5E5AC

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aC00
3REIA 5BT1D 4YM6D 4WU9C 3REKA 3WKJD 5AVBB 4QLCA 3X1SB 5GT0C 3VH5A 1P3GC 1ZLAC 3LZ1C 4AWLC 5B0ZC 4WU9D 3AN2A 5CPKB 3AV1B 4HGAB 1ID3A 4WU8B 5GT0D 4H9OA 1AOIC 3UT9C 1P3GD 3LZ1D 3AFAB 3A6NA 3AZFC 5B0ZD 4J8WA 4LD9B 4H9RB 1KX4A 3O62C 4XUJC 1AOID 3W98A 3UT9D 5E5AA 3AZFD 3B6FB 1EQZC 5AY8A 5AVCB 3W99B 5KDMA 3O62D 3AZEC 1P3AC 1KX5A 4XUJD 4JJNC 3V9RB 1HTAA 4EO5C 5CPJB 5BS7C 4Z5TA 1EQZD 5B40C 3C1CB 3AYWB 3AZED 1P3AD 5B1MA 1S32A 4JJND 1P3FB 4R8PB 2HUEB 4XZQA 3WTPD 5BNVB 5B40D 4E45A 3MGQC 1ULYA 3MVDA 4J8XB 2YFWA 5B0YC 3AZKC 3KWQB 3MGQD 1BH8B 3AZLA 1P3BA 4ZBJB 1P34B 4KGCA 2NQBC 3WA9C 5B0YD 5DNNB 3AZKD 5CP6C 4YM6A 3RELB 3WKJA 2YFVA 3B0DB 5GXQC 1KX3C 3MNNC 5GSUC 1P3PB 1F66C 2PYOC 1TZYC 2NQBD 3WA9D 5B2IC 3REHC 4WU9A 1KX3D 2BYKB 5GXQD 5GSUD 1F66D 2PYOD 1P3GA 1ZLAA 3LZ1A 4CAYA 1TZYD 5CPIB 5B0ZA 4Z66C 5B2ID 3REHD 3AZGC 2CWEA 1AOIA 3UT9A 2F8NK 3AZFA 1M18C 4Z66D 3AZJB 3O62A 3AZHC 3X1UC 3AZGD 4H9NB 3W96B 4G91C 4XUJA 4ZUXC 5AV5C 1U35B 4KUDB 4G92C 5FUGA 1JFIA 1M18D 1EQZA 1M1AD 2AROC 3AZEA 3X1UD 3AZHD 2CV5C 1P3AA 4JJNA 3REKB 5BS7A 4QLCB 5B40A 2AROD 1N1JA 2CV5D 1KU5A 3AN2B 4H9OB 3A6NB 3MGQA 1B67A 2FJ7C 3W97C 1KX4B 3WAAB 5B0YA 3AZKA 3W98B 2F8NH 2FJ7D 5B2JD 5AY8B 4KHAA 3W97D 2NQBA 3WA9A 1HQ3B 5AV8D 3TU4C 3AZNC 5CP6A 1KX3A 5GXQA 1P3OC 4Z5TB 2F8ND 3MNNA 5GSUA 1F66A 2PYOA 1TZYA 3X1VC 3TU4D 3X1TC 3AZND 5B1MB 3MGRC 4X23C 5B2IA 4H9SC 3REHA 1P3OD 4Z2MG 4XZQB 1P3LC 5BT1C 1WWSA 3X1TD 3X1VD 3LZ0C 1P3KC 3MGRD 4Z66A 4X23D 3MVDB 1P3LD 2YFWB 3VH6W 5AV9C 3AZGA 3R45B 3LELC 3LZ0D 1P3KD 1M18A 1P3MC 1R4VA 3AZHA 3X1UA 5AV9D 4NFTA 5AV5A 4ZUXA 4YM6B 3KSYA 3WKJB 5AVBC 2YFVB 2LY8A 4WNNA 3LELD 1P3MD 2AROA 2CV5A 4WU9B 5AVBD 3LJAC 5CPKC 4WU8C 2IO5C 1ZLAB 3LZ1B 4CAYB 3AFAC 4DRAA 5B0ZB 3LJAD 5B31C 1P3IC 5CPKD 4WU8D 3UT9B 3AFAD 2HIOC 3AZFB 3W99C 2FJ7A 3WTPC 5BO0B 5B31D 3W97A 3UTBB 1P3ID 3O62B 3VH5T 2F8NA 4WZSB 2HIOD 5FUGB 1JFIB 3W99D 1EQZB 1Q9CA 3C1CC 3AZEB 4J8UC 3TU4A 3AZNA 1P3AB 1P3FC 4JJNB 4R8PC 1P3OA 3VH6A 3C1CD 3X1TA 4J8UD 1N1JB 2NZDC 1P3FD 3MGRA 4R8PD 4X23A 4H9SA 2RVQC 4J8VC 1P3LA 1M19C 3UTAC 1WWIA 4H9PA 3KWQC 5CHLB 3LZ0A 3MGQB 1P3KA 2NZDD 1P34C 2RVQD 4J8VD 5AV9A 3B0CW 5B0YB 1M19D 3UTAD 3AZMC 3KXBB 3LELA 3KWQD 1P3PC 1P3MA 5GT0A 5B32C 1P34D 4KHAB 1TAFA 3WA9B 2NQBB 3KUYC 5CP6B 3AZMD 5AVBA 5BNXB 3MNNB 5GSUB 1P3PD 3NQJA 1F66B 5B32D 5B24C 3MGPC 5G49A 1TZYB 3KUYD 5AV6C 3REHB 3LJAA 1M1AC 3AZIC 5CPKA 3NQUB 4WU8A 3B6GB 5B24D 3MGSC 3AFAA 3MGPD 5CPID 5DNMC 4Z66B 5AV6D 1P3IA 5B31A 3AZID 3AZGB 3REIB 3MGSD 2HIOA 1M18B 5DNMD 3WTPA 2F8NG 3W99A 3AZHB 3X1UB 3C1BC 4G91B 3V9RA 4ZUXB 5AV5B 3AV2C 1ID3B 4YS3C 3C1CA 5B1LC 2AROB 4J8UA 3C1BD 2CV5B 1P3FA 3WTPE 4R8PA 3AV2D 5B2JC 5JRGC 4J8WB 5AV8C 4YS3D 5BNVA 5B1LD 5E5AB 5F99C 2NZDA 1F1EA 4NE6A 4UUZA 5JRGD 3WAAC 5GT3C 3REJC 5KDMB 5B33C 4J8VA 1KX4C 1KX5B 1M19A 3UTAA 5JA4A 3KWQA 3A6ND 5F99D 2FJ7B 1P34A 5GT3D 5B33D 3REJD 1HQ3C 1KX4D 3W97B 3WAAD 1S32B 3AZMA 1P3PA 1BH9A 5B32A 1HQ3D 3KUYA 4H9QA 3AZNB 1A7WA 4Z5TD 5C3IC 5B24A 3MGPA 3MGRB 5AV6A 4X23B 3AZLB 1P3BB 3AZIA 1B6WA 1M1AA 1P3LB 4KGCB 5B31G 2BYMA 3MGSA 4H9PB 3X1SC 1P3KB 5DNMA 3LELB 3X1SD 3AV1C 4HGAC 1P3MB 5GT0B 1P3GB 1TAFB 3C1BA 4AWLB 3AV2A 4LD9C 3AV1D 3NQJB 4YS3A 1AOIB 5G49B 2L5AA 5B1LA 4E44A 4Z2MH 3B6FC 4NE3A 5AVCC 5B2JA 5JRGA 1H3OA 3LJAB 4LD9D 5AV8A 4XUJB 5CPJC 2IO5B 1ZLAD 5F99A 3B6FD 5AVCD 5GT3A 5B31B 5B33A 3REJA 3UTBC 3AYWC 1P3IB 3WAAA 5CPJD 4EO5B 2HUEC 2HIOB 3WTPB 3UTBD 1HQ3A 5B40B 3AYWD 3X1VA 5B32G 4CSRA 4J8XC 4J8UB 2JSSA 4ZBJC 4J8XD 5DNNC 3AZKB 3RELC 3B0DC 2NZDB 4M6BA 4UUZB 4J8VB 3R45A 5DNND 1M19B 3KXBC 3RELD 3UTAB 5JA4B 1KX3B 5GXQB 3X1SA 2PYOB 3VH6T 5CPIC 3KXBD 5B2IB 3AZMB 3AV1A 1BFMA 1BH9B 5B32B 3KUYB 4H9QB 5CP6D 3AZJC 4LD9A 4H9RA 3MNND 3W96C 3B6GC 4KUDC 1U35C 5B24B 3MGPB 3B6FA 5AVCA 5AV6B 3AZJD 1M1AB 3AZIB 3W96D 3B6GD 3REIC 4KUDD 5CPJA 1U35D 2BYMB 3REKC 3MGSB 4QLCC 4WNNB 4DRBA 4G92B 5DNMB 5BO0A 3UTBA 3AYWA 3REID 3REKD 3AN2C 4QLCD 1ID3C 3A6NC 3C1BB 5AV5D 4ZUXD 3AV2B 4J8WC 4J8XA 3AN2D 1ID3D 3W98C 3VH5W 4YS3B 5B1LB 5E5AC 4WV4B 1BH8A 5AY8C 5B2JB 1H3OB 5JRGB 4J8WD 1KX5C 5AV8B 5DNNA 3B0BA 3W98D 3RELA 4Z5TC 5E5AD 2F8NB 5F99B 5AY8D 5GT3B 5B33B 3REJB 1KX5D 3TU4B 5B1MC 1S32C 3KXBA 2BYKA 1P3OB 4XZQC 3B0CT 3X1TB 3X1VB 5CPIA 5B1MD 1S32D 3MVDC 4CSRB 5BNXA 4XZQD 3LZ0B 3MVDD 3AZJA 3AZLC 1P3BC 4KGCC 3NQUA 4H9NA 3W96A 5C3IB 5AV9B 3B6GA 4KUDA 4YM6C 1U35A 3WKJC 4NE5A 3AZLD 1P3BD 4KGCD
