5E5AC

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 34
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aC00
4NE6A 1H3OB 3A6NC 3W97A 3KXBA 5GSUC 5B32B 5DNMB 4XUJA 4J8UA 2HIOC 1M18D 2NZDD 4KGCD 1P3GC 1KX5B 4J8WC 3KWQC 3AZMD 5AVBC 3AZKC 4X23B 4KUDA 3MNNB 3WTPA 3NQJB 5AY8A 2RVQD 3LJAA 5BT1D 5B0YB 3KUYC 1U35A 5B1LB 5AV8D 5KDMA 2F8NK 2BYMB 4KHAB 3B6GA 5CP6D 5JRGD 4Z2MG 3UTBD 5B32D 5E5AB 5CPIC 3REKC 1M1AB 5B2JB 4E44A 3REHD 5F99D 3MGSD 5C3IB 3WKJC 5B33C 1P3PC 3X1TB 2YFWA 3AZED 3LZ0D 1P3ID 4DRAA 5B0YD 4QLCA 3AFAA 1BH9B 1P34A 2F8ND 3A6NA 3AZFD 5GSUA 2NQBC 3MGPC 3AZGB 2HIOA 5AVCA 1HQ3C 1EQZB 5E5AD 1M1AD 4J8WA 2AROC 5FUGB 4R8PD 3AZKA 1P3OB 4J8VB 3TU4C 4LD9A 3MVDC 3KSYA 1P3AC 5GXQB 3AYWB 3X1TD 1AOIC 3UT9D 2IO5C 4CAYB 4H9RA 5BO0A 4UUZB 4ZUXB 2BYKA 4J8UD 3AN2D 1KX4C 5B31C 5B40B 1M19B 5B0ZD 1JFIB 3RELC 3AZHA 5CPJC 1R4VA 5CPIA 1F66C 4YS3C 4G92B 1WWIA 3B6FC 3WTPD 3WA9C 3LJAD 5DNNB 3WKJA 1ID3A 1P3PA 3W98C 1P3FA 4WU8A 2HUEC 3NQUA 3V9RB 1KX3C 3X1VB 1N1JB 5B2IC 3MGPA 4ZUXD 4H9NB 5B40D 3KWQB 4JJNC 1S32B 4NE5A 1P3LB 1M19D 3REJC 4Z5TA 2L5AA 3UTAA 3REIB 3AZIC 1P3MD 3KXBC 2LY8A 3W97C 3KUYB 5B31G 4NFTA 4WU9A 4XZQC 5DNND 4XUJC 4QLCD 1P3AA 3A6ND 3W99B 2PYOB 3B0CT 5GSUD 4KUDC 3AZJC 5AY8C 2HIOD 1KX4A 3REKB 1U35C 4AWLC 5CPJA 5BNVA 5GT0A 1P3GD 4J8WD 3KWQD 3B6GC 5AVBD 3MGQC 4H9PB 5B33B 5AV6A 3X1UC 3AZKD 5B1MA 3B6FA 3B0DB 5GT3A 1ZLAA 3VH6W 3KUYD 1M18B 4YM6A 5DNMA 1KX3A 4HGAB 3AZLA 1KX5A 1HQ3B 5AV8B 1HTAA 5CPID 3REKD 5CP6B 2AROB 3AFAC 1P34C 3REJA 5JRGB 4Z66C 3AZIA 3TU4B 5B1LA 3UTBB 3MVDB 5B33D 3WKJD 1P3PD 3LZ1A 5AV5C 1AOIB 3O62A 4XZQA 5AV9C 1P3BC 2IO5B 5AVCC 3MGRC 3REHB 5F99B 3MGSB 2FJ7A 3C1BA 2NQBD 1WWSA 3MGPD 3RELB 4NE3A 3AZEB 3LZ0B 3AZJA 1P3IB 1F66B 4LD9C 3R45A 1HQ3D 2F8NB 3WA9B 2AROD 3MGQA 3X1UA 3W98B 3AZFB 3TU4D 3MVDD 1P3AD 1AOID 5BNXB 3AZHC 3LELA 5B2IB 4R8PB 3C1CA 1KX4D 5B31D 3VH5A 4JJNB 1ID3C 3RELD 1P3FC 1EQZA 4WU8C 5CPJD 1BH8A 3UT9B 1F66D 3KXBB 4YS3D 1P3OA 3W97B 3B6FD 1TZYA 4Z66A 3WA9D 4J8UB 3AN2B 3AYWA 2CV5A 3W98D 5AV5A 4EO5C 5B0ZB 5AV9A 1P3BA 2CWEA 3MGRA 1KX3D 3X1SA 4KUDB 4Z5TC 3UTAC 3WTPB 3LJAB 1U35B 4AWLB 5B2ID 4WU9C 3B6GB 4JJND 3AZNC 3REJD 4ZBJC 3AZID 3KXBD 3W97D 4WNNA 5CPKA 4XZQD 4XUJD 3AV2C 5JA4A 3AV1C 3W96C 4J8XA 5GT0C 1P3MB 5B24C 4CSRA 5AV6C 3WAAC 4KUDD 5B1MC 1F1EA 4H9NA 2YFWB 5GT3C 4G91B 5AY8D 3AZJD 1P3LA 1ZLAC 1U35D 4QLCB 1P34B 4YM6C 3B6GD 3A6NB 1P3KA 3MGQD 5DNMC 3X1UD 5GSUB 3AZLC 2HIOB 5AVCB 5G49A 1KX5C 3W99A 1P3GB 4J8WB 5AVBB 3B0CW 4X23C 3MNNC 3AZKB 5B1LC 1TAFB 3LZ1C 3O62C 3VH5T 4H9QA 3AFAD 3AZNA 4DRBA 1P34D 5BO0B 4Z66D 2FJ7C 2BYKB 2NZDA 4KGCA 3C1BC 2YFVA 5AV5D 3AZHB 5AV9D 3AZMA 3AV2A 5B2JC 5CPIB 1P3BD 5AVCD 3MGRD 3AV1A 3W96A 5B24A 3WKJB 1ID3B 1P3PB 5AV8A 3WAAA 4WU8B 4LD9D 3NQUB 1H3OA 4H9SC 5B32A 3LELC 3AZGC 4EO5B 2NQBB 3MGPB 3C1CC 3REHA 1ULYA 2JSSA 5F99A 1EQZC 3AZHD 4Z5TB 3UTAB 4X23A 1P3OC 3MNNA 3LZ0A 3NQJA 4J8VC 1TZYC 4H9OB 5B0YA 3WTPE 5GXQC 3AYWC 2CV5C 1ID3D 1P3AB 1P3FD 2BYMA 4KHAA 4WU8D 4ZBJB 1A7WA 3AZFA 3X1SC 1KX4B 5B31B 5E5AA 1M1AA 5CPJB 5BS7C 5BNVB 5GT0B 5B2JA 4YS3B 5B1MB 4Z5TD 3B6FB 3UTAD 5GT3B 1ZLAB 3X1TA 3UT9A 5CPKC 2HUEB 4WU9D 4YM6B 1BH9A 3AZND 1BFMA 1KX3B 3AN2A 4H9SA 3X1VC 4J8XC 3AZLB 5B0ZA 3AZGA 3AV2D 1S32C 1P3LC 3REIC 3REJB 3AV1D 3W96D 5GT0D 3AZIB 5B24D 5FUGA 1P3KC 5AV6D 3WAAD 3LZ1B 5B1MD 4J8VA 5GT3D 3O62B 1ZLAD 4XZQB 4XUJB 5GXQA 3W99C 4YM6D 4CAYA 2PYOC 2FJ7B 5DNMD 3C1BB 4UUZA 4ZUXA 3AZLD 5B40A 3AZJB 5AY8B 1M19A 1JFIA 3R45B 1KX5D 1P3MA 5KDMB 5BS7A 4X23D 3MGQB 3MNND 3B0DC 3X1UB 5DNNA 4M6BA 1M18C 5B1LD 2NZDC 4KGCC 3LZ1D 3O62D 3AZMC 3V9RA 3LELB 4HGAC 3X1VA 2RVQC 5BT1C 2FJ7D 3C1CB 1N1JA 3C1BD 5AV8C 1P3GA 3KWQA 5CP6C 1BH8B 5AVBA 5B2JD 1S32A 2F8NH 3AFAB 5JRGC 3REIA 1TZYB 3UTBC 3KUYA 4Z66B 1TAFA 1Q9CA 5B32C 2CV5B 5AV5B 3VH5W 5AV9B 3REHC 1P3BB 5F99C 3MGRB 3MGSC 3X1SB 2PYOA 3VH6A 4WV4B 3LELD 4E45A 3AZGD 3AZEC 3LZ0C 1P3IC 3REKA 5B0YC 3C1CD 4LD9B 1EQZD 4H9PA 5B33A 3AZFC 1P3OD 1B67A 4H9RB 4WNNB 4J8VD 1TZYD 5CPKB 1B6WA 1M18A 5GXQD 3AYWD 2CV5D 5JA4B 5E5AC 1M1AC 4J8XB 2NQBA 4R8PC 4CSRB 5B32G 3X1SD 5C3IC 3X1TC 1HQ3A 3UT9C 1P3FB 5CP6A 2AROA 1P3KB 5JRGA 4H9OA 3TU4A 4J8UC 3UTBA 3MVDA 3AN2C 4WZSB 5B0ZC 1AOIA 5CPKD 5G49B 2F8NG 3MGSA 3WTPC 4Z2MH 3LJAC 5B31A 4J8XD 3X1VD 3RELA 3AZEA 1P3IA 1F66A 4WU9B 4YS3A 1S32D 1P3LD 4H9QB 3AZNB 2F8NA 3REID 3WA9A 1P3KD 3W98A 2NZDB 4KGCB 3B0BA 2YFVB 4ZUXC 5B40C 3AZMB 3AV2B 1M19C 5BNXA 5CHLB 3W99D 3AV1B 1KU5A 1P3MC 2PYOD 3W96B 5B24B 4G92C 5B2IA 4R8PA 5AV6B 3WAAB 4G91C 5DNNC 3VH6T 4JJNA 4QLCC
