1B6WA

Crystal structure of the selenomethionine variant of histone hmfb from methanothermus fervidus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (HISTONE HMFB)
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
total genus 22
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1b6wA00
5B2JC 1BH9A 3C1BB 3KXBB 5CPJC 3X1SB 2BYKB 3AV2D 5B2IB 4CAYA 1TZYB 1P3IB 1AOIB 3W97C 2HIOC 3MGQB 2BYMA 3WAAA 4LD9B 3AZNB 2YFWB 3AZLB 1KX5A 2IO5B 5B2JA 5AV6A 5B1LA 3X1UD 4YM6A 5AVCA 3W97A 3B0DB 2HIOA 4YS3B 3NQJA 3AZGD 1P3LC 5AV8C 3WTPB 5F99D 5B33B 4Z5TB 4R8PB 1P3BC 1KX3B 5CP6B 4XZQC 3MVDB 3UTAA 5G49B 1ID3B 4UUZA 1KX5D 3AZEB 3UT9A 5B0YB 3V9RB 5JA4B 3AZMD 5AV6D 5B1LD 4YM6D 5AVCD 5B40C 3W96C 5E5AB 5BNXA 3MGRC 5AV8A 2PYOB 1ZLAD 5B1MA 2F8NK 3LZ0B 1KX4B 3W97D 3AYWA 2FJ7C 1P3OC 1P3FA 4XZQA 4KGCC 3C1CC 5CHLB 3UTAD 5CPKB 3C1BA 3UT9D 1EQZC 3W96A 3MGRA 3AZHC 1P3MB 2BYKA 4J8XB 3TU4C 3X1TC 1P3IA 5GT3D 1P3OA 5B1MD 3MGQA 3REKD 4KGCA 3AYWD 3C1CA 4LD9A 3AZNA 1P3FD 3KWQC 3VH6A 3AV1C 5AV9C 4WU8C 3AZHA 3REIB 4H9RA 4EO5C 3C1BD 3KXBD 4G92C 1BH9B 3MGRD 3X1SD 5DNNC 3WTPA 4Z5TA 1P3ID 4CAYB 1AOID 3MGQD 5CP6A 3KWQA 4G91C 1M18C 3AV1A 4LD9D 2BYMB 3AZND 4WU8A 1ID3A 3WAAB 3AZLD 4HGAC 1F66C 2NZDC 3AZKA 3V9RA 1KX5B 5B2JB 5AV5C 5B31C 4CSRB 4H9QA 5GSUA 2HIOB 4X23C 3W97B 5B33D 5B31G 3WTPD 3NQJB 4ZUXC 4Z5TD 3WTPE 1KX3D 3AZFC 5CP6D 1BFMA 1ID3D 4J8VC 4H9PA 3AZED 3MGSC 4UUZB 5B0YD 3AZKD 4KUDC 5B31A 2RVQC 1S32C 4NE5A 4ZUXA 5AV8B 3LJAC 3LZ0D 2YFVB 5GSUD 3AZFA 1P3BB 5JRGC 5CPIA 1ULYA 4XZQB 5AVBC 3X1VC 1JFIB 3MGSA 4ZBJC 3W98C 4H9NA 3REJC 5CPKD 1S32A 3AFAC 5BS7A 1P3MD 5BNVA 3MNNC 5B40B 3MGRB 3W96B 4J8XD 3REHC 5FUGA 3LJAA 3B6FC 4ZUXD 5JRGA 2FJ7B 1P3OB 3X1VA 4KGCB 3B0BA 5CPID 3AN2C 1HQ3C 3C1CB 5B24C 3REJA 3AFAA 1HTAA 3REID 5CPJA 3AZHB 4H9RB 3REHA 2RVQD 3B6FA 3TU4B 3X1TB 4CSRA 3LJAD 