZD 5GXQD 5B0YA 3MGSA 3AZMD 3AZLC 1P3FA 3W97C 4Z2MH 1TAFB 2Y2QA 5B40D 3AFAB 3WTPE 3X1TA 1P34C 3AZGC 5B2IA 5DNNA 5DNMD 4XUJA 1M1AB 5CPKA 5CP6B 3WA9B 1P3IA 3LELA 5F99C 1P3BC 5B24C 3UTAA 5BNVB 2JCHA 5B0YC 1P3FC 3W97D 4Z2MG 5B33A 3REJB 3A6NB 3C1CA 3WAAB 1P34D 4CSRB 3AZGD 3AZHA 1A7WA 3X1VB 1PZRA 5DNNC 1KX5B 5CPKC 4H9OB 1F66B 3AYWB 4H9SA 4NE5A 1P3IC 3LELC 2BYKA 1WWIA 2AROB 5B2JB 2HUEC 5B24D 4G91B 3KWQA 1P3BD 2Y2IA 2IO5C 3LJAB 5AV8A 4JJNB 3MGQA 1P3FD 3MGRB 1N1JA 3MNND 1P3PA 1KX3B 2NQBC 4Z66A 3C1CC 4WJ3C 2DQNC 5B0ZA 3AZHC 4H9NA 1T3UA 2Y2NA 5DNND 4KGCB 3LZ1B 3REKA 4H9SC 1P3ID 3KWQC 3X1SA 5AV9B 5AV8C 1Q9CA 5CP6C 1P3OC 2F8NB 2CWEA 4NE3A 5AVCA 5GT3D 1P3PC 2NQBD 5JRGD 4Z66C 4NE6A 3TU4A 5B32B 2CV5B 5AVBA 3C1CD 3B6GA 4YS3C 5B0ZC 2F8NH 4J8UB 3REJC 1P3KC 3REKC 1P3MA 5GSUB 3X1VC 1U35B 3B6FA 4H9RB 3KWQD 3X1SC 3REHA 3VH5T 5AV6B 1M1AD 3KUYA 5AV8D 1P3OD 2Y2HA 5CP6D 2FJ7B 3AV1A 4J8XA 5AVCC 3C1BB 4LD9B 3VH6T 3AZNB 5BNXB 5B1MB 2Y2GA 4QLCB 3UTBA 3KFUG 4J8VA 1P3PD 3AZIA 4Z66D 3TU4C 2VQRA 5AVBC 1EQZA 1P3LA 1S32B 1BH8B 3B6GC 4UUZA 4YS3D 5B0ZD 3AZMA 5CPJB 2F8NG 2Y2LA 3REJD 4G92C 4ZUXB 1P3KD 5B40A 1P3MC 3RELC 3X1VD 3B6FC 2HIOB 3REHC 3KUYC 1F66D 3WKJB 3AV1C 1ULYA 3AZKA 4J8XC 1KX4C 4J8WB 5B1LB 4WU8A 3UTBC 4J8VC 1JFIB 3AZIC 4H9PB 2BYMB 2LY8A 3LJAD 1EQZC 3TU4D 5AVBD 1ZLAA 1P3LC 3MGRD 3W98B 4WU9A 2Y2JA 1M19B 3AN2B 1ID3B 2PYOB 2CV5C 5B40C 4KHAB 4R8PB 3RELD 3B6FD 3AV2B 4WNNB 3EPJA 3AZKC 4ZBJC 5B31B 2UWXA 1P3AB 1KX4D 4WU8C 3FDDA 5B24A 3MGSB 4J8VD 5BS7C 3AZID 1P3GA 3W99B 2F8ND 1ZLAC 1P3LD 2YFWB 4LD9C 2NZDB 3X1TB 4YM6B 4WU9C 3LZ0A 1TZYC 4Z5TA 3MNNA 2YFVB 3O62A 3AZJB 3B0DC 3R45A 2CV5D 5B2IB 4KUDB 4XZQB 4XUJB 5AV5B 2J8PA 3UTAB 1AOIB 3AZKD 2Y2MA 1U35D 5E5AB 3MGPB 4AWLC 4WU8D 5AV6D 1P3GC 5B33B 5CPIB 1ZLAD 4EO5C 5JA4A 3C1BD 3UT9C 3AZND 5B1MD 4LD9D 4X23C 3LZ0C 4Z5TC 3MNNC 4WU9D 5GT3A 1TZYD 5B31G 3O62C 3MVDB 3A1IA 2NQBA 5JRGA 5CHLB 3KXBB 3V9RB 1HQ3C 5FUGA 3AN2C 4ZUXD 1TAFA 2Y2KA 2Y2PA 3AFAA 3AZEB 5BT1C 3AV2C 3MGQB 1N1JB 3IP4C 1P3GD 1M1AA 3WKJD 1HTAA 1P3OA 5CP6A 4HGAB 3WA9A 4CAYB 3H0RC 3X1UC 3UT9D 5B1LD 1M18B 4X23D 4WV4B 4Z5TD 5BNVA 5GT3C 3O62D 3LZ0D 1BH9B 5JRGC 1H3OA 4YS3A 1HQ3D 3AN2D 1ID3D 3REJA 4WZSB 3AFAC 1P3KA 4KUDC 3A1KA 5BT1D 3NQUA 4CSRA 3AZFB 3AV2D 3X1VA 1BFMA 1KX5A 1M1AC 4H9OA 1F66A 3WTPB 5B31D 3WA9C 3X1UD 1P3AD 5B2JA 2ZY5A 3W99D 3LJAA 4H9QA 3MGRA 4YM6D 3B0CT 3A6NC 2FFFB 3AFAD 4KUDD 3WAAC 3AL0C 3REIB 5AV5D 3RELA 1KX5C 4KGCA 1AOID 1F66C 3W96B 3AYWC 5BO0B 3WA9D 5AY8B 5GXQB 2AROC 5B2JC 3MGPD 4G91C 1KX4A 2RIQA 3AZMB 5AV9A 3LJAC 4JJNC 2F8NA 4M6BA 5GT0B 3MGRC 2JSSA 1B6WA 3MVDD 1KX3C 2G5HC 3A6ND 2CV5A 3KXBD 3KSYA 5DNMB 5KDMB 3WAAD 4J8UA 2XD5A 5B32G 1WWSA 4KGCC 2ZY2A 3LZ1C 1KX5D 3NQJB 3AYWD 5GSUA 3F6TA 2AROD 1U35A 5B2JD 4H9RA 5AV9C 5AV6A 3AZLB 3W97B 5BS7A 4JJND 2FJ7A 3C1BA 4LD9A 3AZNA 1F1EA 5BNXA 5B1MA 1M18D 4QLCA 1P34B 1TZYA 3AZGB 1KX3D 5B32C 1BH8A 4J8UC 5G49B 4ZUXA 5F99B 1P3BB 5B24B 3LZ1D 4KGCD 5GSUC 3AZFD 5B0YB 1U35C 2HIOA 5AV6C 1P3FB 5AV9D 2FJ7C 3WKJA 2L5AA 3C1BC 3AZNC 4J8WA 5B1MC 3UT9A 4QLCC 5B1LA 4X23A 1JFIA 3VH5W 4H9PA 2BYMA 5B32D 1S32C 5DNNB 5CPJC 5CPKB 3VH6W 4J8UD 2ZY3A 1HQ3A 3AN2A 1P3IB 4ZUXC 3LELB 1M19A 1ID3A 2PYOA 3REID 4KHAA 5GSUD 4NFTA 2IO5B 4R8PA 2HIOC 1KU5A 3EPLA 3AV2A 2W8SA 1W2EA 3W96D 3WKJC 4WNNA 2FJ7D 2NQBB 5AY8D 5B31A 4J8WC 2Y2OA 3X1UA 1P3AA 5B1LC 3C1CB 4QLCD 3W99A 3AZHB 5FUGB 5GT0D 2NZDA 2YFWA 1S32D 5CPJD 3W98C 4YM6A 1M19C 2YFVA 1ID3C 2BYKB 3AZJA 2PYOC 3KWQB 2ZM5A 4KUDA 2G5IC 4XZQA 4R8PC 5AV8B 1P3OB 5AV5A 2HIOD 2DF4C 1AOIA 1P3PB 5B31C 4Z66B 1P3AC
chains in the Genus database with same CATH topology