chains in the Genus database with same CATH superfamily
4NE6A 1H3OB 3A6NC 3W97A 3KXBA 5GSUC 5B32B 5DNMB 4XUJA 4J8UA 2HIOC 2J8PA 1M18D 2NZDD 4KGCD 1P3GC 1KX5B 4J8WC 3KWQC 3AZMD 5AVBC 3AZKC 4X23B 4KUDA 3MNNB 3WTPA 3NQJB 5AY8A 2RVQD 3LJAA 5BT1D 5B0YB 3KUYC 1U35A 5B1LB 5AV8D 5KDMA 2F8NK 2BYMB 4KHAB 3B6GA 5CP6D 5JRGD 4Z2MG 3UTBD 2ZM5A 5B32D 5E5AB 5CPIC 3REKC 1M1AB 5B2JB 4E44A 2ZY5A 3REHD 5F99D 3MGSD 5C3IB 3WKJC 5B33C 1P3PC 3X1TB 2YFWA 3AZED 3LZ0D 3FDDA 1P3ID 4DRAA 5B0YD 4QLCA 3AFAA 1BH9B 1P34A 2F8ND 3A6NA 3AZFD 5GSUA 2NQBC 3MGPC 3AZGB 2HIOA 5AVCA 1HQ3C 1EQZB 5E5AD 1M1AD 4J8WA 2AROC 5FUGB 4R8PD 3AZKA 1P3OB 4J8VB 3TU4C 4LD9A 3MVDC 3KSYA 2Y2JA 1P3AC 5GXQB 3AYWB 3X1TD 1AOIC 3UT9D 2IO5C 4CAYB 4H9RA 5BO0A 4UUZB 4ZUXB 2BYKA 3EPKA 4J8UD 3AN2D 5B31C 1KX4C 5B40B 1M19B 5B0ZD 1JFIB 3RELC 2Y2LA 3AZHA 5CPJC 1R4VA 5CPIA 1F66C 4YS3C 2Y2MA 4G92B 1WWIA 3B6FC 2RIQA 3WTPD 3WA9C 3LJAD 5DNNB 3WKJA 1ID3A 1P3PA 3W98C 1P3FA 4WU8A 2HUEC 3NQUA 3V9RB 1KX3C 3X1VB 1N1JB 5B2IC 3MGPA 4ZUXD 4H9NB 5B40D 3KWQB 4JJNC 1S32B 4NE5A 1P3LB 1M19D 3REJC 4Z5TA 2L5AA 3UTAA 3REIB 3AZIC 1P3MD 1W2EA 2LY8A 3KXBC 3W97C 3KUYB 5B31G 4NFTA 4WU9A 4XZQC 5DNND 4XUJC 4QLCD 1P3AA 3A6ND 3W99B 3EPJA 2PYOB 2VQRA 3B0CT 5GSUD 4KUDC 3AZJC 5AY8C 2HIOD 1KX4A 3REKB 1U35C 4AWLC 5CPJA 5BNVA 5GT0A 1P3GD 4J8WD 3KWQD 3B6GC 5AVBD 3MGQC 4H9PB 5B33B 5AV6A 3X1UC 3AZKD 5B1MA 3B6FA 3B0DB 5GT3A 1ZLAA 3A1IA 3VH6W 2Y2HA 3KUYD 1M18B 4YM6A 5DNMA 1KX3A 4HGAB 3AZLA 1KX5A 3H0LC 1HQ3B 5AV8B 1HTAA 5CPID 3REKD 5CP6B 2AROB 2G5HC 3AFAC 1P34C 3REJA 5JRGB 4Z66C 3AZIA 3TU4B 5B1LA 3UTBB 3MVDB 5B33D 3WKJD 1P3PD 3LZ1A 5AV5C 1AOIB 3O62A 4XZQA 5AV9C 3KFUG 1P3BC 2IO5B 5AVCC 2ZY2A 3MGRC 3REHB 5F99B 3MGSB 2FJ7A 3C1BA 2NQBD 1WWSA 2XD5A 3MGPD 3RELB 4NE3A 3AZEB 3LZ0B 3AZJA 1P3IB 1F66B 4LD9C 3R45A 1HQ3D 2F8NB 3WA9B 2AROD 3MGQA 3X1UA 3W98B 3AZFB 1T3UA 3TU4D 3MVDD 1P3AD 1AOID 5BNXB 3AZHC 3LELA 5B2IB 4R8PB 3C1CA 1KX4D 5B31D 3VH5A 4JJNB 1ID3C 3RELD 1P3FC 1EQZA 4WU8C 5CPJD 1BH8A 3UT9B 1F66D 3KXBB 4YS3D 1P3OA 3W97B 3B6FD 1TZYA 4Z66A 3WA9D 4J8UB 3AN2B 3AYWA 2CV5A 3W98D 5AV5A 4EO5C 5B0ZB 5AV9A 1P3BA 2CWEA 3MGRA 1KX3D 3X1SA 4KUDB 4Z5TC 3P5JB 3UTAC 3WTPB 3LJAB 1U35B 4AWLB 3EG5B 5B2ID 4WU9C 3B6GB 4JJND 3AZNC 3REJD 4ZBJC 3AZID 3KXBD 3W97D 2DF4C 4WNNA 5CPKA 4XZQD 4XUJD 3AV2C 5JA4A 2XD1A 3AV1C 3W96C 4J8XA 5GT0C 1P3MB 5B24C 4CSRA 5AV6C 3WAAC 4KUDD 5B1MC 1F1EA 4H9NA 2YFWB 5GT3C 4G91B 5AY8D 3AZJD 1P3LA 1ZLAC 1U35D 4QLCB 1P34B 4YM6C 3B6GD 2W8SA 3A6NB 1P3KA 3MGQD 5DNMC 3X1UD 5GSUB 3AZLC 2HIOB 5AVCB 2Y2OA 5G49A 1KX5C 3W99A 1P3GB 3EPHA 4J8WB 5AVBB 3B0CW 4X23C 3MNNC 2DQNC 3AZKB 5B1LC 1TAFB 3LZ1C 3O62C 3VH5T 4H9QA 3AFAD 3AZNA 4DRBA 1P34D 5BO0B 4Z66D 2FJ7C 2BYKB 2NZDA 4KGCA 3C1BC 2Y2QA 2YFVA 5AV5D 3AZHB 5AV9D 3AZMA 3AV2A 5B2JC 5CPIB 1P3BD 5AVCD 3MGRD 3AV1A 3W96A 5B24A 3WKJB 1ID3B 1P3PB 5AV8A 3WAAA 4WU8B 4LD9D 3NQUB 1H3OA 4H9SC 5B32A 3LELC 3AZGC 4EO5B 2NQBB 3MGPB 3C1CC 3REHA 1ULYA 2JSSA 2Y2PA 5F99A 1EQZC 3AZHD 4Z5TB 3UTAB 4X23A 1P3OC 3MNNA 3LZ0A 3NQJA 1Z2CB 4J8VC 1TZYC 4H9OB 5B0YA 4DQYB 3WTPE 5GXQC 3AYWC 2CV5C 1ID3D 1P3AB 1P3FD 2BYMA 2Y2NA 4KHAA 4WU8D 2UWXA 4ZBJB 1A7WA 3AZFA 3X1SC 1KX4B 5B31B 5E5AA 1M1AA 5CPJB 5BS7C 5BNVB 5GT0B 5B2JA 2JCHA 4YS3B 2FFFB 5B1MB 4Z5TD 3B6FB 3UTAD 5GT3B 1ZLAB 3X1TA 3UT9A 5CPKC 2HUEB 4WU9D 4YM6B 1BH9A 3IP4C 3AZND 1BFMA 1KX3B 3AL0C 3AN2A 4H9SA 3X1VC 4J8XC 3AZLB 5B0ZA 3AZGA 3AV2D 1S32C 1P3LC 3EPLA 3REIC 3REJB 3AV1D 3W96D 5GT0D 3AZIB 5B24D 5FUGA 1P3KC 5AV6D 3WAAD 3LZ1B 5B1MD 4J8VA 5GT3D 3O62B 1ZLAD 4XZQB 4XUJB 5GXQA 3W99C 4YM6D 4CAYA 2PYOC 2FJ7B 3A1KA 5DNMD 3C1BB 4UUZA 4ZUXA 3AZLD 5B40A 3AZJB 3H0RC 5AY8B 1M19A 1JFIA 3R45B 1KX5D 1P3MA 5KDMB 5BS7A 4X23D 3MGQB 3MNND 3B0DC 3X1UB 5DNNA 4M6BA 1M18C 3H0MC 5B1LD 2NZDC 4KGCC 3F6TA 3LZ1D 3O62D 3AZMC 3V9RA 3LELB 4HGAC 3X1VA 2RVQC 2G5IC 5BT1C 2FJ7D 3C1CB 1N1JA 3C1BD 5AV8C 1P3GA 3KWQA 5CP6C 1BH8B 5AVBA 5B2JD 1S32A 2F8NH 3AFAB 5JRGC 3REIA 1TZYB 3UTBC 3KUYA 4Z66B 1TAFA 1Q9CA 5B32C 2CV5B 5AV5B 3VH5W 5AV9B 3REHC 1P3BB 5F99C 3MGRB 3MGSC 3X1SB 2PYOA 3VH6A 4WV4B 3LELD 4E45A 3AZGD 3AZEC 2Y2IA 3LZ0C 1P3IC 3REKA 5B0YC 3C1CD 4LD9B 1EQZD 4H9PA 5B33A 3AZFC 1P3OD 2BG1A 1B67A 4H9RB 2ZY3A 4WNNB 1TZYD 4J8VD 5CPKB 1B6WA 1M18A 5GXQD 3AYWD 2CV5D 5JA4B 5E5AC 1M1AC 4J8XB 2NQBA 4R8PC 4CSRB 5B32G 3X1SD 5C3IC 2Y2KA 3X1TC 1HQ3A 3UT9C 1P3FB 2Y2GA 5CP6A 2AROA 1P3KB 5JRGA 4H9OA 3TU4A 4J8UC 3UTBA 3MVDA 3AN2C 4WZSB 5B0ZC 1AOIA 5CPKD 5G49B 2F8NG 4UPKA 2JE5A 3MGSA 3WTPC 4Z2MH 3LJAC 5B31A 4J8XD 3X1VD 2ZY4A 3RELA 3AZEA 1P3IA 1F66A 4WU9B 1PZRA 4YS3A 1S32D 1P3LD 4H9QB 3AZNB 2F8NA 3REID 3WA9A 1P3KD 3W98A 2NZDB 4KGCB 3B0BA 2YFVB 4ZUXC 5B40C 3AZMB 3AV2B 1M19C 5BNXA 5CHLB 3W99D 3AV1B 1KU5A 1P3MC 2PYOD 3W96B 2F2AC 5B24B 4G92C 5B2IA 4R8PA 4WJ3C 5AV6B 3WAAB 4G91C 5DNNC 3VH6T 4JJNA 4QLCC