3KSYA 3WA9C 5B24A 3AZJC 1P3PC 3KWQB 3AV1B 5AV9B 3WAAD 4H9SC 4WU8B 3WKJC 3AFAD 4EO5B 5B2JD 3AZKB 4XUJC 5CPJD 5BT1C 4G92B 2F8NH 3AZIC 3REHD 3B6FD 1P3LA 5DNNB 3LELC 3WA9A 2YFVA 2HIOD 3R45B 1P3BA 4H9QB 5GSUB 4J8UC 4G91B 1M18B 4H9SA 3B0CT 1JFIA 4HGAB 1F66B 2NZDB 3LZ1C 3AZIA 4H9PB 5KDMA 5B40A 5B31B 1P3LD 5AV8D 2FJ7A 4X23B 4J8UA 4ZUXB 3VH6T 1P3BD 1Q9CA 4M6BA 3B6GC 5GT0C 3AZFB 5CPIB 1P3AC 4XZQD 1WWSA 1R4VA 5C3IC 4J8VB 1EQZA 3MGSB 4H9NB 3W99C 1S32B 3O62C 5B40D 3TU4A 1BH8A 5BNVB 3X1TA 3MGPC 3W96D 1P3GC 5FUGB 3LJAB 1WWIA 2FJ7D 3B6GA 5GT0A 5JRGB 1P3OD 4YS3C 1P3AA 4KGCD 5DNMC 4Z66C 5AVBB 3X1VB 3C1CD 5AV9A 4R8PC 2CWEA 4ZBJB 4Z2MH 3W98B 3REJB 4QLCC 3AFAB 3O62A 1EQZD 3AZHD 3MGPA 3MNNB 5CPJB 4KHAA 3REHB 5DNNA 3X1TD 3TU4D 3B6FB 3R45A 4AWLC 2NQBC 3A6NC 5DNMA 3B6GD 4Z66A 1M18A 3AN2B 1HQ3B 3RELC 5B0ZC 5B24B 3KWQD 3VH5W 1F66A 4J8WC 2NZDA 3AV1D 5AV9D 5GXQC 4WU8D 5AV5A 4JJNC 3MGPD 5B32C 4H9OA 3A6NA 5DNND 4X23A 1P3LB 5B32G 4WU9C 3WA9B 3AV2C 3RELA 5B0ZA 4J8WA 3AZJB 1P3PB 1M18D 5GXQA 2CV5C 4J8VA 1F66D 2NZDD 3WKJB 3KUYC 4KUDA 2F8NG 3AZIB 5AV5D 5KDMB 4DRAA 4WV4B 5B31D 3X1UC 1P34C 4WU9A 3AV2A 4X23D 2AROC 4J8UB 2CV5A 5AVBA 3AZGC 3AZFD 2F8NA 3W98A 1TAFA 5F99C 3KUYA 1M19C 4J8VD 1N1JA 3MGSD 2HUEC 3MNNA 1EQZB 4KUDD 1S32D 1P34A 3AZMC 4DRBA 1BH8B 5AV6C 2AROA 5B1LC 4YM6C 4WU9D 5AVCC 3AZGA 1A7WA 3NQUA 1U35C 5JRGD 3B6GB 1ZLAC 5GT0B 1HQ3A 5F99A 3AN2A 2CV5D 1P3AB 1M19A 5AVBD 3X1VD 2F8ND 3W98D 5C3IB 4WNNA 5AY8C 3KUYD 3REJD 3W99B 3MNND 4NE6A 3O62B 3AZMA 3MGPB 3UTAC 1P3GB 1P3KC 4KHAB 3UT9C 1P34D 1U35A 1ZLAA 2AROD 4WZSB 3AZJA 1P3PA 5DNMB 4Z66B 5GT3C 3AN2D 1HQ3D 5B1MC 5B24D 5AY8A 4Z2MG 3REKC 1M19D 3AYWC 3WKJA 1H3OA 3UTBC 4QLCB 4XUJA 1P3FC 4E45A 1M1AC 1P3KA 5AV5B 3LELA 3C1BC 4AWLB 2NQBB 3KXBC 4H9OB 3A6NB 3X1SC 1U35D 2JSSA 3WA9D 5GT3A 5B2IC 3REKA 3AZJD 1TZYC 3RELB 5B0ZB 1P3PD 1P3IC 