4J8WD 5E5AA 3MGSC 3MGPA 3AZLD 3W99C 5B0ZB 4YS3B 4H9NB 5CPIA 2NZDC 1P3KB 3X1TC 4YM6C 3REKB 3W98D 3NQUB 3MVDA 3AZJC 2BG1A 1M19D 2PYOD 5B2IC 3X1SB 3A6NA 4XZQC 3KXBA 4XUJC 3V9RA 3WAAA 4R8PD 5AV5C 3VH5A 3B0BA 4DRBA 3EPKA 5AVCB 5F99D 3UTAC 1AOIC 2RVQC 3AZEA 3VH6A 3AYWA 4H9QB 5B0YD 5E5AC 5AVBB 3TU4B 2AROA 3MGPC 3MGSD 3B6GB 5B33C 4JJNA 5CPIC 4DRAA 4G92B 2NZDD 4CAYA 2F2AC 3X1TD 3MVDC 1P3MB 1M18A 3RELB 3AZJD 1BH9A 3H0LC 1KX3A 3B6FB 5B2ID 3KXBC 3REHB 4XZQD 1Z2CB 4XUJD 3KUYB 5CPKD 1R4VA 4DQYB 1H3OB 3AV1B 4J8XB 3LELD 3EPHA 1KX4B 3UTAD 3LZ1A 3UTBB 4J8VB 3AZEC 2RVQD 3AZIB 1EQZB 3AZFA 5E5AD 1P3LB 3MGQC 5C3IB 4UUZB 5B33D 4HGAC 3WTPA 5CPID 5B40B 1M18C 3AZHD 5B32A 2XD1A 3AZKB 4ZBJB 4E44A 4WU8B 3AZED 3REIA 3H0MC 3AZFC 2ZY4A 1ZLAB 4E45A 3MGQD 1B67A 3W96A 4WU9B 1TZYB 3WTPC 5BO0A 4UPKA 3B0DB 5AY8A 5GXQA 5GT0A 2JE5A 1S32A 3REKD 5CPJA 3EG5B 3X1SD 3P5JB 4AWLB 5DNMA 5KDMA 3REIC 1P3GB 3B0CW 5AVCD 4EO5B 3UT9B 3W96C 4X23B 4Z5TB 3MNNB 3NQJA 3O62B 3WTPD 3LZ0B 5AY8C 5GXQC 3R45B 5C3IC 3AZMC 3B6GD 3W97A 3AZLA 1HQ3B 5GT0C 1P3MD 3W98A 1P34A 3AZGA 3REHD 2HUEB 5DNMC 3KUYD 3AV1D 4J8XD 5G49A 5JA4B 3X1UB 2F8NK 1P3BA 5F99A 3UTBD 5GT3B 5JRGB 1EQZD 5GXQD 5B0YA 3MGSA 3AZMD 3AZLC 1P3FA 3W97C 4Z2MH 1TAFB 2Y2QA 5B40D 3AFAB 3WTPE 3X1TA 1P34C 3AZGC 5B2IA 5DNNA 5DNMD 4XUJA 1M1AB 5CPKA 5CP6B 3WA9B 1P3IA 3LELA 5F99C 1P3BC 5B24C 3UTAA 5BNVB 2JCHA 5B0YC 1P3FC 3W97D 4Z2MG 5B33A 3REJB 3A6NB 3C1CA 3WAAB 1P34D 4CSRB 3AZGD 3AZHA 1A7WA 3X1VB 1PZRA 5DNNC 1KX5B 5CPKC 4H9OB 1F66B 3AYWB 4H9SA 4NE5A 1P3IC 3LELC 2BYKA 1WWIA 2AROB 5B2JB 2HUEC 5B24D 4G91B 3KWQA 1P3BD 2Y2IA 2IO5C 3LJAB 5AV8A 4JJNB 3MGQA 1P3FD 3MGRB 1N1JA 3MNND 1P3PA 1KX3B 2NQBC 4Z66A 3C1CC 4WJ3C 2DQNC 5B0ZA 3AZHC 4H9NA 1T3UA 2Y2NA 5DNND 4KGCB 3LZ1B 3REKA 4H9SC 1P3ID 3KWQC 3X1SA 5AV9B 5AV8C 1Q9CA 5CP6C 1P3OC 2F8NB 2CWEA 4NE3A 5AVCA 5GT3D 1P3PC 2NQBD 5JRGD 4Z66C 4NE6A 3TU4A 5B32B 2CV5B 5AVBA 3C1CD 3B6GA 4YS3C 5B0ZC 2F8NH 4J8UB 3REJC 1P3KC 3REKC 1P3MA 5GSUB 3X1VC 1U35B 3B6FA 4H9RB 3KWQD 3X1SC 3REHA 3VH5T 5AV6B 1M1AD 3KUYA 5AV8D 1P3OD 2Y2HA 5CP6D 2FJ7B 3AV1A 4J8XA 5AVCC 3C1BB 4LD9B 3VH6T 3AZNB 5BNXB 5B1MB 2Y2GA 4QLCB 3UTBA 3KFUG 4J8VA 1P3PD 3AZIA 4Z66D 3TU4C 2VQRA 5AVBC 1EQZA 1P3LA 1S32B 1BH8B 3B6GC 4UUZA 4YS3D 5B0ZD 3AZMA 5CPJB 2F8NG 2Y2LA 3REJD 4G92C 4ZUXB 1P3KD 5B40A 1P3MC 3RELC 3X1VD 3B6FC 2HIOB 3REHC 3KUYC 1F66D 3WKJB 3AV1C 1ULYA 3AZKA 4J8XC 1KX4C 4J8WB 5B1LB 4WU8A 3UTBC 4J8VC 1JFIB 3AZIC 4H9PB 2BYMB 2LY8A 3LJAD 1EQZC 3TU4D 5AVBD 1ZLAA 1P3LC 3MGRD 3W98B 4WU9A 2Y2JA 1M19B 3AN2B 1ID3B 2PYOB 2CV5C 5B40C 4KHAB 4R8PB 3RELD 3B6FD 3AV2B 4WNNB 3EPJA 3AZKC 4ZBJC 5B31B 2UWXA 1P3AB 1KX4D 4WU8C 3FDDA 5B24A 3MGSB 4J8VD 5BS7C 3AZID 1P3GA 3W99B 2F8ND 1ZLAC 1P3LD 2YFWB 4LD9C 2NZDB 3X1TB 4YM6B 4WU9C 3LZ0A 1TZYC 4Z5TA 3MNNA 2YFVB 3O62A 3AZJB 3B0DC 3R45A 2CV5D 5B2IB 4KUDB 4XZQB 4XUJB 5AV5B 2J8PA 3UTAB 1AOIB 3AZKD 2Y2MA 1U35D 5E5AB 3MGPB 4AWLC 4WU8D 5AV6D 1P3GC 5B33B 5CPIB 1ZLAD 4EO5C 5JA4A 3C1BD 3UT9C 3AZND 5B1MD 4LD9D 4X23C 3LZ0C 4Z5TC 3MNNC 4WU9D 5GT3A 1TZYD 5B31G 3O62C 3MVDB 3A1IA 2NQBA 5JRGA 5CHLB 3KXBB 3V9RB 1HQ3C 5FUGA 3AN2C 4ZUXD 1TAFA 2Y2KA 2Y2PA 3AFAA 3AZEB 5BT1C 3AV2C 3MGQB 1N1JB 3IP4C 1P3GD 1M1AA 3WKJD 1HTAA 1P3OA 5CP6A 4HGAB 3WA9A 4CAYB 3H0RC 3X1UC 3UT9D 5B1LD 1M18B 4X23D 4WV4B 4Z5TD 5BNVA 5GT3C 3O62D 3LZ0D 1BH9B 5JRGC 1H3OA 4YS3A 1HQ3D 3AN2D 1ID3D 3REJA 4WZSB 3AFAC 1P3KA 4KUDC 3A1KA 5BT1D 3NQUA 4CSRA 3AZFB 3AV2D 3X1VA 1BFMA 1KX5A 1M1AC 4H9OA 1F66A 3WTPB 5B31D 3WA9C 3X1UD 1P3AD 5B2JA 2ZY5A 3W99D 3LJAA 4H9QA 3MGRA 4YM6D 3B0CT 3A6NC 2FFFB 3AFAD 4KUDD 3WAAC 3AL0C 3REIB 5AV5D 3RELA 1KX5C 4KGCA 1AOID 1F66C 3W96B 3AYWC 5BO0B 3WA9D 5AY8B 5GXQB 2AROC 5B2JC 3MGPD 4G91C 1KX4A 2RIQA 3AZMB 5AV9A 