chains in the Genus database with same CATH topology
4NE6A 1H3OB 3A6NC 3W97A 3KXBA 5GSUC 5B32B 5DNMB 4XUJA 4J8UA 2HIOC 2J8PA 1M18D 2NZDD 4KGCD 1P3GC 1KX5B 4J8WC 3KWQC 3AZMD 5AVBC 3AZKC 4X23B 4KUDA 3MNNB 3WTPA 3NQJB 5AY8A 2RVQD 3LJAA 5BT1D 5B0YB 3KUYC 1U35A 5B1LB 5AV8D 5KDMA 2F8NK 2BYMB 4KHAB 3B6GA 5CP6D 5JRGD 4Z2MG 3UTBD 2ZM5A 5B32D 5E5AB 5CPIC 3REKC 1M1AB 5B2JB 4E44A 2ZY5A 3REHD 5F99D 3MGSD 5C3IB 3WKJC 5B33C 1P3PC 3X1TB 2YFWA 3AZED 3LZ0D 3FDDA 1P3ID 4DRAA 5B0YD 4QLCA 3AFAA 1BH9B 1P34A 2F8ND 3A6NA 3AZFD 5GSUA 2NQBC 3MGPC 3AZGB 2HIOA 5AVCA 1HQ3C 1EQZB 5E5AD 1M1AD 4J8WA 2AROC 5FUGB 4R8PD 3AZKA 1P3OB 4J8VB 3TU4C 4LD9A 3MVDC 3KSYA 2Y2JA 1P3AC 5GXQB 3AYWB 3X1TD 1AOIC 3UT9D 2IO5C 4CAYB 4H9RA 5BO0A 4UUZB 4ZUXB 2BYKA 3EPKA 4J8UD 3AN2D 5B31C 1KX4C 5B40B 1M19B 5B0ZD 1JFIB 3RELC 2Y2LA 3AZHA 5CPJC 1R4VA 5CPIA 1F66C 4YS3C 2Y2MA 4G92B 1WWIA 3B6FC 2RIQA 3WTPD 3WA9C 3LJAD 5DNNB 3WKJA 1ID3A 1P3PA 3W98C 1P3FA 4WU8A 2HUEC 3NQUA 3V9RB 1KX3C 3X1VB 1N1JB 5B2IC 3MGPA 4ZUXD 4H9NB 5B40D 3KWQB 4JJNC 1S32B 4NE5A 1P3LB 1M19D 3REJC 4Z5TA 2L5AA 3UTAA 3REIB 3AZIC 1P3MD 1W2EA 2LY8A 3KXBC 3W97C 3KUYB 5B31G 4NFTA 4WU9A 4XZQC 5DNND 4XUJC 4QLCD 1P3AA 3A6ND 3W99B 3EPJA 2PYOB 2VQRA 3B0CT 5GSUD 4KUDC 3AZJC 5AY8C 2HIOD 1KX4A 3REKB 1U35C 4AWLC 5CPJA 5BNVA 5GT0A 1P3GD 4J8WD 3KWQD 3B6GC 5AVBD 3MGQC 4H9PB 5B33B 5AV6A 3X1UC 3AZKD 5B1MA 3B6FA 3B0DB 5GT3A 1ZLAA 3A1IA 3VH6W 2Y2HA 3KUYD 1M18B 4YM6A 5DNMA 1KX3A 4HGAB 3AZLA 1KX5A 3H0LC 1HQ3B 5AV8B 1HTAA 5CPID 3REKD 5CP6B 2AROB 2G5HC 3AFAC 1P34C 3REJA 5JRGB 4Z66C 3AZIA 3TU4B 5B1LA 3UTBB 3MVDB 5B33D 3WKJD 1P3PD 3LZ1A 5AV5C 1AOIB 3O62A 4XZQA 5AV9C 3KFUG 1P3BC 2IO5B 5AVCC 2ZY2A 3MGRC 3REHB 5F99B 3MGSB 2FJ7A 3C1BA 2NQBD 1WWSA 2XD5A 3MGPD 3RELB 4NE3A 3AZEB 3LZ0B 3AZJA 1P3IB 1F66B 4LD9C 3R45A 1HQ3D 2F8NB 3WA9B 2AROD 3MGQA 3X1UA 3W98B 3AZFB 1T3UA 3TU4D 3MVDD 1P3AD 1AOID 5BNXB 3AZHC 3LELA 5B2IB 4R8PB 3C1CA 1KX4D 5B31D 3VH5A 4JJNB 1ID3C 3RELD 1P3FC 1EQZA 4WU8C 5CPJD 1BH8A 3UT9B 1F66D 3KXBB 4YS3D 1P3OA 3W97B 3B6FD 1TZYA 4Z66A 3WA9D 4J8UB 3AN2B 3AYWA 2CV5A 3W98D 5AV5A 4EO5C 5B0ZB 5AV9A 1P3BA 2CWEA 3MGRA 1KX3D 3X1SA 4KUDB 4Z5TC 3P5JB 3UTAC 3WTPB 3LJAB 1U35B 4AWLB 3EG5B 5B2ID 4WU9C 3B6GB 4JJND 3AZNC 3REJD 4ZBJC 3AZID 3KXBD 3W97D 2DF4C 4WNNA 5CPKA 4XZQD 4XUJD 3AV2C 5JA4A 2XD1A 3AV1C 3W96C 4J8XA 5GT0C 1P3MB 5B24C 4CSRA 5AV6C 3WAAC 4KUDD 5B1MC 1F1EA 4H9NA 2YFWB 5GT3C 4G91B 5AY8D 3AZJD 1P3LA 1ZLAC 1U35D 4QLCB 1P34B 4YM6C 3B6GD 2W8SA 3A6NB 1P3KA 3MGQD 5DNMC 3X1UD 5GSUB 3AZLC 2HIOB 5AVCB 2Y2OA 5G49A 1KX5C 3W99A 1P3GB 3EPHA 4J8WB 5AVBB 3B0CW 4X23C 3MNNC 2DQNC 3AZKB 5B1LC 1TAFB 3LZ1C 3O62C 3VH5T 4H9QA 3AFAD 3AZNA 4DRBA 1P34D 5BO0B 4Z66D 2FJ7C 2BYKB 2NZDA 4KGCA 3C1BC 2Y2QA 2YFVA 5AV5D 3AZHB 5AV9D 3AZMA 3AV2A 5B2JC 5CPIB 1P3BD 5AVCD 3MGRD 3AV1A 3W96A 5B24A 3WKJB 1ID3B 1P3PB 5AV8A 3WAAA 4WU8B 4LD9D 3NQUB 1H3OA 4H9SC 5B32A 3LELC 3AZGC 4EO5B 2NQBB 3MGPB 3C1CC 3REHA 1ULYA 2JSSA 2Y2PA 5F99A 1EQZC 3AZHD 4Z5TB 3UTAB 4X23A 1P3OC 3MNNA 3LZ0A 3NQJA 1Z2CB 4J8VC 1TZYC 4H9OB 5B0YA 4DQYB 3WTPE 5GXQC 3AYWC 2CV5C 1ID3D 1P3AB 1P3FD 2BYMA 2Y2NA 4KHAA 4WU8D 2UWXA 4ZBJB 1A7WA 3AZFA 3X1SC 1KX4B 5B31B 5E5AA 1M1AA 5CPJB 5BS7C 5BNVB 5GT0B 5B2JA 2JCHA 4YS3B 2FFFB 5B1MB 4Z5TD 3B6FB 3UTAD 5GT3B 1ZLAB 3X1TA 3UT9A 5CPKC 2HUEB 4WU9D 4YM6B 1BH9A 3IP4C 3AZND 1BFMA 1KX3B 3AL0C 3AN2A 4H9SA 3X1VC 4J8XC 3AZLB 5B0ZA 3AZGA 3AV2D 1S32C 1P3LC 3EPLA 3REIC 3REJB 3AV1D 3W96D 5GT0D 3AZIB 5B24D 5FUGA 1P3KC 5AV6D 3WAAD 3LZ1B 5B1MD 4J8VA 5GT3D 3O62B 1ZLAD 4XZQB 4XUJB 5GXQA 3W99C 4YM6D 4CAYA 2PYOC 2FJ7B 3A1KA 5DNMD 3C1BB 4UUZA 4ZUXA 3AZLD 5B40A 3AZJB 3H0RC 5AY8B 1M19A 1JFIA 3R45B 1KX5D 1P3MA 5KDMB 5BS7A 4X23D 3MGQB 3MNND 3B0DC 3X1UB 5DNNA 4M6BA 1M18C 3H0MC 5B1LD 2NZDC 4KGCC 3F6TA 3LZ1D 3O62D 3AZMC 3V9RA 3LELB 4HGAC 3X1VA 2RVQC 2G5IC 5BT1C 2FJ7D 3C1CB 1N1JA 3C1BD 