chains in the Genus database with same CATH superfamily
1W2EA 3REIA 5BT1D 4YM6D 4WU9C 3REKA 3WKJD 5AVBB 4QLCA 3X1SB 5GT0C 3VH5A 1P3GC 1ZLAC 3LZ1C 4AWLC 5B0ZC 4WU9D 3AN2A 5CPKB 3AV1B 4HGAB 1ID3A 3EPHA 4WU8B 5GT0D 4H9OA 1AOIC 3UT9C 1P3GD 3LZ1D 3AFAB 3A6NA 3AZFC 2Y2MA 5B0ZD 4J8WA 4LD9B 4H9RB 1KX4A 3O62C 4XUJC 1AOID 3W98A 3UT9D 5E5AA 3AZFD 3B6FB 1EQZC 5AY8A 5AVCB 3W99B 5KDMA 3O62D 3AZEC 1P3AC 1KX5A 4XUJD 4JJNC 3V9RB 1HTAA 4EO5C 5CPJB 5BS7C 4Z5TA 1EQZD 5B40C 3C1CB 3AYWB 3AZED 1P3AD 5B1MA 1S32A 4JJND 1P3FB 4R8PB 2HUEB 4XZQA 2Y2KA 3WTPD 5BNVB 2ZY4A 5B40D 4E45A 3MGQC 1ULYA 3MVDA 4J8XB 2YFWA 3AL0C 5B0YC 3AZKC 2W8SA 3KWQB 3MGQD 1BH8B 3AZLA 1P3BA 4ZBJB 1P34B 4KGCA 2NQBC 3WA9C 5B0YD 5DNNB 3AZKD 5CP6C 4YM6A 2XD1A 2Y2LA 3RELB 2YFVA 3B0DB 5GXQC 1KX3C 3WKJA 3MNNC 5GSUC 1P3PB 1F66C 2PYOC 1TZYC 2NQBD 3WA9D 5B2IC 3REHC 4WU9A 1KX3D 2BYKB 5GXQD 5GSUD 2Y2HA 2Y2JA 1F66D 2PYOD 1P3GA 1ZLAA 3LZ1A 4CAYA 1TZYD 5CPIB 5B0ZA 4Z66C 5B2ID 3REHD 1Z2CB 3AZGC 2CWEA 1AOIA 3UT9A 2F8NK 2G5IC 3AZFA 1M18C 4Z66D 3AZJB 3P5JB 3O62A 3AZHC 3X1UC 3AZGD 4H9NB 3W96B 4G91C 4XUJA 4ZUXC 5AV5C 1U35B 4KUDB 4G92C 5FUGA 1JFIA 1M18D 1EQZA 1M1AD 2AROC 3AZEA 3X1UD 3AZHD 2CV5C 1P3AA 4JJNA 3REKB 5BS7A 4QLCB 5B40A 2AROD 1N1JA 2CV5D 1KU5A 3AN2B 4H9OB 3A6NB 3MGQA 1B67A 2FJ7C 3W97C 1KX4B 3WAAB 5B0YA 3AZKA 3W98B 2F8NH 2FJ7D 5B2JD 5AY8B 4KHAA 3W97D 2NQBA 3WA9A 1HQ3B 5AV8D 3TU4C 3AZNC 5CP6A 2RIQA 1KX3A 5GXQA 1P3OC 4Z5TB 2F8ND 3MNNA 5GSUA 1F66A 2PYOA 1TZYA 3X1VC 3TU4D 3X1TC 3AZND 5B1MB 2Y2QA 4X23C 5B2IA 4H9SC 3MGRC 3REHA 1P3OD 4Z2MG 4XZQB 1P3LC 5BT1C 1WWSA 3A1IA 3X1TD 3X1VD 3LZ0C 1P3KC 3MGRD 4Z66A 4X23D 3MVDB 1P3LD 2YFWB 3VH6W 5AV9C 3AZGA 3R45B 3LELC 3LZ0D 1P3KD 1M18A 1P3MC 1R4VA 3AZHA 3X1UA 5AV9D 4NFTA 5AV5A 4ZUXA 2Y2GA 4YM6B 3KSYA 3WKJB 5AVBC 2YFVB 2LY8A 4WNNA 3LELD 1P3MD 2AROA 2CV5A 4WU9B 5AVBD 3LJAC 5CPKC 4WU8C 2IO5C 1ZLAB 3LZ1B 4CAYB 3AFAC 4DRAA 5B0ZB 3LJAD 5B31C 1P3IC 5CPKD 4WU8D 3UT9B 3AFAD 2HIOC 3EG5B 3AZFB 3W99C 2FJ7A 3WTPC 5BO0B 5B31D 3W97A 3UTBB 1P3ID 3O62B 3VH5T 3EPKA 2F8NA 4WZSB 2HIOD 5FUGB 1JFIB 3W99D 1EQZB 1Q9CA 3C1CC 2ZY2A 3AZEB 4J8UC 3TU4A 3AZNA 1P3AB 1P3FC 4JJNB 4R8PC 1P3OA 3VH6A 2ZY3A 3C1CD 3X1TA 4J8UD 1N1JB 2NZDC 1P3FD 3MGRA 4R8PD 4X23A 4H9SA 2RVQC 4J8VC 1P3LA 1M19C 3UTAC 1WWIA 4H9PA 3KWQC 5CHLB 3LZ0A 3MGQB 1P3KA 2NZDD 2Y2NA 1P34C 2RVQD 4J8VD 5AV9A 3B0CW 5B0YB 1M19D 3UTAD 3AZMC 3KXBB 3LELA 3KWQD 1P3PC 1P3MA 5GT0A 5B32C 2DF4C 1P34D 2JCHA 4KHAB 1TAFA 3WA9B 2NQBB 3KUYC 5CP6B 3AZMD 5AVBA 5BNXB 3MNNB 5GSUB 1P3PD 3NQJA 1F66B 5B32D 5B24C 3MGPC 5G49A 1TZYB 3KUYD 5AV6C 3REHB 3LJAA 1M1AC 3AZIC 5CPKA 3NQUB 4WU8A 3B6GB 5B24D 3MGSC 3AFAA 3MGPD 5CPID 5DNMC 4Z66B 5AV6D 1P3IA 5B31A 3AZID 3AZGB 3REIB 3MGSD 2HIOA 2XD5A 2VQRA 5DNMD 3WTPA 1M18B 4UPKA 2F8NG 3W99A 3AZHB 3X1UB 3C1BC 4G91B 3V9RA 4ZUXB 5AV5B 3AV2C 1ID3B 4YS3C 3C1CA 5B1LC 2AROB 4J8UA 3C1BD 2CV5B 1P3FA 2F2AC 3WTPE 4R8PA 5B2JC 5JRGC 4J8WB 3AV2D 5AV8C 3KFUG 4YS3D 5BNVA 5B1LD 5E5AB 5F99C 2NZDA 1F1EA 4NE6A 4UUZA 5JRGD 3WAAC 5GT3C 3REJC 5KDMB 5B33C 4J8VA 1KX4C 2FFFB 1KX5B 1M19A 3UTAA 5JA4A 3KWQA 3A6ND 5F99D 2FJ7B 1P34A 5GT3D 1PZRA 5B33D 1HQ3C 3REJD 1KX4D 3W97B 3WAAD 1S32B 3AZMA 1P3PA 1BH9A 5B32A 2BG1A 1HQ3D 2DQNC 3A1KA 3FDDA 4H9QA 3KUYA 3AZNB 1A7WA 4Z5TD 5C3IC 5B24A 3MGPA 3H0RC 3MGRB 5AV6A 4X23B 2Y2PA 3AZLB 3AZIA 1B6WA 1P3BB 1P3LB 1M1AA 4KGCB 5B31G 2BYMA 3MGSA 4H9PB 3X1SC 1P3KB 2ZY5A 5DNMA 2UWXA 2ZM5A 3LELB 3X1SD 3AV1C 4HGAC 1P3MB 5GT0B 1P3GB 2Y2IA 1TAFB 3C1BA 4AWLB 3AV2A 4LD9C 3AV1D 3NQJB 4YS3A 1AOIB 5G49B 2L5AA 5B1LA 4E44A 4Z2MH 3B6FC 4NE3A 5AVCC 5B2JA 1H3OA 5JRGA 3LJAB 4LD9D 5AV8A 3EPJA 4XUJB 5CPJC 2IO5B 1ZLAD 5F99A 3B6FD 5AVCD 5GT3A 5B31B 5B33A 3REJA 3UTBC 3AYWC 1P3IB 3WAAA 5CPJD 4EO5B 2HUEC 2HIOB 3H0LC 2G5HC 3WTPB 3UTBD 1HQ3A 5B40B 3AYWD 3X1VA 5B32G 4CSRA 4J8XC 4J8UB 2JSSA 4ZBJC 4J8XD 2J8PA 5DNNC 3AZKB 3RELC 3B0DC 3IP4C 2NZDB 4M6BA 4UUZB 4J8VB 3R45A 5DNND 1M19B 3KXBC 3RELD 3UTAB 5JA4B 1KX3B 5GXQB 3X1SA 2PYOB 3VH6T 5CPIC 3KXBD 5B2IB 3AZMB 3AV1A 1BFMA 1BH9B 5B32B 1T3UA 3KUYB 4H9QB 5CP6D 3AZJC 2Y2OA 4LD9A 4H9RA 3MNND 3W96C 3B6GC 4KUDC 1U35C 5B24B 3MGPB 3B6FA 5AVCA 5AV6B 3AZJD 1M1AB 3AZIB 3W96D 3B6GD 3REIC 4KUDD 5CPJA 1U35D 2BYMB 3REKC 3MGSB 4QLCC 4WNNB 4DRBA 4G92B 5DNMB 5BO0A 3UTBA 3AYWA 3REID 3H0MC 3REKD 3AN2C 4QLCD 1ID3C 3A6NC 3C1BB 5AV5D 4ZUXD 3AV2B 4J8WC 4J8XA 3AN2D 2JE5A 1ID3D 3W98C 3VH5W 4YS3B 5B1LB 5E5AC 4WV4B 1BH8A 3F6TA 5AY8C 5B2JB 1H3OB 5JRGB 4J8WD 1KX5C 5AV8B 5DNNA 3B0BA 3W98D 3RELA 4Z5TC 5E5AD 2F8NB 5F99B 5AY8D 4WJ3C 5GT3B 5B33B 3REJB 1KX5D 3TU4B 5B1MC 1S32C 3KXBA 2BYKA 1P3OB 4XZQC 3B0CT 3X1TB 3X1VB 5CPIA 5B1MD 1S32D 3MVDC 4CSRB 3EPLA 5BNXA 4XZQD 3LZ0B 3MVDD 3AZJA 3AZLC 1P3BC 4KGCC 3NQUA 4H9NA 3W96A 5C3IB 5AV9B 3B6GA 4KUDA 4YM6C 1U35A 3WKJC 4NE5A 4DQYB 3AZLD 1P3BD 4KGCD