3LJAC 4JJNC 2F8NA 4M6BA 5GT0B 3MGRC 2JSSA 1B6WA 3MVDD 1KX3C 2G5HC 3A6ND 2CV5A 3KXBD 3KSYA 5DNMB 5KDMB 3WAAD 4J8UA 2XD5A 5B32G 1WWSA 4KGCC 2ZY2A 3LZ1C 1KX5D 3NQJB 3AYWD 5GSUA 3F6TA 2AROD 1U35A 5B2JD 4H9RA 5AV9C 5AV6A 3AZLB 3W97B 5BS7A 4JJND 2FJ7A 3C1BA 4LD9A 3AZNA 1F1EA 5BNXA 5B1MA 1M18D 4QLCA 1P34B 1TZYA 3AZGB 1KX3D 5B32C 1BH8A 4J8UC 5G49B 4ZUXA 5F99B 1P3BB 5B24B 3LZ1D 4KGCD 5GSUC 3AZFD 5B0YB 1U35C 2HIOA 5AV6C 1P3FB 5AV9D 2FJ7C 3WKJA 2L5AA 3C1BC 3AZNC 4J8WA 5B1MC 3UT9A 4QLCC 5B1LA 4X23A 1JFIA 3VH5W 4H9PA 2BYMA 5B32D 1S32C 5DNNB 5CPJC 5CPKB 3VH6W 4J8UD 2ZY3A 1HQ3A 3AN2A 1P3IB 4ZUXC 3LELB 1M19A 1ID3A 2PYOA 3REID 4KHAA 5GSUD 4NFTA 2IO5B 4R8PA 2HIOC 1KU5A 3EPLA 3AV2A 2W8SA 1W2EA 3W96D 3WKJC 4WNNA 2FJ7D 2NQBB 5AY8D 5B31A 4J8WC 2Y2OA 3X1UA 1P3AA 5B1LC 3C1CB 4QLCD 3W99A 3AZHB 5FUGB 5GT0D 2NZDA 2YFWA 1S32D 5CPJD 3W98C 4YM6A 1M19C 2YFVA 1ID3C 2BYKB 3AZJA 2PYOC 3KWQB 2ZM5A 4KUDA 2G5IC 4XZQA 4R8PC 5AV8B 1P3OB 5AV5A 2HIOD 2DF4C 1AOIA 1P3PB 5B31C 4Z66B 1P3AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W D;  5E5A A;  3MGS C;  3MGP A;  3AZL D;  3W99 C;  5B0Z B;  4YS3 B;  4H9N B;  5CPI A;  2NZD C;  1P3K B;  3X1T C;  4YM6 C;  3REK B;  3W98 D;  3NQU B;  3MVD A;  3AZJ C;  1M19 D;  2PYO D;  5B2I C;  3X1S B;  3A6N A;  4XZQ C;  3KXB A;  4XUJ C;  3V9R A;  3WAA A;  4R8P D;  5AV5 C;  3VH5 A;  3B0B A;  4DRB A;  5AVC B;  5F99 D;  3UTA C;  1AOI C;  2RVQ C;  3AZE A;  3VH6 A;  3AYW A;  4H9Q B;  5B0Y D;  5E5A C;  5AVB B;  3TU4 B;  2ARO A;  3MGP C;  3MGS D;  3B6G B;  5B33 C;  4JJN A;  5CPI C;  4DRA A;  4G92 B;  2NZD D;  4CAY A;  3X1T D;  3MVD C;  1P3M B;  1M18 A;  3REL B;  3AZJ D;  1BH9 A;  1KX3 A;  3B6F B;  5B2I D;  3KXB C;  3REH B;  4XZQ D;  4XUJ D;  3KUY B;  5CPK D;  1R4V A;  1H3O B;  3AV1 B;  4J8X B;  3LEL D;  1KX4 B;  3UTA D;  3LZ1 A;  3UTB B;  4J8V B;  3AZE C;  2RVQ D;  3AZI B;  1EQZ B;  3AZF A;  5E5A D;  1P3L B;  3MGQ C;  5C3I B;  4UUZ B;  5B33 D;  4HGA C;  3WTP A;  5CPI D;  5B40 B;  1M18 C;  3AZH D;  5B32 A;  3AZK B;  4ZBJ B;  4E44 A;  4WU8 B;  3AZE D;  3REI A;  3AZF C;  1ZLA B;  4E45 A;  3MGQ D;  1B67 A;  3W96 A;  4WU9 B;  3WTP C;  1TZY B;  5BO0 A;  3B0D B;  5AY8 A;  5GXQ A;  5GT0 A;  1S32 A;  3REK D;  5CPJ A;  3X1S D;  4AWL B;  5DNM A;  5KDM A;  3REI C;  1P3G B;  3B0C W;  5AVC D;  4EO5 B;  3UT9 B;  3W96 C;  4X23 B;  4Z5T B;  3MNN B;  3NQJ A;  3O62 B;  3WTP D;  3LZ0 B;  5AY8 C;  5GXQ C;  3R45 B;  5C3I C;  3AZM C;  3B6G D;  3W97 A;  3AZL A;  1HQ3 B;  5GT0 C;  1P3M D;  3W98 A;  1P34 A;  3AZG A;  3REH D;  2HUE B;  5DNM C;  3KUY D;  3AV1 D;  4J8X D;  5G49 A;  5JA4 B;  3X1U B;  2F8N K;  1P3B A;  5F99 A;  3UTB D;  5GT3 B;  5JRG B;  1EQZ D;  5GXQ D;  5B0Y A;  3MGS A;  3AZM D;  3AZL C;  1P3F A;  3W97 C;  4Z2M H;  1TAF B;  5B40 D;  3AFA B;  3WTP E;  3X1T A;  1P34 C;  3AZG C;  5B2I A;  5DNN A;  5DNM D;  4XUJ A;  1M1A B;  5CPK A;  5CP6 B;  3WA9 B;  1P3I A;  3LEL A;  5F99 C;  1P3B C;  5B24 C;  3UTA A;  5BNV B;  5B0Y C;  1P3F C;  3W97 D;  4Z2M G;  5B33 A;  3REJ B;  3A6N B;  3C1C A;  3WAA B;  1P34 D;  4CSR B;  3AZG D;  3AZH A;  1A7W A;  3X1V B;  5DNN C;  1KX5 B;  5CPK C;  4H9O B;  1F66 B;  3AYW B;  4H9S A;  4NE5 A;  1P3I C;  3LEL C;  2BYK A;  1WWI A;  2ARO B;  5B2J B;  2HUE C;  5B24 D;  4G91 B;  3KWQ A;  1P3B D;  2IO5 C;  3LJA B;  5AV8 A;  4JJN B;  3MGQ A;  1P3F D;  3MGR B;  1N1J A;  3MNN D;  1P3P A;  1KX3 B;  2NQB C;  4Z66 A;  3C1C C;  5B0Z A;  3AZH C;  4H9N A;  5DNN D;  4KGC B;  3LZ1 B;  3REK A;  4H9S C;  1P3I D;  3KWQ C;  3X1S A;  5AV9 B;  5AV8 C;  1Q9C A;  5CP6 C;  1P3O C;  2F8N B;  2CWE A;  4NE3 A;  5AVC A;  5GT3 D;  1P3P C;  2NQB D;  4Z66 C;  5JRG