5AV8C 1P3GA 3KWQA 5CP6C 1BH8B 5AVBA 5B2JD 1S32A 2F8NH 3AFAB 5JRGC 3REIA 1TZYB 3UTBC 3KUYA 4Z66B 1TAFA 1Q9CA 5B32C 2CV5B 5AV5B 3VH5W 5AV9B 3REHC 1P3BB 5F99C 3MGRB 3MGSC 3X1SB 2PYOA 3VH6A 4WV4B 3LELD 4E45A 3AZGD 3AZEC 2Y2IA 3LZ0C 1P3IC 3REKA 5B0YC 3C1CD 4LD9B 1EQZD 4H9PA 5B33A 3AZFC 1P3OD 2BG1A 1B67A 4H9RB 2ZY3A 4WNNB 1TZYD 4J8VD 5CPKB 1B6WA 1M18A 5GXQD 3AYWD 2CV5D 5JA4B 5E5AC 1M1AC 4J8XB 2NQBA 4R8PC 4CSRB 5B32G 3X1SD 5C3IC 2Y2KA 3X1TC 1HQ3A 3UT9C 1P3FB 2Y2GA 5CP6A 2AROA 1P3KB 5JRGA 4H9OA 3TU4A 4J8UC 3UTBA 3MVDA 3AN2C 4WZSB 5B0ZC 1AOIA 5CPKD 5G49B 2F8NG 4UPKA 2JE5A 3MGSA 3WTPC 4Z2MH 3LJAC 5B31A 4J8XD 3X1VD 2ZY4A 3RELA 3AZEA 1P3IA 1F66A 4WU9B 1PZRA 4YS3A 1S32D 1P3LD 4H9QB 3AZNB 2F8NA 3REID 3WA9A 1P3KD 3W98A 2NZDB 4KGCB 3B0BA 2YFVB 4ZUXC 5B40C 3AZMB 3AV2B 1M19C 5BNXA 5CHLB 3W99D 3AV1B 1KU5A 1P3MC 2PYOD 3W96B 2F2AC 5B24B 4G92C 5B2IA 4R8PA 4WJ3C 5AV6B 3WAAB 4G91C 5DNNC 3VH6T 4JJNA 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE6 A;  1H3O B;  3A6N C;  3W97 A;  3KXB A;  5GSU C;  5B32 B;  5DNM B;  4XUJ A;  4J8U A;  2HIO C;  1M18 D;  2NZD D;  4KGC D;  1P3G C;  1KX5 B;  4J8W C;  3KWQ C;  3AZM D;  5AVB C;  3AZK C;  4X23 B;  4KUD A;  3MNN B;  3WTP A;  3NQJ B;  5AY8 A;  2RVQ D;  3LJA A;  5BT1 D;  5B0Y B;  3KUY C;  1U35 A;  5B1L B;  5AV8 D;  5KDM A;  2F8N K;  2BYM B;  4KHA B;  3B6G A;  5CP6 D;  5JRG D;  4Z2M G;  3UTB D;  5B32 D;  5E5A B;  5CPI C;  3REK C;  1M1A B;  5B2J B;  4E44 A;  3REH D;  5F99 D;  3MGS D;  5C3I B;  3WKJ C;  5B33 C;  1P3P C;  3X1T B;  2YFW A;  3AZE D;  3LZ0 D;  1P3I D;  4DRA A;  5B0Y D;  4QLC A;  3AFA A;  1BH9 B;  1P34 A;  2F8N D;  3A6N A;  3AZF D;  5GSU A;  2NQB C;  3MGP C;  3AZG B;  2HIO A;  5AVC A;  1HQ3 C;  1EQZ B;  5E5A D;  1M1A D;  4J8W A;  2ARO C;  5FUG B;  4R8P D;  3AZK A;  1P3O B;  4J8V B;  3TU4 C;  4LD9 A;  3MVD C;  3KSY A;  1P3A C;  5GXQ B;  3AYW B;  3X1T D;  1AOI C;  3UT9 D;  2IO5 C;  4CAY B;  4H9R A;  5BO0 A;  4UUZ B;  4ZUX B;  2BYK A;  4J8U D;  3AN2 D;  1KX4 C;  5B31 C;  5B40 B;  1M19 B;  5B0Z D;  1JFI B;  3REL C;  3AZH A;  5CPJ C;  1R4V A;  5CPI A;  1F66 C;  4YS3 C;  4G92 B;  1WWI A;  3B6F C;  3WTP D;  3WA9 C;  3LJA D;  5DNN B;  3WKJ A;  1ID3 A;  1P3P A;  3W98 C;  1P3F A;  4WU8 A;  2HUE C;  3NQU A;  3V9R B;  1KX3 C;  3X1V B;  1N1J B;  5B2I C;  3MGP A;  4ZUX D;  4H9N B;  5B40 D;  3KWQ B;  4JJN C;  1S32 B;  4NE5 A;  1P3L B;  1M19 D;  3REJ C;  4Z5T A;  2L5A A;  3UTA A;  3REI B;  3AZI C;  1P3M D;  3KXB C;  2LY8 A;  3W97 C;  3KUY B;  5B31 G;  4NFT A;  4WU9 A;  4XZQ C;  5DNN D;  4XUJ C;  4QLC D;  1P3A A;  3A6N D;  3W99 B;  2PYO B;  3B0C T;  5GSU D;  4KUD C;  3AZJ C;  5AY8 C;  2HIO D;  1KX4 A;  3REK B;  1U35 C;  4AWL C;  5CPJ A;  5BNV A;  5GT0 A;  1P3G D;  4J8W D;  3KWQ D;  3B6G C;  5AVB D;  3MGQ C;  4H9P B;  5B33 B;  5AV6 A;  3X1U C;  3AZK D;  5B1M A;  3B6F A;  3B0D B;  5GT3 A;  1ZLA A;  3VH6 W;  3KUY D;  1M18 B;  4YM6 A;  5DNM A;  1KX3 A;  4HGA B;  3AZL A;  1KX5 A;  1HQ3 B;  5AV8 B;  1HTA A;  5CPI D;  3REK D;  5CP6 B;  2ARO B;  3AFA C;  1P34 C;  3REJ A;  5JRG B;  4Z66 C;  3AZI A;  3TU4 B;  5B1L A;  3UTB B;  3MVD B;  5B33 D;  3WKJ D;  1P3P D;  3LZ1 A;  5AV5 C;  1AOI B;  3O62 A;  4XZQ A;  5AV9 C;  1P3B C;  2IO5 B;  5AVC C;  3MGR C;  3REH B;  5F99 B;  3MGS B;  2FJ7 A;  3C1B A;  2NQB D;  1WWS A;  3MGP D;  3REL B;  4NE3 A;  3AZE B;  3LZ0 B;  3AZJ A;  1P3I B;  1F66 B;  4LD9 C;  3R45 A;  1HQ3 D;  2F8N B;  3WA9 B;  2ARO D;  3MGQ A;  3X1U A;  3W98 B;  3AZF B;  3TU4 D;  3MVD D;  1P3A D;  1AOI D;  5BNX B;  3AZH C;  3LEL A;  5B2I B;  4R8P B;  3C1C A;  1KX4 D;  5B31 D;  3VH5 A;  4JJN B;  1ID3 C;  3REL D;  1P3F C;  1EQZ A;  4WU8 C;  5CPJ D;  1BH8 A;  3UT9 B;  1F66 D;  3KXB B;  4YS3 D;  1P3O A;  3W97 B;  3B6F D;  1TZY A;  4Z66 A;  3WA9 D;  4J8U B;  3AN2 B;  3AYW A;  2CV5 A;  3W98 D;  5AV5 A;  4EO5 C;  5B0Z B;  5AV9 A;  1P3B A;  2CWE A;  3MGR A;  1KX3 D;  3X1S A;  4KUD B;  4Z5T C;  3UTA C;  3WTP B;  3LJA B;  1U35 B;  4AWL B;  5B2I D;  4WU9 C;  3B6G B;  4JJN D;  3AZN C;  3REJ D;  4ZBJ C;  3AZI D;  3KXB D;  3W97 D;  4WNN A;  5CPK A;  4XZQ D;  4XUJ D;  3AV2 C;  5JA4 A;  3AV1 C;  3W96 C;  4J8X A;  5GT0 C;  1P3M B;  5B24 C;  4CSR A;  5AV6 C;  3WAA C;  4KUD D;  5B1M C;  1F1E A;  4H9N A;  2YFW B;  5GT3 C;  4G91 B;  5AY8 D;  3AZJ D;  1P3L A;  1ZLA C;  1U35 D;  4QLC B;  1P34 B;  4YM6 C;  3B6G D;  