chains in the Genus database with same CATH topology
1W2EA 3REIA 5BT1D 4YM6D 4WU9C 3REKA 3WKJD 5AVBB 4QLCA 3X1SB 5GT0C 3VH5A 1P3GC 1ZLAC 3LZ1C 4AWLC 5B0ZC 4WU9D 3AN2A 5CPKB 3AV1B 4HGAB 1ID3A 3EPHA 4WU8B 5GT0D 4H9OA 1AOIC 3UT9C 1P3GD 3LZ1D 3AFAB 3A6NA 3AZFC 2Y2MA 5B0ZD 4J8WA 4LD9B 4H9RB 1KX4A 3O62C 4XUJC 1AOID 3W98A 3UT9D 5E5AA 3AZFD 3B6FB 1EQZC 5AY8A 5AVCB 3W99B 5KDMA 3O62D 3AZEC 1P3AC 1KX5A 4XUJD 4JJNC 3V9RB 1HTAA 4EO5C 5CPJB 5BS7C 4Z5TA 1EQZD 5B40C 3C1CB 3AYWB 3AZED 1P3AD 5B1MA 1S32A 4JJND 1P3FB 4R8PB 2HUEB 4XZQA 2Y2KA 3WTPD 5BNVB 2ZY4A 5B40D 4E45A 3MGQC 1ULYA 3MVDA 4J8XB 2YFWA 3AL0C 5B0YC 3AZKC 2W8SA 3KWQB 3MGQD 1BH8B 3AZLA 1P3BA 4ZBJB 1P34B 4KGCA 2NQBC 3WA9C 5B0YD 5DNNB 3AZKD 5CP6C 4YM6A 2XD1A 2Y2LA 3RELB 2YFVA 3B0DB 5GXQC 1KX3C 3WKJA 3MNNC 5GSUC 1P3PB 1F66C 2PYOC 1TZYC 2NQBD 3WA9D 5B2IC 3REHC 4WU9A 1KX3D 2BYKB 5GXQD 5GSUD 2Y2HA 2Y2JA 1F66D 2PYOD 1P3GA 1ZLAA 3LZ1A 4CAYA 1TZYD 5CPIB 5B0ZA 4Z66C 5B2ID 3REHD 1Z2CB 3AZGC 2CWEA 1AOIA 3UT9A 2F8NK 2G5IC 3AZFA 1M18C 4Z66D 3AZJB 3P5JB 3O62A 3AZHC 3X1UC 3AZGD 4H9NB 3W96B 4G91C 4XUJA 4ZUXC 5AV5C 1U35B 4KUDB 4G92C 5FUGA 1JFIA 1M18D 1EQZA 1M1AD 2AROC 3AZEA 3X1UD 3AZHD 2CV5C 1P3AA 4JJNA 3REKB 5BS7A 4QLCB 5B40A 2AROD 1N1JA 2CV5D 1KU5A 3AN2B 4H9OB 3A6NB 3MGQA 1B67A 2FJ7C 3W97C 1KX4B 3WAAB 5B0YA 3AZKA 3W98B 2F8NH 2FJ7D 5B2JD 5AY8B 4KHAA 3W97D 2NQBA 3WA9A 1HQ3B 5AV8D 3TU4C 3AZNC 5CP6A 2RIQA 1KX3A 5GXQA 1P3OC 4Z5TB 2F8ND 3MNNA 5GSUA 1F66A 2PYOA 1TZYA 3X1VC 3TU4D 3X1TC 3AZND 5B1MB 2Y2QA 4X23C 5B2IA 4H9SC 3MGRC 3REHA 1P3OD 4Z2MG 4XZQB 1P3LC 5BT1C 1WWSA 3A1IA 3X1TD 3X1VD 3LZ0C 1P3KC 3MGRD 4Z66A 4X23D 3MVDB 1P3LD 2YFWB 3VH6W 5AV9C 3AZGA 3R45B 3LELC 3LZ0D 1P3KD 1M18A 1P3MC 1R4VA 3AZHA 3X1UA 5AV9D 4NFTA 5AV5A 4ZUXA 2Y2GA 4YM6B 3KSYA 3WKJB 5AVBC 2YFVB 2LY8A 4WNNA 3LELD 1P3MD 2AROA 2CV5A 4WU9B 5AVBD 3LJAC 5CPKC 4WU8C 2IO5C 1ZLAB 3LZ1B 4CAYB 3AFAC 4DRAA 5B0ZB 3LJAD 5B31C 1P3IC 5CPKD 4WU8D 3UT9B 3AFAD 2HIOC 3EG5B 3AZFB 3W99C 2FJ7A 3WTPC 5BO0B 5B31D 3W97A 3UTBB 1P3ID 3O62B 3VH5T 3EPKA 2F8NA 4WZSB 2HIOD 5FUGB 1JFIB 3W99D 1EQZB 1Q9CA 3C1CC 2ZY2A 3AZEB 4J8UC 3TU4A 3AZNA 1P3AB 1P3FC 4JJNB 4R8PC 1P3OA 3VH6A 2ZY3A 3C1CD 3X1TA 4J8UD 1N1JB 2NZDC 1P3FD 3MGRA 4R8PD 4X23A 4H9SA 2RVQC 4J8VC 1P3LA 1M19C 3UTAC 1WWIA 4H9PA 3KWQC 5CHLB 3LZ0A 3MGQB 1P3KA 2NZDD 2Y2NA 1P34C 2RVQD 4J8VD 5AV9A 3B0CW 5B0YB 1M19D 3UTAD 3AZMC 3KXBB 3LELA 3KWQD 1P3PC 1P3MA 5GT0A 5B32C 2DF4C 1P34D 2JCHA 4KHAB 1TAFA 3WA9B 2NQBB 3KUYC 5CP6B 3AZMD 5AVBA 5BNXB 3MNNB 5GSUB 1P3PD 3NQJA 1F66B 5B32D 5B24C 3MGPC 5G49A 1TZYB 3KUYD 5AV6C 3REHB 3LJAA 1M1AC 3AZIC 5CPKA 3NQUB 4WU8A 3B6GB 5B24D 3MGSC 3AFAA 3MGPD 5CPID 5DNMC 4Z66B 5AV6D 1P3IA 5B31A 3AZID 3AZGB 3REIB 3MGSD 2HIOA 2XD5A 2VQRA 5DNMD 3WTPA 1M18B 4UPKA 2F8NG 3W99A 3AZHB 3X1UB 3C1BC 4G91B 3V9RA 4ZUXB 5AV5B 3AV2C 1ID3B 4YS3C 3C1CA 5B1LC 2AROB 4J8UA 3C1BD 2CV5B 1P3FA 2F2AC 3WTPE 4R8PA 5B2JC 5JRGC 4J8WB 3AV2D 5AV8C 3KFUG 4YS3D 5BNVA 5B1LD 5E5AB 5F99C 2NZDA 1F1EA 4NE6A 4UUZA 5JRGD 3WAAC 5GT3C 3REJC 5KDMB 5B33C 4J8VA 1KX4C 2FFFB 1KX5B 1M19A 3UTAA 5JA4A 3KWQA 3A6ND 5F99D 2FJ7B 1P34A 5GT3D 1PZRA 5B33D 1HQ3C 3REJD 1KX4D 3W97B 3WAAD 1S32B 3AZMA 1P3PA 1BH9A 5B32A 2BG1A 1HQ3D 2DQNC 3A1KA 3FDDA 4H9QA 3KUYA 3AZNB 1A7WA 4Z5TD 5C3IC 5B24A 3MGPA 3H0RC 3MGRB 5AV6A 4X23B 2Y2PA 3AZLB 3AZIA 1B6WA 1P3BB 1P3LB 1M1AA 4KGCB 5B31G 2BYMA 3MGSA 4H9PB 3X1SC 1P3KB 2ZY5A 5DNMA 2UWXA 2ZM5A 3LELB 3X1SD 3AV1C 4HGAC 1P3MB 5GT0B 1P3GB 2Y2IA 1TAFB 3C1BA 4AWLB 3AV2A 4LD9C 3AV1D 3NQJB 4YS3A 1AOIB 5G49B 2L5AA 5B1LA 4E44A 4Z2MH 3B6FC 4NE3A 5AVCC 5B2JA 1H3OA 5JRGA 3LJAB 4LD9D 5AV8A 3EPJA 4XUJB 5CPJC 2IO5B 1ZLAD 5F99A 3B6FD 5AVCD 5GT3A 5B31B 5B33A 3REJA 3UTBC 3AYWC 1P3IB 3WAAA 5CPJD 4EO5B 2HUEC 2HIOB 3H0LC 2G5HC 3WTPB 3UTBD 1HQ3A 5B40B 3AYWD 3X1VA 5B32G 4CSRA 4J8XC 4J8UB 2JSSA 4ZBJC 4J8XD 2J8PA 5DNNC 3AZKB 3RELC 3B0DC 3IP4C 2NZDB 4M6BA 4UUZB 4J8VB 