D;  4NE6 A;  3TU4 A;  5B32 B;  2CV5 B;  5AVB A;  3C1C D;  3B6G A;  4YS3 C;  5B0Z C;  2F8N H;  4J8U B;  3REJ C;  1P3K C;  3REK C;  1P3M A;  5GSU B;  3X1V C;  1U35 B;  3B6F A;  4H9R B;  3KWQ D;  3X1S C;  3REH A;  3VH5 T;  5AV6 B;  1M1A D;  3KUY A;  5AV8 D;  1P3O D;  5CP6 D;  2FJ7 B;  3AV1 A;  4J8X A;  5AVC C;  3C1B B;  4LD9 B;  3VH6 T;  3AZN B;  5BNX B;  5B1M B;  4QLC B;  3UTB A;  4J8V A;  1P3P D;  3AZI A;  4Z66 D;  3TU4 C;  5AVB C;  1EQZ A;  1P3L A;  1S32 B;  1BH8 B;  3B6G C;  4UUZ A;  4YS3 D;  5B0Z D;  3AZM A;  5CPJ B;  2F8N G;  3REJ D;  4G92 C;  4ZUX B;  1P3K D;  5B40 A;  1P3M C;  3REL C;  3X1V D;  3B6F C;  2HIO B;  3REH C;  3KUY C;  1F66 D;  3WKJ B;  3AV1 C;  1ULY A;  3AZK A;  4J8X C;  1KX4 C;  4J8W B;  5B1L B;  4WU8 A;  3UTB C;  4J8V C;  1JFI B;  3AZI C;  4H9P B;  2BYM B;  2LY8 A;  3LJA D;  1EQZ C;  3TU4 D;  5AVB D;  1ZLA A;  1P3L C;  3MGR D;  3W98 B;  4WU9 A;  1M19 B;  3AN2 B;  1ID3 B;  2PYO B;  2CV5 C;  5B40 C;  4KHA B;  4R8P B;  3REL D;  3B6F D;  3AV2 B;  4WNN B;  3AZK C;  4ZBJ C;  5B31 B;  1P3A B;  1KX4 D;  4WU8 C;  3MGS B;  5B24 A;  4J8V D;  5BS7 C;  3AZI D;  1P3G A;  3W99 B;  2F8N D;  1ZLA C;  1P3L D;  2YFW B;  4LD9 C;  2NZD B;  3X1T B;  4YM6 B;  4WU9 C;  3LZ0 A;  1TZY C;  4Z5T A;  3MNN A;  2YFV B;  3O62 A;  3AZJ B;  3B0D C;  3R45 A;  2CV5 D;  5B2I B;  4KUD B;  4XZQ B;  4XUJ B;  5AV5 B;  3UTA B;  1AOI B;  3AZK D;  1U35 D;  5E5A B;  3MGP B;  4AWL C;  4WU8 D;  5AV6 D;  1P3G C;  5B33 B;  5CPI B;  1ZLA D;  4EO5 C;  5JA4 A;  3C1B D;  3UT9 C;  3AZN D;  5B1M D;  4LD9 D;  4X23 C;  3LZ0 C;  4Z5T C;  3MNN C;  4WU9 D;  5GT3 A;  1TZY D;  5B31 G;  3O62 C;  3MVD B;  2NQB A;  5JRG A;  5CHL B;  3KXB B;  3V9R B;  1HQ3 C;  5FUG A;  3AN2 C;  4ZUX D;  1TAF A;  3AFA A;  3AZE B;  5BT1 C;  3AV2 C;  3MGQ B;  1N1J B;  1P3G D;  1M1A A;  3WKJ D;  1HTA A;  1P3O A;  5CP6 A;  4HGA B;  3WA9 A;  4CAY B;  3X1U C;  3UT9 D;  5B1L D;  1M18 B;  4X23 D;  4WV4 B;  4Z5T D;  5BNV A;  5GT3 C;  3O62 D;  3LZ0 D;  1BH9 B;  5JRG C;  1H3O A;  4YS3 A;  1HQ3 D;  3AN2 D;  1ID3 D;  3REJ A;  4WZS B;  3AFA C;  1P3K A;  4KUD C;  5BT1 D;  3NQU A;  4CSR A;  3AZF B;  3AV2 D;  3X1V A;  1BFM A;  1KX5 A;  1M1A C;  4H9O A;  1F66 A;  3WTP B;  5B31 D;  3WA9 C;  3X1U D;  1P3A D;  5B2J A;  3W99 D;  3LJA A;  4H9Q A;  3MGR A;  4YM6 D;  3B0C T;  3A6N C;  4KUD D;  3AFA D;  3WAA C;  3REI B;  5AV5 D;  3REL A;  1KX5 C;  4KGC A;  1AOI D;  1F66 C;  3W96 B;  3AYW C;  5BO0 B;  3WA9 D;  5AY8 B;  5GXQ B;  2ARO C;  5B2J C;  3MGP D;  4G91 C;  1KX4 A;  3AZM B;  5AV9 A;  3LJA C;  4JJN C;  2F8N A;  4M6B A;  5GT0 B;  3MGR C;  2JSS A;  1B6W A;  3MVD D;  1KX3 C;  3A6N D;  2CV5 A;  3KXB D;  3KSY A;  5DNM B;  5KDM B;  3WAA D;  4J8U A;  5B32 G;  1WWS A;  4KGC C;  3LZ1 C;  1KX5 D;  3NQJ B;  3AYW D;  5GSU A;  2ARO D;  1U35 A;  5B2J D;  4H9R A;  5AV9 C;  5AV6 A;  3AZL B;  3W97 B;  5BS7 A;  4JJN D;  2FJ7 A;  3C1B A;  4LD9 A;  3AZN A;  1F1E A;  5BNX A;  5B1M A;  1M18 D;  4QLC A;  1P34 B;  1TZY A;  3AZG B;  1KX3 D;  5B32 C;  1BH8 A;  4J8U C;  5G49 B;  4ZUX A;  5F99 B;  1P3B B;  5B24 B;  3LZ1 D;  4KGC D;  5GSU C;  3AZF D;  5B0Y B;  1U35 C;  2HIO A;  5AV6 C;  1P3F B;  5AV9 D;  2FJ7 C;  3WKJ A;  2L5A A;  3C1B C;  3AZN C;  4J8W A;  5B1M C;  3UT9 A;  4QLC C;  5B1L A;  4X23 A;  1JFI A;  3VH5 W;  4H9P A;  2BYM A;  5B32 D;  1S32 C;  5DNN B;  5CPJ C;  5CPK B;  3VH6 W;  4J8U D;  1HQ3 A;  3AN2 A;  1P3I B;  4ZUX C;  3LEL B;  1M19 A;  1ID3 A;  2PYO A;  3REI D;  4KHA A;  5GSU D;  4NFT A;  2IO5 B;  4R8P A;  2HIO C;  1KU5 A;  3AV2 A;  3W96 D;  3WKJ C;  4WNN A;  2FJ7 D;  2NQB B;  5AY8 D;  5B31 A;  4J8W C;  3X1U A;  1P3A A;  5B1L C;  3C1C B;  4QLC D;  3W99 A;  3AZH B;  5FUG B;  5GT0 D;  2NZD A;  2YFW A;  1S32 D;  5CPJ D;  3W98 C;  4YM6 A;  1M19 C;  2YFV A;  1ID3 C;  2BYK B;  3AZJ A;  2PYO C;  3KWQ B;  4KUD A;  4XZQ A;  4R8P C;  5AV8 B;  1P3O B;  5AV5 A;  2HIO D;  1AOI A;  1P3P B;  5B31 C;  4Z66 B;  1P3A C; 