3A6N B;  1P3K A;  3MGQ D;  5DNM C;  3X1U D;  5GSU B;  3AZL C;  2HIO B;  5AVC B;  5G49 A;  1KX5 C;  3W99 A;  1P3G B;  4J8W B;  5AVB B;  3B0C W;  4X23 C;  3MNN C;  3AZK B;  5B1L C;  1TAF B;  3LZ1 C;  3O62 C;  3VH5 T;  4H9Q A;  3AFA D;  3AZN A;  4DRB A;  1P34 D;  5BO0 B;  4Z66 D;  2FJ7 C;  2BYK B;  2NZD A;  4KGC A;  3C1B C;  2YFV A;  5AV5 D;  3AZH B;  5AV9 D;  3AZM A;  3AV2 A;  5B2J C;  5CPI B;  1P3B D;  5AVC D;  3MGR D;  3AV1 A;  3W96 A;  5B24 A;  3WKJ B;  1ID3 B;  1P3P B;  5AV8 A;  3WAA A;  4WU8 B;  4LD9 D;  3NQU B;  1H3O A;  4H9S C;  5B32 A;  3LEL C;  3AZG C;  4EO5 B;  2NQB B;  3MGP B;  3C1C C;  3REH A;  1ULY A;  2JSS A;  5F99 A;  1EQZ C;  3AZH D;  4Z5T B;  3UTA B;  4X23 A;  1P3O C;  3MNN A;  3LZ0 A;  3NQJ A;  4J8V C;  1TZY C;  4H9O B;  5B0Y A;  3WTP E;  5GXQ C;  3AYW C;  2CV5 C;  1ID3 D;  1P3A B;  1P3F D;  2BYM A;  4KHA A;  4WU8 D;  4ZBJ B;  1A7W A;  3AZF A;  3X1S C;  1KX4 B;  5B31 B;  5E5A A;  1M1A A;  5CPJ B;  5BS7 C;  5BNV B;  5GT0 B;  5B2J A;  4YS3 B;  5B1M B;  4Z5T D;  3B6F B;  3UTA D;  5GT3 B;  1ZLA B;  3X1T A;  3UT9 A;  5CPK C;  2HUE B;  4WU9 D;  4YM6 B;  1BH9 A;  3AZN D;  1BFM A;  1KX3 B;  3AN2 A;  4H9S A;  3X1V C;  4J8X C;  3AZL B;  5B0Z A;  3AZG A;  3AV2 D;  1S32 C;  1P3L C;  3REI C;  3REJ B;  3AV1 D;  3W96 D;  5GT0 D;  3AZI B;  5B24 D;  5FUG A;  1P3K C;  5AV6 D;  3WAA D;  3LZ1 B;  5B1M D;  4J8V A;  5GT3 D;  3O62 B;  1ZLA D;  4XZQ B;  4XUJ B;  5GXQ A;  3W99 C;  4YM6 D;  4CAY A;  2PYO C;  2FJ7 B;  5DNM D;  3C1B B;  4UUZ A;  4ZUX A;  3AZL D;  5B40 A;  3AZJ B;  5AY8 B;  1M19 A;  1JFI A;  3R45 B;  1KX5 D;  1P3M A;  5KDM B;  5BS7 A;  4X23 D;  3MGQ B;  3MNN D;  3B0D C;  3X1U B;  5DNN A;  4M6B A;  1M18 C;  5B1L D;  2NZD C;  4KGC C;  3LZ1 D;  3O62 D;  3AZM C;  3V9R A;  3LEL B;  4HGA C;  3X1V A;  2RVQ C;  5BT1 C;  2FJ7 D;  3C1C B;  1N1J A;  3C1B D;  5AV8 C;  1P3G A;  3KWQ A;  5CP6 C;  1BH8 B;  5AVB A;  5B2J D;  1S32 A;  2F8N H;  3AFA B;  5JRG C;  3REI A;  1TZY B;  3UTB C;  3KUY A;  4Z66 B;  1TAF A;  1Q9C A;  5B32 C;  2CV5 B;  5AV5 B;  3VH5 W;  5AV9 B;  3REH C;  1P3B B;  5F99 C;  3MGR B;  3MGS C;  3X1S B;  2PYO A;  3VH6 A;  4WV4 B;  3LEL D;  4E45 A;  3AZG D;  3AZE C;  3LZ0 C;  1P3I C;  3REK A;  5B0Y C;  3C1C D;  4LD9 B;  1EQZ D;  4H9P A;  5B33 A;  3AZF C;  1P3O D;  1B67 A;  4H9R B;  4WNN B;  4J8V D;  1TZY D;  5CPK B;  1B6W A;  1M18 A;  5GXQ D;  3AYW D;  2CV5 D;  5JA4 B;  5E5A C;  1M1A C;  4J8X B;  2NQB A;  4R8P C;  4CSR B;  5B32 G;  3X1S D;  5C3I C;  3X1T C;  1HQ3 A;  3UT9 C;  1P3F B;  5CP6 A;  2ARO A;  1P3K B;  5JRG A;  4H9O A;  3TU4 A;  4J8U C;  3UTB A;  3MVD A;  3AN2 C;  4WZS B;  5B0Z C;  1AOI A;  5CPK D;  5G49 B;  2F8N G;  3MGS A;  3WTP C;  4Z2M H;  3LJA C;  5B31 A;  4J8X D;  3X1V D;  3REL A;  3AZE A;  1P3I A;  1F66 A;  4WU9 B;  4YS3 A;  1S32 D;  1P3L D;  4H9Q B;  3AZN B;  2F8N A;  3REI D;  3WA9 A;  1P3K D;  3W98 A;  2NZD B;  4KGC B;  3B0B A;  2YFV B;  4ZUX C;  5B40 C;  3AZM B;  3AV2 B;  1M19 C;  5BNX A;  5CHL B;  3W99 D;  3AV1 B;  1KU5 A;  1P3M C;  2PYO D;  3W96 B;  5B24 B;  4G92 C;  5B2I A;  4R8P A;  5AV6 B;  3WAA B;  4G91 C;  5DNN C;  3VH6 T;  4JJN A;  4QLC C; 
#chains in the Genus database with same CATH topology
 4NE6 A;  1H3O B;  3A6N C;  3W97 A;  3KXB A;  5GSU C;  5B32 B;  5DNM B;  4XUJ A;  4J8U A;  2HIO C;  2J8P A;  1M18 D;  2NZD D;  4KGC D;  1P3G C;  1KX5 B;  4J8W C;  3KWQ C;  3AZM D;  5AVB C;  3AZK C;  4X23 B;  4KUD A;  3MNN B;  3WTP A;  3NQJ B;  5AY8 A;  2RVQ D;  3LJA A;  5BT1 D;  5B0Y B;  3KUY C;  1U35 A;  5B1L B;  5AV8 D;  5KDM A;  2F8N K;  2BYM B;  4KHA B;  3B6G A;  5CP6 D;  5JRG D;  4Z2M G;  3UTB D;  2ZM5 A;  5B32 D;  5E5A B;  5CPI C;  3REK C;  1M1A B;  5B2J B;  4E44 A;  2ZY5 A;  3REH D;  5F99 D;  3MGS D;  5C3I B;  3WKJ C;  5B33 C;  1P3P C;  3X1T B;  2YFW A;  3AZE D;  3LZ0 D;  3FDD A;  1P3I D;  4DRA A;  5B0Y D;  4QLC A;  3AFA A;  1BH9 B;  1P34 A;  2F8N D;  3A6N A;  3AZF D;  5GSU A;  2NQB C;  3MGP C;  3AZG B;  2HIO A;  5AVC A;  1HQ3 C;  1EQZ B;  5E5A D;  1M1A D;  4J8W A;  2ARO C;  5FUG B;  4R8P D;  3AZK A;  1P3O B;  4J8V B;  3TU4 C;  4LD9 A;  3MVD C;  3KSY A;  2Y2J A;  1P3A C;  5GXQ B;  3AYW B;  3X1T D;  1AOI C;  3UT9 D;  2IO5 C;  4CAY B;  4H9R A;  5BO0 A;  4UUZ B;  4ZUX B;  2BYK A;  3EPK A;  4J8U D;  3AN2 D;  5B31 C;  1KX4 C;  5B40 B;  1M19 B;  5B0Z D;  1JFI B;  3REL C;  