3R45A 5DNND 1M19B 3KXBC 3RELD 3UTAB 5JA4B 1KX3B 5GXQB 3X1SA 2PYOB 3VH6T 5CPIC 3KXBD 5B2IB 3AZMB 3AV1A 1BFMA 1BH9B 5B32B 1T3UA 3KUYB 4H9QB 5CP6D 3AZJC 2Y2OA 4LD9A 4H9RA 3MNND 3W96C 3B6GC 4KUDC 1U35C 5B24B 3MGPB 3B6FA 5AVCA 5AV6B 3AZJD 1M1AB 3AZIB 3W96D 3B6GD 3REIC 4KUDD 5CPJA 1U35D 2BYMB 3REKC 3MGSB 4QLCC 4WNNB 4DRBA 4G92B 5DNMB 5BO0A 3UTBA 3AYWA 3REID 3H0MC 3REKD 3AN2C 4QLCD 1ID3C 3A6NC 3C1BB 5AV5D 4ZUXD 3AV2B 4J8WC 4J8XA 3AN2D 2JE5A 1ID3D 3W98C 3VH5W 4YS3B 5B1LB 5E5AC 4WV4B 1BH8A 3F6TA 5AY8C 5B2JB 1H3OB 5JRGB 4J8WD 1KX5C 5AV8B 5DNNA 3B0BA 3W98D 3RELA 4Z5TC 5E5AD 2F8NB 5F99B 5AY8D 4WJ3C 5GT3B 5B33B 3REJB 1KX5D 3TU4B 5B1MC 1S32C 3KXBA 2BYKA 1P3OB 4XZQC 3B0CT 3X1TB 3X1VB 5CPIA 5B1MD 1S32D 3MVDC 4CSRB 3EPLA 5BNXA 4XZQD 3LZ0B 3MVDD 3AZJA 3AZLC 1P3BC 4KGCC 3NQUA 4H9NA 3W96A 5C3IB 5AV9B 3B6GA 4KUDA 4YM6C 1U35A 3WKJC 4NE5A 4DQYB 3AZLD 1P3BD 4KGCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI A;  5BT1 D;  4YM6 D;  4WU9 C;  3REK A;  3WKJ D;  5AVB B;  4QLC A;  3X1S B;  5GT0 C;  3VH5 A;  1P3G C;  1ZLA C;  3LZ1 C;  4AWL C;  5B0Z C;  4WU9 D;  3AN2 A;  5CPK B;  3AV1 B;  4HGA B;  1ID3 A;  4WU8 B;  5GT0 D;  4H9O A;  1AOI C;  3UT9 C;  1P3G D;  3LZ1 D;  3AFA B;  3A6N A;  3AZF C;  5B0Z D;  4J8W A;  4LD9 B;  4H9R B;  1KX4 A;  3O62 C;  4XUJ C;  1AOI D;  3W98 A;  3UT9 D;  5E5A A;  3AZF D;  3B6F B;  1EQZ C;  5AY8 A;  5AVC B;  3W99 B;  5KDM A;  3O62 D;  3AZE C;  1P3A C;  1KX5 A;  4XUJ D;  4JJN C;  3V9R B;  1HTA A;  4EO5 C;  5CPJ B;  5BS7 C;  4Z5T A;  1EQZ D;  5B40 C;  3C1C B;  3AYW B;  3AZE D;  1P3A D;  5B1M A;  1S32 A;  4JJN D;  1P3F B;  4R8P B;  2HUE B;  4XZQ A;  3WTP D;  5BNV B;  5B40 D;  4E45 A;  3MGQ C;  1ULY A;  3MVD A;  4J8X B;  2YFW A;  5B0Y C;  3AZK C;  3KWQ B;  3MGQ D;  1BH8 B;  3AZL A;  1P3B A;  4ZBJ B;  1P34 B;  4KGC A;  2NQB C;  3WA9 C;  5B0Y D;  5DNN B;  3AZK D;  5CP6 C;  4YM6 A;  3REL B;  3WKJ A;  2YFV A;  3B0D B;  5GXQ C;  1KX3 C;  3MNN C;  5GSU C;  1P3P B;  1F66 C;  2PYO C;  1TZY C;  2NQB D;  3WA9 D;  5B2I C;  3REH C;  4WU9 A;  1KX3 D;  2BYK B;  5GXQ D;  5GSU D;  1F66 D;  2PYO D;  1P3G A;  1ZLA A;  3LZ1 A;  4CAY A;  1TZY D;  5CPI B;  5B0Z A;  4Z66 C;  5B2I D;  3REH D;  3AZG C;  2CWE A;  1AOI A;  3UT9 A;  2F8N K;  3AZF A;  1M18 C;  4Z66 D;  3AZJ B;  3O62 A;  3AZH C;  3X1U C;  3AZG D;  4H9N B;  3W96 B;  4G91 C;  4XUJ A;  4ZUX C;  5AV5 C;  1U35 B;  4KUD B;  4G92 C;  5FUG A;  1JFI A;  1M18 D;  1EQZ A;  1M1A D;  2ARO C;  3AZE A;  3X1U D;  3AZH D;  2CV5 C;  1P3A A;  4JJN A;  3REK B;  5BS7 A;  4QLC B;  5B40 A;  2ARO D;  1N1J A;  2CV5 D;  1KU5 A;  3AN2 B;  4H9O B;  3A6N B;  3MGQ A;  1B67 A;  2FJ7 C;  3W97 C;  1KX4 B;  3WAA B;  5B0Y A;  3AZK A;  3W98 B;  2F8N H;  2FJ7 D;  5B2J D;  5AY8 B;  4KHA A;  3W97 D;  2NQB A;  3WA9 A;  1HQ3 B;  5AV8 D;  3TU4 C;  3AZN C;  5CP6 A;  1KX3 A;  5GXQ A;  1P3O C;  4Z5T B;  2F8N D;  3MNN A;  5GSU A;  1F66 A;  2PYO A;  1TZY A;  3X1V C;  3TU4 D;  3X1T C;  3AZN D;  5B1M B;  3MGR C;  4X23 C;  5B2I A;  4H9S C;  3REH A;  1P3O D;  4Z2M G;  4XZQ B;  1P3L C;  5BT1 C;  1WWS A;  3X1T D;  3X1V D;  3LZ0 C;  1P3K C;  3MGR D;  4Z66 A;  4X23 D;  3MVD B;  1P3L D;  2YFW B;  3VH6 W;  5AV9 C;  3AZG A;  3R45 B;  3LEL C;  3LZ0 D;  1P3K D;  1M18 A;  1P3M C;  1R4V A;  3AZH A;  3X1U A;  5AV9 D;  4NFT A;  5AV5 A;  4ZUX A;  4YM6 B;  3KSY A;  3WKJ B;  5AVB C;  2YFV B;  2LY8 A;  4WNN A;  3LEL D;  1P3M D;  2ARO A;  2CV5 A;  4WU9 B;  5AVB D;  3LJA C;  5CPK C;  4WU8 C;  2IO5 C;  1ZLA B;  3LZ1 B;  4CAY B;  3AFA C;  4DRA A;  5B0Z B;  3LJA D;  5B31 C;  1P3I C;  5CPK D;  4WU8 D;  3UT9 B;  3AFA D;  2HIO C;  3AZF B;  3W99 C;  2FJ7 A;  3WTP C;  5BO0 B;  5B31 D;  3W97 A;  3UTB B;  1P3I D;  3O62 B;  3VH5 T;  2F8N A;  4WZS B;  2HIO D;  5FUG B;  1JFI B;  3W99 D;  1EQZ B;  1Q9C A;  3C1C C;  3AZE B;  4J8U C;  3TU4 A;  3AZN A;  1P3A B;  1P3F C;  4JJN B;  4R8P C;  1P3O A;  3VH6 A;  3C1C D;  3X1T A;  4J8U D;  1N1J B;  2NZD C;  1P3F D;  3MGR A;  4R8P D;  4X23 A;  4H9S A;  2RVQ C;  4J8V C;  1P3L A;  1M19 C;  3UTA C;  1WWI A;  4H9P A;  3KWQ C;  5CHL B;  3LZ0 A;  3MGQ B;  1P3K A;  2NZD D;  1P34 C;  2RVQ D;  4J8V D;  5AV9 A;  3B0C W;  5B0Y B;  1M19 D;  3UTA D;  3AZM C;  3KXB B;  3LEL A;  3KWQ D;  1P3P C;  1P3M A;  5GT0 A;  5B32 C;  1P34 D;  4KHA B;  1TAF A;  3WA9 B;  2NQB B;  3KUY C;  5CP6 B;  3AZM D;  5AVB A;  5BNX