1AOIC 4J8WB 3UTBA 3MGQC 5GXQB 5AY8D 3LZ1A 3WKJD 1M1AA 5BO0B 4LD9C 3AZNC 4XUJD 5BT1D 4JJNB 3AZLC 4KUDB 2IO5C 3AZID 1P3KD 1KU5A 5B32B 3KXBA 3LELD 3X1SA 4NFTA 5B2IA 3VH5T 4WU9B 3AV2B 1TZYA 4J8UD 1AOIA 3B0DC 2CV5B 4NE3A 3WTPC 3VH5A 5B33C 4Z5TC 2F8NB 3UTBD 1TAFB 1KX3C 2YFWA 3LZ1D 3KUYB 5CP6C 3AZLA 3W99A 1M1AD 1N1JB 1F1EA 3MVDC 1P3GA 1ID3C 3AZEC 3X1UB 3B0CW 5B0YC 3AZKC 1P34B 4YS3A 2AROB 5E5AC 5B2ID 2PYOC 1TZYD 5B33A 3NQUB 5GT0D 3AZGB 4R8PA 3LZ0C 1P3AD 1KX4C 5F99B 1KX3A 5GSUC 1M19B 4QLCA 3MVDA 4WNNB 2HUEB 5G49A 3VH6W 3AZEA 3W99D 5B0YA 3O62D 5JA4A 1P3GD 3AZMB 5CPKC 5AV6B 2NQBA 5B1LB 5E5AA 1P3MC 4YM6B 5AVCB 2PYOA 1U35B 4J8XC 3LZ0A 4YS3D 1KX4A 1ZLAB 5DNMD 4Z66D 2L5AA 4R8PD 5BO0A 5AY8B 4QLCD 1H3OB 5CPIC 4JJNA 3MVDD 4XUJB 5CPKA 5B32A 3UTAB 1B6WA 1P3KB 2LY8A 1P3MA 3REIC 3UT9B 3LELB 4J8XA 2NQBD 5BS7C 3A6ND 5E5AD 2PYOD 5BNXB 1KX4D 5GT3B 3RELD 5B1MB 5B0ZD 4E44A 3REKB 4J8WD 3AYWB 5GXQD 3UTBB 1B67A 1P3FB 3LZ1B 1M1AB 3WAAC 4JJND 3REIA 3X1UA 1KX5C 5B32D
chains in the Genus database with same CATH superfamily
5B2JC 1BH9A 3C1BB 3EPJA 3KXBB 5CPJC 3X1SB 3EPLA 2BYKB 3AV2D 5B2IB 4CAYA 1TZYB 1P3IB 1AOIB 3W97C 2HIOC 3MGQB 2BYMA 3WAAA 4LD9B 3AZNB 2YFWB 3AZLB 1KX5A 2IO5B 5B2JA 5AV6A 5B1LA 3X1UD 4YM6A 5AVCA 4UPKA 3W97A 2HIOA 3B0DB 4YS3B 3NQJA 3AZGD 1P3LC 5AV8C 3WTPB 5F99D 5B33B 4Z5TB 4R8PB 1P3BC 1KX3B 5CP6B 4XZQC 3MVDB 3UTAA 5G49B 1ID3B 4UUZA 1KX5D 3AZEB 3UT9A 5B0YB 3V9RB 5JA4B 2Y2PA 5AV6D 3AZMD 5B1LD 4YM6D 5AVCD 5B40C 3W96C 5E5AB 5BNXA 3MGRC 5AV8A 2PYOB 1ZLAD 5B1MA 2F8NK 3LZ0B 1KX4B 3W97D 3AYWA 2FJ7C 1P3OC 1P3FA 4XZQA 4KGCC 3C1CC 5CHLB 3UTAD 5CPKB 3C1BA 3UT9D 1EQZC 3W96A 3MGRA 3AZHC 1P3MB 2BYKA 3EG5B 4DQYB 4J8XB 3TU4C 3X1TC 1P3IA 5GT3D 3H0MC 1P3OA 5B1MD 3MGQA 3REKD 4KGCA 3AYWD 2Y2QA 3EPKA 3C1CA 4LD9A 3AZNA 1P3FD 3KWQC 3VH6A 3AV1C 5AV9C 4WU8C 3AZHA 1PZRA 3REIB 