#chains in the Genus database with same CATH topology
 4J8W D;  5E5A A;  3MGS C;  3MGP A;  3AZL D;  3W99 C;  5B0Z B;  4YS3 B;  4H9N B;  5CPI A;  2NZD C;  1P3K B;  3X1T C;  4YM6 C;  3REK B;  3W98 D;  3NQU B;  3MVD A;  3AZJ C;  2BG1 A;  1M19 D;  2PYO D;  5B2I C;  3X1S B;  3A6N A;  4XZQ C;  3KXB A;  4XUJ C;  3V9R A;  3WAA A;  4R8P D;  5AV5 C;  3VH5 A;  3B0B A;  4DRB A;  3EPK A;  5AVC B;  5F99 D;  3UTA C;  1AOI C;  2RVQ C;  3AZE A;  3VH6 A;  3AYW A;  4H9Q B;  5B0Y D;  5E5A C;  5AVB B;  3TU4 B;  2ARO A;  3MGP C;  3MGS D;  3B6G B;  5B33 C;  4JJN A;  5CPI C;  4DRA A;  4G92 B;  2NZD D;  4CAY A;  2F2A C;  3X1T D;  3MVD C;  1P3M B;  1M18 A;  3REL B;  3AZJ D;  1BH9 A;  3H0L C;  1KX3 A;  3B6F B;  5B2I D;  3KXB C;  3REH B;  4XZQ D;  1Z2C B;  4XUJ D;  3KUY B;  5CPK D;  1R4V A;  4DQY B;  1H3O B;  3AV1 B;  4J8X B;  3LEL D;  3EPH A;  1KX4 B;  3UTA D;  3LZ1 A;  3UTB B;  4J8V B;  3AZE C;  2RVQ D;  3AZI B;  1EQZ B;  3AZF A;  5E5A D;  1P3L B;  3MGQ C;  5C3I B;  4UUZ B;  5B33 D;  4HGA C;  3WTP A;  5CPI D;  5B40 B;  1M18 C;  3AZH D;  5B32 A;  2XD1 A;  3AZK B;  4ZBJ B;  4E44 A;  4WU8 B;  3AZE D;  3REI A;  3H0M C;  3AZF C;  2ZY4 A;  1ZLA B;  4E45 A;  3MGQ D;  1B67 A;  3W96 A;  4WU9 B;  1TZY B;  3WTP C;  5BO0 A;  4UPK A;  3B0D B;  5AY8 A;  5GXQ A;  5GT0 A;  2JE5 A;  1S32 A;  3REK D;  5CPJ A;  3EG5 B;  3X1S D;  3P5J B;  4AWL B;  5DNM A;  5KDM A;  3REI C;  1P3G B;  3B0C W;  5AVC D;  4EO5 B;  3UT9 B;  3W96 C;  4X23 B;  4Z5T B;  3MNN B;  3NQJ A;  3O62 B;  3WTP D;  3LZ0 B;  5AY8 C;  5GXQ C;  3R45 B;  5C3I C;  3AZM C;  3B6G D;  3W97 A;  3AZL A;  1HQ3 B;  5GT0 C;  1P3M D;  3W98 A;  1P34 A;  3AZG A;  3REH D;  2HUE B;  5DNM C;  3KUY D;  3AV1 D;  4J8X D;  5G49 A;  5JA4 B;  3X1U B;  2F8N K;  1P3B A;  5F99 A;  3UTB D;  5GT3 B;  5JRG B;  1EQZ D;  5GXQ D;  5B0Y A;  3MGS A;  3AZM D;  3AZL C;  1P3F A;  3W97 C;  4Z2M H;  1TAF B;  2Y2Q A;  5B40 D;  3AFA B;  3WTP E;  3X1T A;  1P34 C;  3AZG C;  5B2I A;  5DNN A;  5DNM D;  4XUJ A;  1M1A B;  5CPK A;  5CP6 B;  3WA9 B;  1P3I A;  3LEL A;  5F99 C;  1P3B C;  5B24 C;  3UTA A;  5BNV B;  2JCH A;  5B0Y C;  1P3F C;  3W97 D;  4Z2M G;  5B33 A;  3REJ B;  3A6N B;  3C1C A;  3WAA B;  1P34 D;  4CSR B;  3AZG D;  3AZH A;  1A7W A;  3X1V B;  1PZR A;  5DNN C;  1KX5 B;  5CPK C;  4H9O B;  1F66 B;  3AYW B;  4H9S A;  4NE5 A;  1P3I C;  3LEL C;  2BYK A;  1WWI A;  2ARO B;  5B2J B;  2HUE C;  5B24 D;  4G91 B;  3KWQ A;  1P3B D;  2Y2I A;  2IO5 C;  3LJA B;  5AV8 A;  4JJN B;  3MGQ A;  1P3F D;  3MGR B;  1N1J A;  3MNN D;  1P3P A;  1KX3 B;  2NQB C;  4Z66 A;  3C1C C;  4WJ3 C;  2DQN C;  5B0Z A;  3AZH C;  4H9N A;  1T3U A;  2Y2N A;  5DNN D;  4KGC B;  3LZ1 B;  3REK A;  4H9S C;  1P3I D;  3KWQ C;  3X1S A;  5AV9 B;  5AV8 C;  1Q9C A;  5CP6 C;  1P3O C;  2F8N B;  2CWE A;  4NE3 A;  5AVC A;  5GT3 D;  1P3P C;  2NQB D;  5JRG D;  4Z66 C;  4NE6 A;  3TU4 A;  5B32 B;  2CV5 B;  5AVB A;  3C1C D;  3B6G A;  4YS3 C;  5B0Z C;  2F8N H;  4J8U B;  3REJ C;  1P3K C;  3REK C;  1P3M A;  5GSU B;  3X1V C;  1U35 B;  3B6F A;  4H9R B;  3KWQ D;  3X1S C;  3REH A;  3VH5 T;  5AV6 B;  1M1A D;  3KUY A;  5AV8 D;  1P3O D;  2Y2H A;  5CP6 D;  2FJ7 B;  3AV1 A;  4J8X A;  5AVC C;  3C1B B;  4LD9 B;  3VH6 T;  3AZN B;  5BNX B;  5B1M B;  2Y2G A;  4QLC B;  3UTB A;  3KFU G;  4J8V A;  1P3P D;  3AZI A;  4Z66 D;  3TU4 C;  2VQR A;  5AVB