B;  3MNN B;  5GSU B;  1P3P D;  3NQJ A;  1F66 B;  5B32 D;  5B24 C;  3MGP C;  5G49 A;  1TZY B;  3KUY D;  5AV6 C;  3REH B;  3LJA A;  1M1A C;  3AZI C;  5CPK A;  3NQU B;  4WU8 A;  3B6G B;  5B24 D;  3MGS C;  3AFA A;  3MGP D;  5CPI D;  5DNM C;  4Z66 B;  5AV6 D;  1P3I A;  5B31 A;  3AZI D;  3AZG B;  3REI B;  3MGS D;  2HIO A;  1M18 B;  5DNM D;  3WTP A;  2F8N G;  3W99 A;  3AZH B;  3X1U B;  3C1B C;  4G91 B;  3V9R A;  4ZUX B;  5AV5 B;  3AV2 C;  1ID3 B;  4YS3 C;  3C1C A;  5B1L C;  2ARO B;  4J8U A;  3C1B D;  2CV5 B;  1P3F A;  3WTP E;  4R8P A;  3AV2 D;  5B2J C;  5JRG C;  4J8W B;  5AV8 C;  4YS3 D;  5BNV A;  5B1L D;  5E5A B;  5F99 C;  2NZD A;  1F1E A;  4NE6 A;  4UUZ A;  5JRG D;  3WAA C;  5GT3 C;  3REJ C;  5KDM B;  5B33 C;  4J8V A;  1KX4 C;  1KX5 B;  1M19 A;  3UTA A;  5JA4 A;  3KWQ A;  3A6N D;  5F99 D;  2FJ7 B;  1P34 A;  5GT3 D;  5B33 D;  3REJ D;  1HQ3 C;  1KX4 D;  3W97 B;  3WAA D;  1S32 B;  3AZM A;  1P3P A;  1BH9 A;  5B32 A;  1HQ3 D;  3KUY A;  4H9Q A;  3AZN B;  1A7W A;  4Z5T D;  5C3I C;  5B24 A;  3MGP A;  3MGR B;  5AV6 A;  4X23 B;  3AZL B;  1P3B B;  3AZI A;  1B6W A;  1M1A A;  1P3L B;  4KGC B;  5B31 G;  2BYM A;  3MGS A;  4H9P B;  3X1S C;  1P3K B;  5DNM A;  3LEL B;  3X1S D;  3AV1 C;  4HGA C;  1P3M B;  5GT0 B;  1P3G B;  1TAF B;  3C1B A;  4AWL B;  3AV2 A;  4LD9 C;  3AV1 D;  3NQJ B;  4YS3 A;  1AOI B;  5G49 B;  2L5A A;  5B1L A;  4E44 A;  4Z2M H;  3B6F C;  4NE3 A;  5AVC C;  5B2J A;  5JRG A;  1H3O A;  3LJA B;  4LD9 D;  5AV8 A;  4XUJ B;  5CPJ C;  2IO5 B;  1ZLA D;  5F99 A;  3B6F D;  5AVC D;  5GT3 A;  5B31 B;  5B33 A;  3REJ A;  3UTB C;  3AYW C;  1P3I B;  3WAA A;  5CPJ D;  4EO5 B;  2HUE C;  2HIO B;  3WTP B;  3UTB D;  1HQ3 A;  5B40 B;  3AYW D;  3X1V A;  5B32 G;  4CSR A;  4J8X C;  4J8U B;  2JSS A;  4ZBJ C;  4J8X D;  5DNN C;  3AZK B;  3REL C;  3B0D C;  2NZD B;  4M6B A;  4UUZ B;  4J8V B;  3R45 A;  5DNN D;  1M19 B;  3KXB C;  3REL D;  3UTA B;  5JA4 B;  1KX3 B;  5GXQ B;  3X1S A;  2PYO B;  3VH6 T;  5CPI C;  3KXB D;  5B2I B;  3AZM B;  3AV1 A;  1BFM A;  1BH9 B;  5B32 B;  3KUY B;  4H9Q B;  5CP6 D;  3AZJ C;  4LD9 A;  4H9R A;  3MNN D;  3W96 C;  3B6G C;  4KUD C;  1U35 C;  5B24 B;  3MGP B;  3B6F A;  5AVC A;  5AV6 B;  3AZJ D;  1M1A B;  3AZI B;  3W96 D;  3B6G D;  3REI C;  4KUD D;  5CPJ A;  1U35 D;  2BYM B;  3REK C;  3MGS B;  4QLC C;  4WNN B;  4DRB A;  4G92 B;  5DNM B;  5BO0 A;  3UTB A;  3AYW A;  3REI D;  3REK D;  3AN2 C;  4QLC D;  1ID3 C;  3A6N C;  3C1B B;  5AV5 D;  4ZUX D;  3AV2 B;  4J8W C;  4J8X A;  3AN2 D;  1ID3 D;  3W98 C;  3VH5 W;  4YS3 B;  5B1L B;  5E5A C;  4WV4 B;  1BH8 A;  5AY8 C;  5B2J B;  1H3O B;  5JRG B;  4J8W D;  1KX5 C;  5AV8 B;  5DNN A;  3B0B A;  3W98 D;  3REL A;  4Z5T C;  5E5A D;  2F8N B;  5F99 B;  5AY8 D;  5GT3 B;  5B33 B;  3REJ B;  1KX5 D;  3TU4 B;  5B1M C;  1S32 C;  3KXB A;  2BYK A;  1P3O B;  4XZQ C;  3B0C T;  3X1T B;  3X1V B;  5CPI A;  5B1M D;  1S32 D;  3MVD C;  4CSR B;  5BNX A;  4XZQ D;  3LZ0 B;  3MVD D;  3AZJ A;  3AZL C;  1P3B C;  4KGC C;  3NQU A;  4H9N A;  3W96 A;  5C3I B;  5AV9 B;  3B6G A;  4KUD A;  4YM6 C;  1U35 A;  3WKJ C;  4NE5 A;  3AZL D;  1P3B D;  4KGC D; 
#chains in the Genus database with same CATH topology
 1W2E A;  3REI A;  5BT1 D;  4YM6 D;  4WU9 C;  3REK A;  3WKJ D;  5AVB B;  4QLC A;  3X1S B;  5GT0 C;  3VH5 A;  1P3G C;  1ZLA C;  3LZ1 C;  4AWL C;  5B0Z C;  4WU9 D;  3AN2 A;  5CPK B;  3AV1 B;  4HGA B;  1ID3 A;  3EPH A;  4WU8 B;  5GT0 D;  4H9O A;  1AOI C;  3UT9 C;  1P3G D;  3LZ1 D;  3AFA B;  3A6N A;  3AZF C;  2Y2M A;  5B0Z D;  4J8W A;  4LD9 B;  4H9R B;  1KX4 A;  3O62 C;  4XUJ C;  1AOI D;  3W98 A;  3UT9 D;  5E5A A;  3AZF D;  3B6F B;  1EQZ C;  5AY8 A;  5AVC B;  3W99 B;  5KDM A;  3O62 D;  3AZE C;  1P3A C;  1KX5 A;  4XUJ D;  4JJN C;  3V9R B;  1HTA A;  4EO5 C;  5CPJ B;  5BS7 C;  4Z5T A;  1EQZ D;  5B40 C;  3C1C B;  3AYW B;  3AZE D;  1P3A D;  5B1M A;  1S32 A;  4JJN D;  1P3F B;  4R8P B;  2HUE B;  4XZQ A;  2Y2K A;  3WTP D;  5BNV B;  2ZY4 A;  5B40 D;  4E45 A;  3MGQ C;  1ULY A;  3MVD A;  4J8X B;  2YFW A;  3AL0 C;  5B0Y C;  3AZK C;  2W8S A;  3KWQ B;  3MGQ D;  1BH8 B;  3AZL A;  1P3B A;  4ZBJ B;  1P34 B;  4KGC A;  2NQB C;  3WA9 C;  5B0Y D;  5DNN B;  3AZK D;  5CP6 C;  4YM6 A;  2XD1 A;  2Y2L A;  3REL B;  2YFV A;  3B0D B;  5GXQ C;  1KX3 C;  3WKJ A;  3MNN C;  5GSU C;  1P3P B;  1F66 C;  2PYO C;  1TZY C;  2NQB D;  3WA9 D;  