2Y2L A;  3AZH A;  5CPJ C;  1R4V A;  5CPI A;  1F66 C;  4YS3 C;  2Y2M A;  4G92 B;  1WWI A;  3B6F C;  2RIQ A;  3WTP D;  3WA9 C;  3LJA D;  5DNN B;  3WKJ A;  1ID3 A;  1P3P A;  3W98 C;  1P3F A;  4WU8 A;  2HUE C;  3NQU A;  3V9R B;  1KX3 C;  3X1V B;  1N1J B;  5B2I C;  3MGP A;  4ZUX D;  4H9N B;  5B40 D;  3KWQ B;  4JJN C;  1S32 B;  4NE5 A;  1P3L B;  1M19 D;  3REJ C;  4Z5T A;  2L5A A;  3UTA A;  3REI B;  3AZI C;  1P3M D;  1W2E A;  2LY8 A;  3KXB C;  3W97 C;  3KUY B;  5B31 G;  4NFT A;  4WU9 A;  4XZQ C;  5DNN D;  4XUJ C;  4QLC D;  1P3A A;  3A6N D;  3W99 B;  3EPJ A;  2PYO B;  2VQR A;  3B0C T;  5GSU D;  4KUD C;  3AZJ C;  5AY8 C;  2HIO D;  1KX4 A;  3REK B;  1U35 C;  4AWL C;  5CPJ A;  5BNV A;  5GT0 A;  1P3G D;  4J8W D;  3KWQ D;  3B6G C;  5AVB D;  3MGQ C;  4H9P B;  5B33 B;  5AV6 A;  3X1U C;  3AZK D;  5B1M A;  3B6F A;  3B0D B;  5GT3 A;  1ZLA A;  3A1I A;  3VH6 W;  2Y2H A;  3KUY D;  1M18 B;  4YM6 A;  5DNM A;  1KX3 A;  4HGA B;  3AZL A;  1KX5 A;  3H0L C;  1HQ3 B;  5AV8 B;  1HTA A;  5CPI D;  3REK D;  5CP6 B;  2ARO B;  2G5H C;  3AFA C;  1P34 C;  3REJ A;  5JRG B;  4Z66 C;  3AZI A;  3TU4 B;  5B1L A;  3UTB B;  3MVD B;  5B33 D;  3WKJ D;  1P3P D;  3LZ1 A;  5AV5 C;  1AOI B;  3O62 A;  4XZQ A;  5AV9 C;  3KFU G;  1P3B C;  2IO5 B;  5AVC C;  2ZY2 A;  3MGR C;  3REH B;  5F99 B;  3MGS B;  2FJ7 A;  3C1B A;  2NQB D;  1WWS A;  2XD5 A;  3MGP D;  3REL B;  4NE3 A;  3AZE B;  3LZ0 B;  3AZJ A;  1P3I B;  1F66 B;  4LD9 C;  3R45 A;  1HQ3 D;  2F8N B;  3WA9 B;  2ARO D;  3MGQ A;  3X1U A;  3W98 B;  3AZF B;  1T3U A;  3TU4 D;  3MVD D;  1P3A D;  1AOI D;  5BNX B;  3AZH C;  3LEL A;  5B2I B;  4R8P B;  3C1C A;  1KX4 D;  5B31 D;  3VH5 A;  4JJN B;  1ID3 C;  3REL D;  1P3F C;  1EQZ A;  4WU8 C;  5CPJ D;  1BH8 A;  3UT9 B;  1F66 D;  3KXB B;  4YS3 D;  1P3O A;  3W97 B;  3B6F D;  1TZY A;  4Z66 A;  3WA9 D;  4J8U B;  3AN2 B;  3AYW A;  2CV5 A;  3W98 D;  5AV5 A;  4EO5 C;  5B0Z B;  5AV9 A;  1P3B A;  2CWE A;  3MGR A;  1KX3 D;  3X1S A;  4KUD B;  4Z5T C;  3P5J B;  3UTA C;  3WTP B;  3LJA B;  1U35 B;  4AWL B;  3EG5 B;  5B2I D;  4WU9 C;  3B6G B;  4JJN D;  3AZN C;  3REJ D;  4ZBJ C;  3AZI D;  3KXB D;  3W97 D;  2DF4 C;  4WNN A;  5CPK A;  4XZQ D;  4XUJ D;  3AV2 C;  5JA4 A;  2XD1 A;  3AV1 C;  3W96 C;  4J8X A;  5GT0 C;  1P3M B;  5B24 C;  4CSR A;  5AV6 C;  3WAA C;  4KUD D;  5B1M C;  1F1E A;  4H9N A;  2YFW B;  5GT3 C;  4G91 B;  5AY8 D;  3AZJ D;  1P3L A;  1ZLA C;  1U35 D;  4QLC B;  1P34 B;  4YM6 C;  3B6G D;  2W8S A;  3A6N B;  1P3K A;  3MGQ D;  5DNM C;  3X1U D;  5GSU B;  3AZL C;  2HIO B;  5AVC B;  2Y2O A;  5G49 A;  1KX5 C;  3W99 A;  1P3G B;  3EPH A;  4J8W B;  5AVB B;  3B0C W;  4X23 C;  3MNN C;  2DQN C;  3AZK B;  5B1L C;  1TAF B;  3LZ1 C;  3O62 C;  3VH5 T;  4H9Q A;  3AFA D;  3AZN A;  4DRB A;  1P34 D;  5BO0 B;  4Z66 D;  2FJ7 C;  2BYK B;  2NZD A;  4KGC A;  3C1B C;  2Y2Q A;  2YFV A;  5AV5 D;  3AZH B;  5AV9 D;  3AZM A;  3AV2 A;  5B2J C;  5CPI B;  1P3B D;  5AVC D;  3MGR D;  3AV1 A;  3W96 A;  5B24 A;  3WKJ B;  1ID3 B;  1P3P B;  5AV8 A;  3WAA A;  4WU8 B;  4LD9 D;  3NQU B;  1H3O A;  4H9S C;  5B32 A;  3LEL C;  3AZG C;  4EO5 B;  2NQB B;  3MGP B;  3C1C C;  3REH A;  1ULY A;  2JSS A;  2Y2P A;  5F99 A;  1EQZ C;  3AZH D;  4Z5T B;  3UTA B;  4X23 A;  1P3O C;  3MNN A;  3LZ0 A;  3NQJ A;  1Z2C B;  4J8V C;  1TZY C;  4H9O B;  5B0Y A;  4DQY B;  3WTP E;  5GXQ C;  3AYW C;  2CV5 C;  1ID3 D;  1P3A B;  1P3F D;  2BYM A;  2Y2N A;  4KHA A;  4WU8 D;  2UWX A;  4ZBJ B;  1A7W A;  3AZF A;  3X1S C;  1KX4 B;  5B31 B;  5E5A A;  1M1A A;  5CPJ B;  5BS7 C;  5BNV B;  5GT0 B;  5B2J A;  2JCH A;  4YS3 B;  2FFF B;  5B1M B;  4Z5T D;  3B6F B;  3UTA D;  5GT3 B;  1ZLA B;  3X1T A;  3UT9 A;  5CPK C;  2HUE B;  4WU9 D;  4YM6 B;  1BH9 A;  3IP4 C;  3AZN D;  1BFM A;  1KX3 B;  3AL0 C;  3AN2 A;  4H9S A;  3X1V C;  4J8X C;  3AZL B;  5B0Z A;  3AZG A;  3AV2 D;  1S32 C;  1P3L C;  3EPL A;  3REI C;  3REJ B;  3AV1 D;  3W96 D;  5GT0 D;  3AZI B;  5B24 D;  5FUG A;  1P3K C;  5AV6 D;  3WAA D;  3LZ1 B;  5B1M D;  4J8V A;  5GT3 D;  3O62 B;  1ZLA D;  4XZQ B;  4XUJ B;  5GXQ A;  3W99 C;  4YM6 D;  4CAY A;  2PYO C;  2FJ7 B;  3A1K A;  5DNM D;  3C1B B;  4UUZ A;  4ZUX A;  3AZL D;  5B40 A;  3AZJ B;  3H0R C;  5AY8 B;  1M19 A;  1JFI A;  3R45 B;  1KX5 D;  1P3M A;  5KDM B;  5BS7 A;  4X23 D;  3MGQ B;  3MNN D;  3B0D C;  3X1U B;  5DNN A;  4M6B A;  1M18 C;  3H0M C;  5B1L D;  2NZD