C;  1EQZ A;  1P3L A;  1S32 B;  1BH8 B;  3B6G C;  4UUZ A;  4YS3 D;  5B0Z D;  3AZM A;  5CPJ B;  2F8N G;  2Y2L A;  3REJ D;  4G92 C;  4ZUX B;  1P3K D;  5B40 A;  1P3M C;  3REL C;  3X1V D;  3B6F C;  2HIO B;  3REH C;  3KUY C;  1F66 D;  3WKJ B;  3AV1 C;  1ULY A;  3AZK A;  4J8X C;  1KX4 C;  4J8W B;  5B1L B;  4WU8 A;  3UTB C;  4J8V C;  1JFI B;  3AZI C;  4H9P B;  2BYM B;  2LY8 A;  3LJA D;  1EQZ C;  3TU4 D;  5AVB D;  1ZLA A;  1P3L C;  3MGR D;  3W98 B;  4WU9 A;  2Y2J A;  1M19 B;  3AN2 B;  1ID3 B;  2PYO B;  2CV5 C;  5B40 C;  4KHA B;  4R8P B;  3REL D;  3B6F D;  3AV2 B;  4WNN B;  3EPJ A;  3AZK C;  4ZBJ C;  5B31 B;  2UWX A;  1P3A B;  1KX4 D;  4WU8 C;  3FDD A;  5B24 A;  3MGS B;  4J8V D;  5BS7 C;  3AZI D;  1P3G A;  3W99 B;  2F8N D;  1ZLA C;  1P3L D;  2YFW B;  4LD9 C;  2NZD B;  3X1T B;  4YM6 B;  4WU9 C;  3LZ0 A;  1TZY C;  4Z5T A;  3MNN A;  2YFV B;  3O62 A;  3AZJ B;  3B0D C;  3R45 A;  2CV5 D;  5B2I B;  4KUD B;  4XZQ B;  4XUJ B;  5AV5 B;  2J8P A;  3UTA B;  1AOI B;  3AZK D;  2Y2M A;  1U35 D;  5E5A B;  3MGP B;  4AWL C;  4WU8 D;  5AV6 D;  1P3G C;  5B33 B;  5CPI B;  1ZLA D;  4EO5 C;  5JA4 A;  3C1B D;  3UT9 C;  3AZN D;  5B1M D;  4LD9 D;  4X23 C;  3LZ0 C;  4Z5T C;  3MNN C;  4WU9 D;  5GT3 A;  1TZY D;  5B31 G;  3O62 C;  3MVD B;  3A1I A;  2NQB A;  5JRG A;  5CHL B;  3KXB B;  3V9R B;  1HQ3 C;  5FUG A;  3AN2 C;  4ZUX D;  1TAF A;  2Y2K A;  2Y2P A;  3AFA A;  3AZE B;  5BT1 C;  3AV2 C;  3MGQ B;  1N1J B;  3IP4 C;  1P3G D;  1M1A A;  3WKJ D;  1HTA A;  1P3O A;  5CP6 A;  4HGA B;  3WA9 A;  4CAY B;  3H0R C;  3X1U C;  3UT9 D;  5B1L D;  1M18 B;  4X23 D;  4WV4 B;  4Z5T D;  5BNV A;  5GT3 C;  3O62 D;  3LZ0 D;  1BH9 B;  5JRG C;  1H3O A;  4YS3 A;  1HQ3 D;  3AN2 D;  1ID3 D;  3REJ A;  4WZS B;  3AFA C;  1P3K A;  4KUD C;  3A1K A;  5BT1 D;  3NQU A;  4CSR A;  3AZF B;  3AV2 D;  3X1V A;  1BFM A;  1KX5 A;  1M1A C;  4H9O A;  1F66 A;  3WTP B;  5B31 D;  3WA9 C;  3X1U D;  1P3A D;  5B2J A;  2ZY5 A;  3W99 D;  3LJA A;  4H9Q A;  3MGR A;  4YM6 D;  3B0C T;  3A6N C;  2FFF B;  3AFA D;  4KUD D;  3WAA C;  3AL0 C;  3REI B;  5AV5 D;  3REL A;  1KX5 C;  4KGC A;  1AOI D;  1F66 C;  3W96 B;  3AYW C;  5BO0 B;  3WA9 D;  5AY8 B;  5GXQ B;  2ARO C;  5B2J C;  3MGP D;  4G91 C;  1KX4 A;  2RIQ A;  3AZM B;  5AV9 A;  3LJA C;  4JJN C;  2F8N A;  4M6B A;  5GT0 B;  3MGR C;  2JSS A;  1B6W A;  3MVD D;  1KX3 C;  2G5H C;  3A6N D;  2CV5 A;  3KXB D;  3KSY A;  5DNM B;  5KDM B;  3WAA D;  4J8U A;  2XD5 A;  5B32 G;  1WWS A;  4KGC C;  2ZY2 A;  3LZ1 C;  1KX5 D;  3NQJ B;  3AYW D;  5GSU A;  3F6T A;  2ARO D;  1U35 A;  5B2J D;  4H9R A;  5AV9 C;  5AV6 A;  3AZL B;  3W97 B;  5BS7 A;  4JJN D;  2FJ7 A;  3C1B A;  4LD9 A;  3AZN A;  1F1E A;  5BNX A;  5B1M A;  1M18 D;  4QLC A;  1P34 B;  1TZY A;  3AZG B;  1KX3 D;  5B32 C;  1BH8 A;  4J8U C;  5G49 B;  4ZUX A;  5F99 B;  1P3B B;  5B24 B;  3LZ1 D;  4KGC D;  5GSU C;  3AZF D;  5B0Y B;  1U35 C;  2HIO A;  5AV6 C;  1P3F B;  5AV9 D;  2FJ7 C;  3WKJ A;  2L5A A;  3C1B C;  3AZN C;  4J8W A;  5B1M C;  3UT9 A;  4QLC C;  5B1L A;  4X23 A;  1JFI A;  3VH5 W;  4H9P A;  2BYM A;  5B32 D;  1S32 C;  5DNN B;  5CPJ C;  5CPK B;  3VH6 W;  4J8U D;  2ZY3 A;  1HQ3 A;  3AN2 A;  1P3I B;  4ZUX C;  3LEL B;  1M19 A;  1ID3 A;  2PYO A;  3REI D;  4KHA A;  5GSU D;  4NFT A;  2IO5 B;  4R8P A;  2HIO C;  1KU5 A;  3EPL A;  3AV2 A;  2W8S A;  1W2E A;  3W96 D;  3WKJ C;  4WNN A;  2FJ7 D;  2NQB B;  5AY8 D;  5B31 A;  4J8W C;  2Y2O A;  3X1U A;  1P3A A;  5B1L C;  3C1C B;  4QLC D;  3W99 A;  3AZH B;  5FUG B;  5GT0 D;  2NZD A;  2YFW A;  1S32 D;  5CPJ D;  3W98 C;  4YM6 A;  1M19 C;  2YFV A;  1ID3 C;  2BYK B;  3AZJ A;  2PYO C;  3KWQ B;  2ZM5 A;  4KUD A;  2G5I C;  4XZQ A;  4R8P C;  5AV8 B;  1P3O B;  5AV5 A;  2HIO D;  2DF4 C;  1AOI A;  1P3P B;  5B31 C;  4Z66 B;  1P3A C; 