5B2I C;  3REH C;  4WU9 A;  1KX3 D;  2BYK B;  5GXQ D;  5GSU D;  2Y2H A;  2Y2J A;  1F66 D;  2PYO D;  1P3G A;  1ZLA A;  3LZ1 A;  4CAY A;  1TZY D;  5CPI B;  5B0Z A;  4Z66 C;  5B2I D;  3REH D;  1Z2C B;  3AZG C;  2CWE A;  1AOI A;  3UT9 A;  2F8N K;  2G5I C;  3AZF A;  1M18 C;  4Z66 D;  3AZJ B;  3P5J B;  3O62 A;  3AZH C;  3X1U C;  3AZG D;  4H9N B;  3W96 B;  4G91 C;  4XUJ A;  4ZUX C;  5AV5 C;  1U35 B;  4KUD B;  4G92 C;  5FUG A;  1JFI A;  1M18 D;  1EQZ A;  1M1A D;  2ARO C;  3AZE A;  3X1U D;  3AZH D;  2CV5 C;  1P3A A;  4JJN A;  3REK B;  5BS7 A;  4QLC B;  5B40 A;  2ARO D;  1N1J A;  2CV5 D;  1KU5 A;  3AN2 B;  4H9O B;  3A6N B;  3MGQ A;  1B67 A;  2FJ7 C;  3W97 C;  1KX4 B;  3WAA B;  5B0Y A;  3AZK A;  3W98 B;  2F8N H;  2FJ7 D;  5B2J D;  5AY8 B;  4KHA A;  3W97 D;  2NQB A;  3WA9 A;  1HQ3 B;  5AV8 D;  3TU4 C;  3AZN C;  5CP6 A;  2RIQ A;  1KX3 A;  5GXQ A;  1P3O C;  4Z5T B;  2F8N D;  3MNN A;  5GSU A;  1F66 A;  2PYO A;  1TZY A;  3X1V C;  3TU4 D;  3X1T C;  3AZN D;  5B1M B;  2Y2Q A;  4X23 C;  5B2I A;  4H9S C;  3MGR C;  3REH A;  1P3O D;  4Z2M G;  4XZQ B;  1P3L C;  5BT1 C;  1WWS A;  3A1I A;  3X1T D;  3X1V D;  3LZ0 C;  1P3K C;  3MGR D;  4Z66 A;  4X23 D;  3MVD B;  1P3L D;  2YFW B;  3VH6 W;  5AV9 C;  3AZG A;  3R45 B;  3LEL C;  3LZ0 D;  1P3K D;  1M18 A;  1P3M C;  1R4V A;  3AZH A;  3X1U A;  5AV9 D;  4NFT A;  5AV5 A;  4ZUX A;  2Y2G A;  4YM6 B;  3KSY A;  3WKJ B;  5AVB C;  2YFV B;  2LY8 A;  4WNN A;  3LEL D;  1P3M D;  2ARO A;  2CV5 A;  4WU9 B;  5AVB D;  3LJA C;  5CPK C;  4WU8 C;  2IO5 C;  1ZLA B;  3LZ1 B;  4CAY B;  3AFA C;  4DRA A;  5B0Z B;  3LJA D;  5B31 C;  1P3I C;  5CPK D;  4WU8 D;  3UT9 B;  3AFA D;  2HIO C;  3EG5 B;  3AZF B;  3W99 C;  2FJ7 A;  3WTP C;  5BO0 B;  5B31 D;  3W97 A;  3UTB B;  1P3I D;  3O62 B;  3VH5 T;  3EPK A;  2F8N A;  4WZS B;  2HIO D;  5FUG B;  1JFI B;  3W99 D;  1EQZ B;  1Q9C A;  3C1C C;  2ZY2 A;  3AZE B;  4J8U C;  3TU4 A;  3AZN A;  1P3A B;  1P3F C;  4JJN B;  4R8P C;  1P3O A;  3VH6 A;  2ZY3 A;  3C1C D;  3X1T A;  4J8U D;  1N1J B;  2NZD C;  1P3F D;  3MGR A;  4R8P D;  4X23 A;  4H9S A;  2RVQ C;  4J8V C;  1P3L A;  1M19 C;  3UTA C;  1WWI A;  4H9P A;  3KWQ C;  5CHL B;  3LZ0 A;  3MGQ B;  1P3K A;  2NZD D;  2Y2N A;  1P34 C;  2RVQ D;  4J8V D;  5AV9 A;  3B0C W;  5B0Y B;  1M19 D;  3UTA D;  3AZM C;  3KXB B;  3LEL A;  3KWQ D;  1P3P C;  1P3M A;  5GT0 A;  5B32 C;  2DF4 C;  1P34 D;  2JCH A;  4KHA B;  1TAF A;  3WA9 B;  2NQB B;  3KUY C;  5CP6 B;  3AZM D;  5AVB A;  5BNX B;  3MNN B;  5GSU B;  1P3P D;  3NQJ A;  1F66 B;  5B32 D;  5B24 C;  3MGP C;  5G49 A;  1TZY B;  3KUY D;  5AV6 C;  3REH B;  3LJA A;  1M1A C;  3AZI C;  5CPK A;  3NQU B;  4WU8 A;  3B6G B;  5B24 D;  3MGS C;  3AFA A;  3MGP D;  5CPI D;  5DNM C;  4Z66 B;  5AV6 D;  1P3I A;  5B31 A;  3AZI D;  3AZG B;  3REI B;  3MGS D;  2HIO A;  2XD5 A;  2VQR A;  5DNM D;  3WTP A;  1M18 B;  4UPK A;  2F8N G;  3W99 A;  3AZH B;  3X1U B;  3C1B C;  4G91 B;  3V9R A;  4ZUX B;  5AV5 B;  3AV2 C;  1ID3 B;  4YS3 C;  3C1C A;  5B1L C;  2ARO B;  4J8U A;  3C1B D;  2CV5 B;  1P3F A;  2F2A C;  3WTP E;  4R8P A;  5B2J C;  5JRG C;  4J8W B;  3AV2 D;  5AV8 C;  3KFU G;  4YS3 D;  5BNV A;  5B1L D;  5E5A B;  5F99 C;  2NZD A;  1F1E A;  4NE6 A;  4UUZ A;  5JRG D;  3WAA C;  5GT3 C;  3REJ C;  5KDM B;  5B33 C;  4J8V A;  1KX4 C;  2FFF B;  1KX5 B;  1M19 A;  3UTA A;  5JA4 A;  3KWQ A;  3A6N D;  5F99 D;  2FJ7 B;  1P34 A;  5GT3 D;  1PZR A;  5B33 D;  1HQ3 C;  3REJ D;  1KX4 D;  3W97 B;  3WAA D;  1S32 B;  3AZM A;  1P3P A;  1BH9 A;  5B32 A;  2BG1 A;  1HQ3 D;  2DQN C;  3A1K A;  3FDD A;  4H9Q A;  3KUY A;  3AZN B;  1A7W A;  4Z5T D;  5C3I C;  5B24 A;  3MGP A;  3H0R C;  3MGR B;  5AV6 A;  4X23 B;  2Y2P A;  3AZL B;  3AZI A;  1B6W A;  1P3B B;  1P3L B;  1M1A A;  4KGC B;  5B31 G;  2BYM A;  3MGS A;  4H9P B;  3X1S C;  1P3K B;  2ZY5 A;  5DNM A;  2UWX A;  2ZM5 A;  3LEL B;  3X1S D;  3AV1 C;  4HGA C;  1P3M B;  5GT0 B;  1P3G B;  2Y2I A;  1TAF B;  3C1B A;  4AWL B;  3AV2 A;  4LD9 C;  3AV1 D;  3NQJ B;  4YS3 A;  1AOI B;  5G49 B;  2L5A A;  5B1L A;  4E44 A;  4Z2M H;  3B6F C;  4NE3 A;  5AVC C;  5B2J A;  1H3O A;  5JRG A;  3LJA B;  4LD9 D;  5AV8 A;  3EPJ A;  4XUJ B;  5CPJ C;  2IO5 B;  1ZLA D;  5F99 A;  3B6F D;  5AVC D;  5GT3 A;  5B31 B;  5B33 A;  3REJ A;  3UTB C;  3AYW C;  1P3I B;  3WAA A;  5CPJ D;  4EO5 B;  2HUE C;  2HIO B;  3H0L C;  2G5H C;  3WTP B;  3UTB