C;  4KGC C;  3F6T A;  3LZ1 D;  3O62 D;  3AZM C;  3V9R A;  3LEL B;  4HGA C;  3X1V A;  2RVQ C;  2G5I C;  5BT1 C;  2FJ7 D;  3C1C B;  1N1J A;  3C1B D;  5AV8 C;  1P3G A;  3KWQ A;  5CP6 C;  1BH8 B;  5AVB A;  5B2J D;  1S32 A;  2F8N H;  3AFA B;  5JRG C;  3REI A;  1TZY B;  3UTB C;  3KUY A;  4Z66 B;  1TAF A;  1Q9C A;  5B32 C;  2CV5 B;  5AV5 B;  3VH5 W;  5AV9 B;  3REH C;  1P3B B;  5F99 C;  3MGR B;  3MGS C;  3X1S B;  2PYO A;  3VH6 A;  4WV4 B;  3LEL D;  4E45 A;  3AZG D;  3AZE C;  2Y2I A;  3LZ0 C;  1P3I C;  3REK A;  5B0Y C;  3C1C D;  4LD9 B;  1EQZ D;  4H9P A;  5B33 A;  3AZF C;  1P3O D;  2BG1 A;  1B67 A;  4H9R B;  2ZY3 A;  4WNN B;  1TZY D;  4J8V D;  5CPK B;  1B6W A;  1M18 A;  5GXQ D;  3AYW D;  2CV5 D;  5JA4 B;  5E5A C;  1M1A C;  4J8X B;  2NQB A;  4R8P C;  4CSR B;  5B32 G;  3X1S D;  5C3I C;  2Y2K A;  3X1T C;  1HQ3 A;  3UT9 C;  1P3F B;  2Y2G A;  5CP6 A;  2ARO A;  1P3K B;  5JRG A;  4H9O A;  3TU4 A;  4J8U C;  3UTB A;  3MVD A;  3AN2 C;  4WZS B;  5B0Z C;  1AOI A;  5CPK D;  5G49 B;  2F8N G;  4UPK A;  2JE5 A;  3MGS A;  3WTP C;  4Z2M H;  3LJA C;  5B31 A;  4J8X D;  3X1V D;  2ZY4 A;  3REL A;  3AZE A;  1P3I A;  1F66 A;  4WU9 B;  1PZR A;  4YS3 A;  1S32 D;  1P3L D;  4H9Q B;  3AZN B;  2F8N A;  3REI D;  3WA9 A;  1P3K D;  3W98 A;  2NZD B;  4KGC B;  3B0B A;  2YFV B;  4ZUX C;  5B40 C;  3AZM B;  3AV2 B;  1M19 C;  5BNX A;  5CHL B;  3W99 D;  3AV1 B;  1KU5 A;  1P3M C;  2PYO D;  3W96 B;  2F2A C;  5B24 B;  4G92 C;  5B2I A;  4R8P A;  4WJ3 C;  5AV6 B;  3WAA B;  4G91 C;  5DNN C;  3VH6 T;  4JJN A;  4QLC C; 
#chains in the Genus database with same CATH homology
 4NE6 A;  1H3O B;  3A6N C;  3W97 A;  3KXB A;  5GSU C;  5B32 B;  5DNM B;  4XUJ A;  4J8U A;  2HIO C;  2J8P A;  1M18 D;  2NZD D;  4KGC D;  1P3G C;  1KX5 B;  4J8W C;  3KWQ C;  3AZM D;  5AVB C;  3AZK C;  4X23 B;  4KUD A;  3MNN B;  3WTP A;  3NQJ B;  5AY8 A;  2RVQ D;  3LJA A;  5BT1 D;  5B0Y B;  3KUY C;  1U35 A;  5B1L B;  5AV8 D;  5KDM A;  2F8N K;  2BYM B;  4KHA B;  3B6G A;  5CP6 D;  5JRG D;  4Z2M G;  3UTB D;  2ZM5 A;  5B32 D;  5E5A B;  5CPI C;  3REK C;  1M1A B;  5B2J B;  4E44 A;  2ZY5 A;  3REH D;  5F99 D;  3MGS D;  5C3I B;  3WKJ C;  5B33 C;  1P3P C;  3X1T B;  2YFW A;  3AZE D;  3LZ0 D;  3FDD A;  1P3I D;  4DRA A;  5B0Y D;  4QLC A;  3AFA A;  1BH9 B;  1P34 A;  2F8N D;  3A6N A;  3AZF D;  5GSU A;  2NQB C;  3MGP C;  3AZG B;  2HIO A;  5AVC A;  1HQ3 C;  1EQZ B;  5E5A D;  1M1A D;  4J8W A;  2ARO C;  5FUG B;  4R8P D;  3AZK A;  1P3O B;  4J8V B;  3TU4 C;  4LD9 A;  3MVD C;  3KSY A;  2Y2J A;  1P3A C;  5GXQ B;  3AYW B;  3X1T D;  1AOI C;  3UT9 D;  2IO5 C;  4CAY B;  4H9R A;  5BO0 A;  4UUZ B;  4ZUX B;  2BYK A;  3EPK A;  4J8U D;  3AN2 D;  5B31 C;  1KX4 C;  5B40 B;  1M19 B;  5B0Z D;  1JFI B;  3REL C;  2Y2L A;  3AZH A;  5CPJ C;  1R4V A;  5CPI A;  1F66 C;  4YS3 C;  2Y2M A;  4G92 B;  1WWI A;  3B6F C;  2RIQ A;  3WTP D;  3WA9 C;  3LJA D;  5DNN B;  3WKJ A;  1ID3 A;  1P3P A;  3W98 C;  1P3F A;  4WU8 A;  2HUE C;  3NQU A;  3V9R B;  1KX3 C;  3X1V B;  1N1J B;  5B2I C;  3MGP A;  4ZUX D;  4H9N B;  5B40 D;  3KWQ B;  4JJN C;  1S32 B;  4NE5 A;  1P3L B;  1M19 D;  3REJ C;  4Z5T A;  2L5A A;  3UTA A;  3REI B;  3AZI C;  1P3M D;  1W2E A;  2LY8 A;  3KXB C;  3W97 C;  3KUY B;  5B31 G;  4NFT A;  4WU9 A;  4XZQ C;  5DNN D;  4XUJ C;  4QLC D;  1P3A A;  3A6N D;  3W99 B;  3EPJ A;  2PYO B;  2VQR A;  3B0C T;  5GSU D;  4KUD C;  3AZJ C;  5AY8 C;  2HIO D;  1KX4 A;  3REK B;  1U35 C;  4AWL C;  5CPJ A;  5BNV A;  5GT0 A;  1P3G D;  4J8W D;  3KWQ D;  3B6G C;  5AVB D;  3MGQ C;  4H9P B;  5B33 B;  5AV6 A;  3X1U C;  3AZK D;  5B1M A;  3B6F A;  3B0D B;  5GT3 A;  1ZLA A;  3A1I A;  3VH6 W;  2Y2H A;  3KUY D;  1M18 B;  4YM6 A;  5DNM A;  1KX3 A;  4HGA B;  3AZL A;  1KX5 A;  3H0L C;  1HQ3 B;  5AV8 B;  1HTA A;  5CPI D;  3REK D;  5CP6 B;  2ARO B;  2G5H C;  3AFA C;  1P34 C;  3REJ A;  5JRG B;  4Z66 C;  3AZI A;  3TU4 B;  5B1L A;  3UTB B;  3MVD B;  5B33 D;  3WKJ D;  1P3P D;  3LZ1 A;  5AV5 C;  1AOI B;  3O62 A;  4XZQ A;  5AV9 C;  3KFU G;  1P3B C;  2IO5 B;  5AVC C;  2ZY2 A;  3MGR C;  3REH B;  5F99 B;  3MGS B;  2FJ7 A;  3C1B A;  2NQB D;  1WWS A;  2XD5 A;  3MGP D;  3REL B;  4NE3 A;  3AZE B;  3LZ0 B;  3AZJ A;  1P3I B;  1F66 B;  4LD9 C;  3R45 A;  1HQ3 D;  2F8N B;  3WA9 B;  2ARO D;  3MGQ A;  3X1U A;  3W98 B;  3AZF B;  1T3U A;  3TU4 D;  3MVD D;  1P3A D;  1AOI D;  5BNX B;  3AZH