#chains in the Genus database with same CATH homology
 4J8W D;  5E5A A;  3MGS C;  3MGP A;  3AZL D;  3W99 C;  5B0Z B;  4YS3 B;  4H9N B;  5CPI A;  2NZD C;  1P3K B;  3X1T C;  4YM6 C;  3REK B;  3W98 D;  3NQU B;  3MVD A;  3AZJ C;  2BG1 A;  1M19 D;  2PYO D;  5B2I C;  3X1S B;  3A6N A;  4XZQ C;  3KXB A;  4XUJ C;  3V9R A;  3WAA A;  4R8P D;  5AV5 C;  3VH5 A;  3B0B A;  4DRB A;  3EPK A;  5AVC B;  5F99 D;  3UTA C;  1AOI C;  2RVQ C;  3AZE A;  3VH6 A;  3AYW A;  4H9Q B;  5B0Y D;  5E5A C;  5AVB B;  3TU4 B;  2ARO A;  3MGP C;  3MGS D;  3B6G B;  5B33 C;  4JJN A;  5CPI C;  4DRA A;  4G92 B;  2NZD D;  4CAY A;  2F2A C;  3X1T D;  3MVD C;  1P3M B;  1M18 A;  3REL B;  3AZJ D;  1BH9 A;  3H0L C;  1KX3 A;  3B6F B;  5B2I D;  3KXB C;  3REH B;  4XZQ D;  1Z2C B;  4XUJ D;  3KUY B;  5CPK D;  1R4V A;  4DQY B;  1H3O B;  3AV1 B;  4J8X B;  3LEL D;  3EPH A;  1KX4 B;  3UTA D;  3LZ1 A;  3UTB B;  4J8V B;  3AZE C;  2RVQ D;  3AZI B;  1EQZ B;  3AZF A;  5E5A D;  1P3L B;  3MGQ C;  5C3I B;  4UUZ B;  5B33 D;  4HGA C;  3WTP A;  5CPI D;  5B40 B;  1M18 C;  3AZH D;  5B32 A;  2XD1 A;  3AZK B;  4ZBJ B;  4E44 A;  4WU8 B;  3AZE D;  3REI A;  3H0M C;  3AZF C;  2ZY4 A;  1ZLA B;  4E45 A;  3MGQ D;  1B67 A;  3W96 A;  4WU9 B;  1TZY B;  3WTP C;  5BO0 A;  4UPK A;  3B0D B;  5AY8 A;  5GXQ A;  5GT0 A;  2JE5 A;  1S32 A;  3REK D;  5CPJ A;  3EG5 B;  3X1S D;  3P5J B;  4AWL B;  5DNM A;  5KDM A;  3REI C;  1P3G B;  3B0C W;  5AVC D;  4EO5 B;  3UT9 B;  3W96 C;  4X23 B;  4Z5T B;  3MNN B;  3NQJ A;  3O62 B;  3WTP D;  3LZ0 B;  5AY8 C;  5GXQ C;  3R45 B;  5C3I C;  3AZM C;  3B6G D;  3W97 A;  3AZL A;  1HQ3 B;  5GT0 C;  1P3M D;  3W98 A;  1P34 A;  3AZG A;  3REH D;  2HUE B;  5DNM C;  3KUY D;  3AV1 D;  4J8X D;  5G49 A;  5JA4 B;  3X1U B;  2F8N K;  1P3B A;  5F99 A;  3UTB D;  5GT3 B;  5JRG B;  1EQZ D;  5GXQ D;  5B0Y A;  3MGS A;  3AZM D;  3AZL C;  1P3F A;  3W97 C;  4Z2M H;  1TAF B;  2Y2Q A;  5B40 D;  3AFA B;  3WTP E;  3X1T A;  1P34 C;  3AZG C;  5B2I A;  5DNN A;  5DNM D;  4XUJ A;  1M1A B;  5CPK A;  5CP6 B;  3WA9 B;  1P3I A;  3LEL A;  5F99 C;  1P3B C;  5B24 C;  3UTA A;  5BNV B;  2JCH A;  5B0Y C;  1P3F C;  3W97 D;  4Z2M G;  5B33 A;  3REJ B;  3A6N B;  3C1C A;  3WAA B;  1P34 D;  4CSR B;  3AZG D;  3AZH A;  1A7W A;  3X1V B;  1PZR A;  5DNN C;  1KX5 B;  5CPK C;  4H9O B;  1F66 B;  3AYW B;  4H9S A;  4NE5 A;  1P3I C;  3LEL C;  2BYK A;  1WWI A;  2ARO B;  5B2J B;  2HUE C;  5B24 D;  4G91 B;  3KWQ A;  1P3B D;  2Y2I A;  2IO5 C;  3LJA B;  5AV8 A;  4JJN B;  3MGQ A;  1P3F D;  3MGR B;  1N1J A;  3MNN D;  1P3P A;  1KX3 B;  2NQB C;  4Z66 A;  3C1C C;  4WJ3 C;  2DQN C;  5B0Z A;  3AZH C;  4H9N A;  1T3U A;  2Y2N A;  5DNN D;  4KGC B;  3LZ1 B;  3REK A;  4H9S C;  1P3I D;  3KWQ C;  3X1S A;  5AV9 B;  5AV8 C;  1Q9C A;  5CP6 C;  1P3O C;  2F8N B;  2CWE A;  4NE3 A;  5AVC A;  5GT3 D;  1P3P C;  2NQB D;  5JRG D;  4Z66 C;  4NE6 A;  3TU4 A;  5B32 B;  2CV5 B;  5AVB A;  3C1C D;  3B6G A;  4YS3 C;  5B0Z C;  2F8N H;  4J8U B;  3REJ C;  1P3K C;  3REK C;  1P3M A;  5GSU B;  3X1V C;  1U35 B;  3B6F A;  4H9R B;  3KWQ D;  3X1S C;  3REH A;  3VH5 T;  5AV6 B;  1M1A D;  3KUY A;  5AV8 D;  1P3O D;  2Y2H A;  5CP6 D;  2FJ7 B;  3AV1 A;  4J8X A;  5AVC C;  3C1B B;  4LD9 B;  3VH6 T;  3AZN B;  5BNX B;  5B1M B;  2Y2G A;  4QLC B;  3UTB A;  3KFU G;  4J8V A;  1P3P D;  3AZI A;  4Z66 D;  3TU4 C;  2VQR A;  5AVB C;  1EQZ A;  1P3L A;  1S32 B;  1BH8 B;  3B6G C;  4UUZ A;  4YS3 D;  5B0Z D;  3AZM A;  5CPJ B;  2F8N G;  2Y2L A;  3REJ D;  4G92 C;  4ZUX B;  1P3K D;  5B40 A;  1P3M C;  