D;  1HQ3 A;  5B40 B;  3AYW D;  3X1V A;  5B32 G;  4CSR A;  4J8X C;  4J8U B;  2JSS A;  4ZBJ C;  4J8X D;  2J8P A;  5DNN C;  3AZK B;  3REL C;  3B0D C;  3IP4 C;  2NZD B;  4M6B A;  4UUZ B;  4J8V B;  3R45 A;  5DNN D;  1M19 B;  3KXB C;  3REL D;  3UTA B;  5JA4 B;  1KX3 B;  5GXQ B;  3X1S A;  2PYO B;  3VH6 T;  5CPI C;  3KXB D;  5B2I B;  3AZM B;  3AV1 A;  1BFM A;  1BH9 B;  5B32 B;  1T3U A;  3KUY B;  4H9Q B;  5CP6 D;  3AZJ C;  2Y2O A;  4LD9 A;  4H9R A;  3MNN D;  3W96 C;  3B6G C;  4KUD C;  1U35 C;  5B24 B;  3MGP B;  3B6F A;  5AVC A;  5AV6 B;  3AZJ D;  1M1A B;  3AZI B;  3W96 D;  3B6G D;  3REI C;  4KUD D;  5CPJ A;  1U35 D;  2BYM B;  3REK C;  3MGS B;  4QLC C;  4WNN B;  4DRB A;  4G92 B;  5DNM B;  5BO0 A;  3UTB A;  3AYW A;  3REI D;  3H0M C;  3REK D;  3AN2 C;  4QLC D;  1ID3 C;  3A6N C;  3C1B B;  5AV5 D;  4ZUX D;  3AV2 B;  4J8W C;  4J8X A;  3AN2 D;  2JE5 A;  1ID3 D;  3W98 C;  3VH5 W;  4YS3 B;  5B1L B;  5E5A C;  4WV4 B;  1BH8 A;  3F6T A;  5AY8 C;  5B2J B;  1H3O B;  5JRG B;  4J8W D;  1KX5 C;  5AV8 B;  5DNN A;  3B0B A;  3W98 D;  3REL A;  4Z5T C;  5E5A D;  2F8N B;  5F99 B;  5AY8 D;  4WJ3 C;  5GT3 B;  5B33 B;  3REJ B;  1KX5 D;  3TU4 B;  5B1M C;  1S32 C;  3KXB A;  2BYK A;  1P3O B;  4XZQ C;  3B0C T;  3X1T B;  3X1V B;  5CPI A;  5B1M D;  1S32 D;  3MVD C;  4CSR B;  3EPL A;  5BNX A;  4XZQ D;  3LZ0 B;  3MVD D;  3AZJ A;  3AZL C;  1P3B C;  4KGC C;  3NQU A;  4H9N A;  3W96 A;  5C3I B;  5AV9 B;  3B6G A;  4KUD A;  4YM6 C;  1U35 A;  3WKJ C;  4NE5 A;  4DQY B;  3AZL D;  1P3B D;  4KGC D; 
#chains in the Genus database with same CATH homology
 1W2E A;  3REI A;  5BT1 D;  4YM6 D;  4WU9 C;  3REK A;  3WKJ D;  5AVB B;  4QLC A;  3X1S B;  5GT0 C;  3VH5 A;  1P3G C;  1ZLA C;  3LZ1 C;  4AWL C;  5B0Z C;  4WU9 D;  3AN2 A;  5CPK B;  3AV1 B;  4HGA B;  1ID3 A;  3EPH A;  4WU8 B;  5GT0 D;  4H9O A;  1AOI C;  3UT9 C;  1P3G D;  3LZ1 D;  3AFA B;  3A6N A;  3AZF C;  2Y2M A;  5B0Z D;  4J8W A;  4LD9 B;  4H9R B;  1KX4 A;  3O62 C;  4XUJ C;  1AOI D;  3W98 A;  3UT9 D;  5E5A A;  3AZF D;  3B6F B;  1EQZ C;  5AY8 A;  5AVC B;  3W99 B;  5KDM A;  3O62 D;  3AZE C;  1P3A C;  1KX5 A;  4XUJ D;  4JJN C;  3V9R B;  1HTA A;  4EO5 C;  5CPJ B;  5BS7 C;  4Z5T A;  1EQZ D;  5B40 C;  3C1C B;  3AYW B;  3AZE D;  1P3A D;  5B1M A;  1S32 A;  4JJN D;  1P3F B;  4R8P B;  2HUE B;  4XZQ A;  2Y2K A;  3WTP D;  5BNV B;  2ZY4 A;  5B40 D;  4E45 A;  3MGQ C;  1ULY A;  3MVD A;  4J8X B;  2YFW A;  3AL0 C;  5B0Y C;  3AZK C;  2W8S A;  3KWQ B;  3MGQ D;  1BH8 B;  3AZL A;  1P3B A;  4ZBJ B;  1P34 B;  4KGC A;  2NQB C;  3WA9 C;  5B0Y D;  5DNN B;  3AZK D;  5CP6 C;  4YM6 A;  2XD1 A;  2Y2L A;  3REL B;  2YFV A;  3B0D B;  5GXQ C;  1KX3 C;  3WKJ A;  3MNN C;  5GSU C;  1P3P B;  1F66 C;  2PYO C;  1TZY C;  2NQB D;  3WA9 D;  5B2I C;  3REH C;  4WU9 A;  1KX3 D;  2BYK B;  5GXQ D;  5GSU D;  2Y2H A;  2Y2J A;  1F66 D;  2PYO D;  1P3G A;  1ZLA A;  3LZ1 A;  4CAY A;  1TZY D;  5CPI B;  5B0Z A;  4Z66 C;  5B2I D;  3REH D;  1Z2C B;  3AZG C;  2CWE A;  1AOI A;  3UT9 A;  2F8N K;  2G5I C;  3AZF A;  1M18 C;  4Z66 D;  3AZJ B;  3P5J B;  3O62 A;  3AZH C;  3X1U C;  3AZG D;  4H9N B;  3W96 B;  4G91 C;  4XUJ A;  4ZUX C;  5AV5 C;  1U35 B;  4KUD B;  4G92 C;  5FUG A;  1JFI A;  1M18 D;  1EQZ A;  1M1A D;  2ARO C;  3AZE A;  3X1U D;  3AZH D;  2CV5 C;  1P3A A;  4JJN A;  3REK B;  5BS7 A;  4QLC B;  5B40 A;  2ARO D;  1N1J A;  2CV5 D;  1KU5 A;  3AN2 B;  4H9O B;  3A6N B;  3MGQ A;  1B67 A;  2FJ7 C;  3W97 C;  1KX4 B;  3WAA B;  5B0Y A;  3AZK A;  3W98 B;  2F8N H;  2FJ7 D;  5B2J D;  5AY8 B;  4KHA A;  3W97 D;  2NQB A;  3WA9 A;  1HQ3 B;  5AV8 D;  3TU4 C;  3AZN C;  5CP6 A;  2RIQ A;  1KX3 A;  5GXQ A;  1P3O C;  4Z5T B;  2F8N D;  3MNN A;  5GSU A;  1F66 A;  2PYO A;  1TZY A;  3X1V C;  3TU4 D;  3X1T C;  3AZN D;  5B1M B;  2Y2Q A;  4X23 C;  5B2I A;  4H9S C;  3MGR C;  3REH A;  1P3O D;  4Z2M G;  4XZQ B;  1P3L C;  5BT1 C;  1WWS A;  3A1I A;  3X1T D;  3X1V D;  3LZ0 C;  1P3K C;  3MGR D;  4Z66 A;  4X23 D;  3MVD B;  1P3L D;  2YFW B;  3VH6 W;  5AV9 C;  3AZG A;  3R45 B;  3LEL C;  3LZ0 D;  1P3K D;  1M18 A;  1P3M C;  1R4V A;  3AZH A;  3X1U A;  5AV9 D;  4NFT A;  5AV5 A;  4ZUX A;  2Y2G A;  4YM6 B;  3KSY A;  3WKJ B;  5AVB C;  2YFV B;  2LY8 A;  4WNN A;  3LEL D;  1P3M D;  2ARO A;  2CV5 A;  4WU9 B;  5AVB D;  3LJA C;  5CPK C;  4WU8 C;  2IO5 C;  1ZLA B;  3LZ1 B;  4CAY B;  3AFA C;  4DRA A;  