C;  3LEL A;  5B2I B;  4R8P B;  3C1C A;  1KX4 D;  5B31 D;  3VH5 A;  4JJN B;  1ID3 C;  3REL D;  1P3F C;  1EQZ A;  4WU8 C;  5CPJ D;  1BH8 A;  3UT9 B;  1F66 D;  3KXB B;  4YS3 D;  1P3O A;  3W97 B;  3B6F D;  1TZY A;  4Z66 A;  3WA9 D;  4J8U B;  3AN2 B;  3AYW A;  2CV5 A;  3W98 D;  5AV5 A;  4EO5 C;  5B0Z B;  5AV9 A;  1P3B A;  2CWE A;  3MGR A;  1KX3 D;  3X1S A;  4KUD B;  4Z5T C;  3P5J B;  3UTA C;  3WTP B;  3LJA B;  1U35 B;  4AWL B;  3EG5 B;  5B2I D;  4WU9 C;  3B6G B;  4JJN D;  3AZN C;  3REJ D;  4ZBJ C;  3AZI D;  3KXB D;  3W97 D;  2DF4 C;  4WNN A;  5CPK A;  4XZQ D;  4XUJ D;  3AV2 C;  5JA4 A;  2XD1 A;  3AV1 C;  3W96 C;  4J8X A;  5GT0 C;  1P3M B;  5B24 C;  4CSR A;  5AV6 C;  3WAA C;  4KUD D;  5B1M C;  1F1E A;  4H9N A;  2YFW B;  5GT3 C;  4G91 B;  5AY8 D;  3AZJ D;  1P3L A;  1ZLA C;  1U35 D;  4QLC B;  1P34 B;  4YM6 C;  3B6G D;  2W8S A;  3A6N B;  1P3K A;  3MGQ D;  5DNM C;  3X1U D;  5GSU B;  3AZL C;  2HIO B;  5AVC B;  2Y2O A;  5G49 A;  1KX5 C;  3W99 A;  1P3G B;  3EPH A;  4J8W B;  5AVB B;  3B0C W;  4X23 C;  3MNN C;  2DQN C;  3AZK B;  5B1L C;  1TAF B;  3LZ1 C;  3O62 C;  3VH5 T;  4H9Q A;  3AFA D;  3AZN A;  4DRB A;  1P34 D;  5BO0 B;  4Z66 D;  2FJ7 C;  2BYK B;  2NZD A;  4KGC A;  3C1B C;  2Y2Q A;  2YFV A;  5AV5 D;  3AZH B;  5AV9 D;  3AZM A;  3AV2 A;  5B2J C;  5CPI B;  1P3B D;  5AVC D;  3MGR D;  3AV1 A;  3W96 A;  5B24 A;  3WKJ B;  1ID3 B;  1P3P B;  5AV8 A;  3WAA A;  4WU8 B;  4LD9 D;  3NQU B;  1H3O A;  4H9S C;  5B32 A;  3LEL C;  3AZG C;  4EO5 B;  2NQB B;  3MGP B;  3C1C C;  3REH A;  1ULY A;  2JSS A;  2Y2P A;  5F99 A;  1EQZ C;  3AZH D;  4Z5T B;  3UTA B;  4X23 A;  1P3O C;  3MNN A;  3LZ0 A;  3NQJ A;  1Z2C B;  4J8V C;  1TZY C;  4H9O B;  5B0Y A;  4DQY B;  3WTP E;  5GXQ C;  3AYW C;  2CV5 C;  1ID3 D;  1P3A B;  1P3F D;  2BYM A;  2Y2N A;  4KHA A;  4WU8 D;  2UWX A;  4ZBJ B;  1A7W A;  3AZF A;  3X1S C;  1KX4 B;  5B31 B;  5E5A A;  1M1A A;  5CPJ B;  5BS7 C;  5BNV B;  5GT0 B;  5B2J A;  2JCH A;  4YS3 B;  2FFF B;  5B1M B;  4Z5T D;  3B6F B;  3UTA D;  5GT3 B;  1ZLA B;  3X1T A;  3UT9 A;  5CPK C;  2HUE B;  4WU9 D;  4YM6 B;  1BH9 A;  3IP4 C;  3AZN D;  1BFM A;  1KX3 B;  3AL0 C;  3AN2 A;  4H9S A;  3X1V C;  4J8X C;  3AZL B;  5B0Z A;  3AZG A;  3AV2 D;  1S32 C;  1P3L C;  3EPL A;  3REI C;  3REJ B;  3AV1 D;  3W96 D;  5GT0 D;  3AZI B;  5B24 D;  5FUG A;  1P3K C;  5AV6 D;  3WAA D;  3LZ1 B;  5B1M D;  4J8V A;  5GT3 D;  3O62 B;  1ZLA D;  4XZQ B;  4XUJ B;  5GXQ A;  3W99 C;  4YM6 D;  4CAY A;  2PYO C;  2FJ7 B;  3A1K A;  5DNM D;  3C1B B;  4UUZ A;  4ZUX A;  3AZL D;  5B40 A;  3AZJ B;  3H0R C;  5AY8 B;  1M19 A;  1JFI A;  3R45 B;  1KX5 D;  1P3M A;  5KDM B;  5BS7 A;  4X23 D;  3MGQ B;  3MNN D;  3B0D C;  3X1U B;  5DNN A;  4M6B A;  1M18 C;  3H0M C;  5B1L D;  2NZD C;  4KGC C;  3F6T A;  3LZ1 D;  3O62 D;  3AZM C;  3V9R A;  3LEL B;  4HGA C;  3X1V A;  2RVQ C;  2G5I C;  5BT1 C;  2FJ7 D;  3C1C B;  1N1J A;  3C1B D;  5AV8 C;  1P3G A;  3KWQ A;  5CP6 C;  1BH8 B;  5AVB A;  5B2J D;  1S32 A;  2F8N H;  3AFA B;  5JRG C;  3REI A;  1TZY B;  3UTB C;  3KUY A;  4Z66 B;  1TAF A;  1Q9C A;  5B32 C;  2CV5 B;  5AV5 B;  3VH5 W;  5AV9 B;  3REH C;  1P3B B;  5F99 C;  3MGR B;  3MGS C;  3X1S B;  2PYO A;  3VH6 A;  4WV4 B;  3LEL D;  4E45 A;  3AZG D;  3AZE C;  2Y2I A;  3LZ0 C;  1P3I C;  3REK A;  5B0Y C;  3C1C D;  4LD9 B;  1EQZ D;  4H9P A;  5B33 A;  3AZF C;  1P3O D;  2BG1 A;  1B67 A;  4H9R B;  2ZY3 A;  4WNN B;  1TZY D;  4J8V D;  5CPK B;  1B6W A;  1M18 A;  5GXQ D;  3AYW D;  2CV5 D;  5JA4 B;  5E5A C;  1M1A C;  4J8X B;  2NQB A;  4R8P C;  4CSR B;  5B32 G;  3X1S D;  5C3I C;  2Y2K A;  3X1T C;  1HQ3 A;  3UT9 C;  1P3F B;  2Y2G A;  5CP6 A;  2ARO A;  1P3K B;  5JRG A;  4H9O A;  3TU4 A;  4J8U C;  3UTB A;  3MVD A;  3AN2 C;  4WZS B;  5B0Z C;  1AOI A;  5CPK D;  5G49 B;  2F8N G;  4UPK A;  2JE5 A;  3MGS A;  3WTP C;  4Z2M H;  3LJA C;  5B31 A;  4J8X D;  3X1V D;  2ZY4 A;  3REL A;  3AZE A;  1P3I A;  1F66 A;  4WU9 B;  1PZR A;  4YS3 A;  1S32 D;  1P3L D;  4H9Q B;  3AZN B;  2F8N A;  3REI D;  3WA9 A;  1P3K D;  3W98 A;  2NZD B;  4KGC B;  3B0B A;  2YFV B;  4ZUX C;  5B40 C;  3AZM B;  3AV2 B;  1M19 C;  5BNX A;  5CHL B;  3W99 D;  3AV1 B;  1KU5 A;  1P3M C;  2PYO D;  3W96 B;  2F2A C;  5B24 B;  4G92 C;  5B2I A;  4R8P A;  4WJ3 C;  5AV6 B;  3WAA B;  4G91 C;  5DNN C;  3VH6 T;  4JJN A;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...