3REL C;  3X1V D;  3B6F C;  2HIO B;  3REH C;  3KUY C;  1F66 D;  3WKJ B;  3AV1 C;  1ULY A;  3AZK A;  4J8X C;  1KX4 C;  4J8W B;  5B1L B;  4WU8 A;  3UTB C;  4J8V C;  1JFI B;  3AZI C;  4H9P B;  2BYM B;  2LY8 A;  3LJA D;  1EQZ C;  3TU4 D;  5AVB D;  1ZLA A;  1P3L C;  3MGR D;  3W98 B;  4WU9 A;  2Y2J A;  1M19 B;  3AN2 B;  1ID3 B;  2PYO B;  2CV5 C;  5B40 C;  4KHA B;  4R8P B;  3REL D;  3B6F D;  3AV2 B;  4WNN B;  3EPJ A;  3AZK C;  4ZBJ C;  5B31 B;  2UWX A;  1P3A B;  1KX4 D;  4WU8 C;  3FDD A;  5B24 A;  3MGS B;  4J8V D;  5BS7 C;  3AZI D;  1P3G A;  3W99 B;  2F8N D;  1ZLA C;  1P3L D;  2YFW B;  4LD9 C;  2NZD B;  3X1T B;  4YM6 B;  4WU9 C;  3LZ0 A;  1TZY C;  4Z5T A;  3MNN A;  2YFV B;  3O62 A;  3AZJ B;  3B0D C;  3R45 A;  2CV5 D;  5B2I B;  4KUD B;  4XZQ B;  4XUJ B;  5AV5 B;  2J8P A;  3UTA B;  1AOI B;  3AZK D;  2Y2M A;  1U35 D;  5E5A B;  3MGP B;  4AWL C;  4WU8 D;  5AV6 D;  1P3G C;  5B33 B;  5CPI B;  1ZLA D;  4EO5 C;  5JA4 A;  3C1B D;  3UT9 C;  3AZN D;  5B1M D;  4LD9 D;  4X23 C;  3LZ0 C;  4Z5T C;  3MNN C;  4WU9 D;  5GT3 A;  1TZY D;  5B31 G;  3O62 C;  3MVD B;  3A1I A;  2NQB A;  5JRG A;  5CHL B;  3KXB B;  3V9R B;  1HQ3 C;  5FUG A;  3AN2 C;  4ZUX D;  1TAF A;  2Y2K A;  2Y2P A;  3AFA A;  3AZE B;  5BT1 C;  3AV2 C;  3MGQ B;  1N1J B;  3IP4 C;  1P3G D;  1M1A A;  3WKJ D;  1HTA A;  1P3O A;  5CP6 A;  4HGA B;  3WA9 A;  4CAY B;  3H0R C;  3X1U C;  3UT9 D;  5B1L D;  1M18 B;  4X23 D;  4WV4 B;  4Z5T D;  5BNV A;  5GT3 C;  3O62 D;  3LZ0 D;  1BH9 B;  5JRG C;  1H3O A;  4YS3 A;  1HQ3 D;  3AN2 D;  1ID3 D;  3REJ A;  4WZS B;  3AFA C;  1P3K A;  4KUD C;  3A1K A;  5BT1 D;  3NQU A;  4CSR A;  3AZF B;  3AV2 D;  3X1V A;  1BFM A;  1KX5 A;  1M1A C;  4H9O A;  1F66 A;  3WTP B;  5B31 D;  3WA9 C;  3X1U D;  1P3A D;  5B2J A;  2ZY5 A;  3W99 D;  3LJA A;  4H9Q A;  3MGR A;  4YM6 D;  3B0C T;  3A6N C;  2FFF B;  3AFA D;  4KUD D;  3WAA C;  3AL0 C;  3REI B;  5AV5 D;  3REL A;  1KX5 C;  4KGC A;  1AOI D;  1F66 C;  3W96 B;  3AYW C;  5BO0 B;  3WA9 D;  5AY8 B;  5GXQ B;  2ARO C;  5B2J C;  3MGP D;  4G91 C;  1KX4 A;  2RIQ A;  3AZM B;  5AV9 A;  3LJA C;  4JJN C;  2F8N A;  4M6B A;  5GT0 B;  3MGR C;  2JSS A;  1B6W A;  3MVD D;  1KX3 C;  2G5H C;  3A6N D;  2CV5 A;  3KXB D;  3KSY A;  5DNM B;  5KDM B;  3WAA D;  4J8U A;  2XD5 A;  5B32 G;  1WWS A;  4KGC C;  2ZY2 A;  3LZ1 C;  1KX5 D;  3NQJ B;  3AYW D;  5GSU A;  3F6T A;  2ARO D;  1U35 A;  5B2J D;  4H9R A;  5AV9 C;  5AV6 A;  3AZL B;  3W97 B;  5BS7 A;  4JJN D;  2FJ7 A;  3C1B A;  4LD9 A;  3AZN A;  1F1E A;  5BNX A;  5B1M A;  1M18 D;  4QLC A;  1P34 B;  1TZY A;  3AZG B;  1KX3 D;  5B32 C;  1BH8 A;  4J8U C;  5G49 B;  4ZUX A;  5F99 B;  1P3B B;  5B24 B;  3LZ1 D;  4KGC D;  5GSU C;  3AZF D;  5B0Y B;  1U35 C;  2HIO A;  5AV6 C;  1P3F B;  5AV9 D;  2FJ7 C;  3WKJ A;  2L5A A;  3C1B C;  3AZN C;  4J8W A;  5B1M C;  3UT9 A;  4QLC C;  5B1L A;  4X23 A;  1JFI A;  3VH5 W;  4H9P A;  2BYM A;  5B32 D;  1S32 C;  5DNN B;  5CPJ C;  5CPK B;  3VH6 W;  4J8U D;  2ZY3 A;  1HQ3 A;  3AN2 A;  1P3I B;  4ZUX C;  3LEL B;  1M19 A;  1ID3 A;  2PYO A;  3REI D;  4KHA A;  5GSU D;  4NFT A;  2IO5 B;  4R8P A;  2HIO C;  1KU5 A;  3EPL A;  3AV2 A;  2W8S A;  1W2E A;  3W96 D;  3WKJ C;  4WNN A;  2FJ7 D;  2NQB B;  5AY8 D;  5B31 A;  4J8W C;  2Y2O A;  3X1U A;  1P3A A;  5B1L C;  3C1C B;  4QLC D;  3W99 A;  3AZH B;  5FUG B;  5GT0 D;  2NZD A;  2YFW A;  1S32 D;  5CPJ D;  3W98 C;  4YM6 A;  1M19 C;  2YFV A;  1ID3 C;  2BYK B;  3AZJ A;  2PYO C;  3KWQ B;  2ZM5 A;  4KUD A;  2G5I C;  4XZQ A;  4R8P C;  5AV8 B;  1P3O B;  5AV5 A;  2HIO D;  2DF4 C;  1AOI A;  1P3P B;  5B31 C;  4Z66 B;  1P3A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...