5B0Z B;  3LJA D;  5B31 C;  1P3I C;  5CPK D;  4WU8 D;  3UT9 B;  3AFA D;  2HIO C;  3EG5 B;  3AZF B;  3W99 C;  2FJ7 A;  3WTP C;  5BO0 B;  5B31 D;  3W97 A;  3UTB B;  1P3I D;  3O62 B;  3VH5 T;  3EPK A;  2F8N A;  4WZS B;  2HIO D;  5FUG B;  1JFI B;  3W99 D;  1EQZ B;  1Q9C A;  3C1C C;  2ZY2 A;  3AZE B;  4J8U C;  3TU4 A;  3AZN A;  1P3A B;  1P3F C;  4JJN B;  4R8P C;  1P3O A;  3VH6 A;  2ZY3 A;  3C1C D;  3X1T A;  4J8U D;  1N1J B;  2NZD C;  1P3F D;  3MGR A;  4R8P D;  4X23 A;  4H9S A;  2RVQ C;  4J8V C;  1P3L A;  1M19 C;  3UTA C;  1WWI A;  4H9P A;  3KWQ C;  5CHL B;  3LZ0 A;  3MGQ B;  1P3K A;  2NZD D;  2Y2N A;  1P34 C;  2RVQ D;  4J8V D;  5AV9 A;  3B0C W;  5B0Y B;  1M19 D;  3UTA D;  3AZM C;  3KXB B;  3LEL A;  3KWQ D;  1P3P C;  1P3M A;  5GT0 A;  5B32 C;  2DF4 C;  1P34 D;  2JCH A;  4KHA B;  1TAF A;  3WA9 B;  2NQB B;  3KUY C;  5CP6 B;  3AZM D;  5AVB A;  5BNX B;  3MNN B;  5GSU B;  1P3P D;  3NQJ A;  1F66 B;  5B32 D;  5B24 C;  3MGP C;  5G49 A;  1TZY B;  3KUY D;  5AV6 C;  3REH B;  3LJA A;  1M1A C;  3AZI C;  5CPK A;  3NQU B;  4WU8 A;  3B6G B;  5B24 D;  3MGS C;  3AFA A;  3MGP D;  5CPI D;  5DNM C;  4Z66 B;  5AV6 D;  1P3I A;  5B31 A;  3AZI D;  3AZG B;  3REI B;  3MGS D;  2HIO A;  2XD5 A;  2VQR A;  5DNM D;  3WTP A;  1M18 B;  4UPK A;  2F8N G;  3W99 A;  3AZH B;  3X1U B;  3C1B C;  4G91 B;  3V9R A;  4ZUX B;  5AV5 B;  3AV2 C;  1ID3 B;  4YS3 C;  3C1C A;  5B1L C;  2ARO B;  4J8U A;  3C1B D;  2CV5 B;  1P3F A;  2F2A C;  3WTP E;  4R8P A;  5B2J C;  5JRG C;  4J8W B;  3AV2 D;  5AV8 C;  3KFU G;  4YS3 D;  5BNV A;  5B1L D;  5E5A B;  5F99 C;  2NZD A;  1F1E A;  4NE6 A;  4UUZ A;  5JRG D;  3WAA C;  5GT3 C;  3REJ C;  5KDM B;  5B33 C;  4J8V A;  1KX4 C;  2FFF B;  1KX5 B;  1M19 A;  3UTA A;  5JA4 A;  3KWQ A;  3A6N D;  5F99 D;  2FJ7 B;  1P34 A;  5GT3 D;  1PZR A;  5B33 D;  1HQ3 C;  3REJ D;  1KX4 D;  3W97 B;  3WAA D;  1S32 B;  3AZM A;  1P3P A;  1BH9 A;  5B32 A;  2BG1 A;  1HQ3 D;  2DQN C;  3A1K A;  3FDD A;  4H9Q A;  3KUY A;  3AZN B;  1A7W A;  4Z5T D;  5C3I C;  5B24 A;  3MGP A;  3H0R C;  3MGR B;  5AV6 A;  4X23 B;  2Y2P A;  3AZL B;  3AZI A;  1B6W A;  1P3B B;  1P3L B;  1M1A A;  4KGC B;  5B31 G;  2BYM A;  3MGS A;  4H9P B;  3X1S C;  1P3K B;  2ZY5 A;  5DNM A;  2UWX A;  2ZM5 A;  3LEL B;  3X1S D;  3AV1 C;  4HGA C;  1P3M B;  5GT0 B;  1P3G B;  2Y2I A;  1TAF B;  3C1B A;  4AWL B;  3AV2 A;  4LD9 C;  3AV1 D;  3NQJ B;  4YS3 A;  1AOI B;  5G49 B;  2L5A A;  5B1L A;  4E44 A;  4Z2M H;  3B6F C;  4NE3 A;  5AVC C;  5B2J A;  1H3O A;  5JRG A;  3LJA B;  4LD9 D;  5AV8 A;  3EPJ A;  4XUJ B;  5CPJ C;  2IO5 B;  1ZLA D;  5F99 A;  3B6F D;  5AVC D;  5GT3 A;  5B31 B;  5B33 A;  3REJ A;  3UTB C;  3AYW C;  1P3I B;  3WAA A;  5CPJ D;  4EO5 B;  2HUE C;  2HIO B;  3H0L C;  2G5H C;  3WTP B;  3UTB D;  1HQ3 A;  5B40 B;  3AYW D;  3X1V A;  5B32 G;  4CSR A;  4J8X C;  4J8U B;  2JSS A;  4ZBJ C;  4J8X D;  2J8P A;  5DNN C;  3AZK B;  3REL C;  3B0D C;  3IP4 C;  2NZD B;  4M6B A;  4UUZ B;  4J8V B;  3R45 A;  5DNN D;  1M19 B;  3KXB C;  3REL D;  3UTA B;  5JA4 B;  1KX3 B;  5GXQ B;  3X1S A;  2PYO B;  3VH6 T;  5CPI C;  3KXB D;  5B2I B;  3AZM B;  3AV1 A;  1BFM A;  1BH9 B;  5B32 B;  1T3U A;  3KUY B;  4H9Q B;  5CP6 D;  3AZJ C;  2Y2O A;  4LD9 A;  4H9R A;  3MNN D;  3W96 C;  3B6G C;  4KUD C;  1U35 C;  5B24 B;  3MGP B;  3B6F A;  5AVC A;  5AV6 B;  3AZJ D;  1M1A B;  3AZI B;  3W96 D;  3B6G D;  3REI C;  4KUD D;  5CPJ A;  1U35 D;  2BYM B;  3REK C;  3MGS B;  4QLC C;  4WNN B;  4DRB A;  4G92 B;  5DNM B;  5BO0 A;  3UTB A;  3AYW A;  3REI D;  3H0M C;  3REK D;  3AN2 C;  4QLC D;  1ID3 C;  3A6N C;  3C1B B;  5AV5 D;  4ZUX D;  3AV2 B;  4J8W C;  4J8X A;  3AN2 D;  2JE5 A;  1ID3 D;  3W98 C;  3VH5 W;  4YS3 B;  5B1L B;  5E5A C;  4WV4 B;  1BH8 A;  3F6T A;  5AY8 C;  5B2J B;  1H3O B;  5JRG B;  4J8W D;  1KX5 C;  5AV8 B;  5DNN A;  3B0B A;  3W98 D;  3REL A;  4Z5T C;  5E5A D;  2F8N B;  5F99 B;  5AY8 D;  4WJ3 C;  5GT3 B;  5B33 B;  3REJ B;  1KX5 D;  3TU4 B;  5B1M C;  1S32 C;  3KXB A;  2BYK A;  1P3O B;  4XZQ C;  3B0C T;  3X1T B;  3X1V B;  5CPI A;  5B1M D;  1S32 D;  3MVD C;  4CSR B;  3EPL A;  5BNX A;  4XZQ D;  3LZ0 B;  3MVD D;  3AZJ A;  3AZL C;  1P3B C;  4KGC C;  3NQU A;  4H9N A;  3W96 A;  5C3I B;  5AV9 B;  3B6G A;  4KUD A;  4YM6 C;  1U35 A;  3WKJ C;  4NE5 A;  4DQY B;  3AZL D;  1P3B D;  4KGC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...