4H9RA 2JCHA 4EO5C 3C1BD 3KXBD 4G92C 1BH9B 3MGRD 3X1SD 5DNNC 3WTPA 4Z5TA 1P3ID 4CAYB 1AOID 3EPHA 3MGQD 5CP6A 3KWQA 4G91C 1M18C 3AV1A 4LD9D 2BYMB 3AZND 4WU8A 2JE5A 2Y2MA 3AZLD 1ID3A 4HGAC 3WAAB 1F66C 2NZDC 3AZKA 3V9RA 1KX5B 5B2JB 5AV5C 5B31C 4CSRB 4H9QA 5GSUA 2HIOB 4X23C 3W97B 5B33D 5B31G 4ZUXC 3NQJB 4Z5TD 3WTPD 2XD5A 3WTPE 1KX3D 3AZFC 5CP6D 1BFMA 1ID3D 4J8VC 4H9PA 3AZED 3MGSC 4UUZB 5B0YD 3AZKD 3IP4C 4KUDC 5B31A 2RVQC 2Y2IA 1S32C 4NE5A 4ZUXA 5AV8B 3LJAC 3LZ0D 2YFVB 5GSUD 3AZFA 1P3BB 5JRGC 5CPIA 1ULYA 4XZQB 5AVBC 3X1VC 1JFIB 3MGSA 4ZBJC 3W98C 4H9NA 3REJC 5CPKD 1S32A 3AFAC 5BS7A 1P3MD 5BNVA 3MNNC 5B40B 3MGRB 3H0RC 3W96B 4J8XD 3REHC 5FUGA 3LJAA 3B6FC 4ZUXD 5JRGA 2FJ7B 2DQNC 1P3OB 2DF4C 3X1VA 4KGCB 3B0BA 5CPID 3AN2C 1HQ3C 3C1CB 5B24C 3REJA 3AFAA 1HTAA 3REID 5CPJA 3AZHB 4H9RB 3REHA 2RVQD 3B6FA 3A1IA 3TU4B 3X1TB 4CSRA 3LJAD 3KSYA 3WA9C 5B24A 3AZJC 1P3PC 3KWQB 2Y2OA 5AV9B 3AV1B 3WAAD 4H9SC 4WU8B 3WKJC 3AFAD 4EO5B 5B2JD 3AZKB 4XUJC 5CPJD 5BT1C 4G92B 2F8NH 3AZIC 3REHD 3B6FD 1P3LA 5DNNB 3LELC 3WA9A 2YFVA 2HIOD 3R45B 3A1KA 1P3BA 4H9QB 5GSUB 3AL0C 2ZY4A 4J8UC 4G91B 1M18B 4H9SA 3B0CT 1JFIA 4HGAB 1F66B 2NZDB 3LZ1C 3AZIA 2ZM5A 4H9PB 5KDMA 5B40A 1Z2CB 5B31B 1P3LD 5AV8D 2FJ7A 4X23B 4J8UA 4ZUXB 3VH6T 1P3BD 1Q9CA 4M6BA 3B6GC 5GT0C 3AZFB 5CPIB 1P3AC 4XZQD 1WWSA 1R4VA 5C3IC 4J8VB 1EQZA 3MGSB 4H9NB 2Y2HA 3W99C 1S32B 3O62C 5B40D 3TU4A 1BH8A 5BNVB 3X1TA 3MGPC 3W96D 1P3GC 5FUGB 3LJAB 1WWIA 2FJ7D 3B6GA 5GT0A 5JRGB 1P3OD 4YS3C 1P3AA 4KGCD 5DNMC 4Z66C 5AVBB 3X1VB 3C1CD 5AV9A 4R8PC 2CWEA 4ZBJB 4Z2MH 3W98B 3REJB 2G5IC 4QLCC 3AFAB 3O62A 1EQZD 3AZHD 3MGPA 3MNNB 5CPJB 2Y2LA 4KHAA 2J8PA 3REHB 5DNNA 3X1TD 3TU4D 3B6FB 3R45A 4AWLC 2NQBC 3A6NC 4WJ3C 5DNMA 3B6GD 4Z66A 1M18A 3AN2B 1HQ3B 3RELC 5B0ZC 5B24B 3KWQD 3VH5W 1F66A 4J8WC 2NZDA 2Y2NA 3AV1D 5AV9D 5GXQC 4WU8D 5AV5A 4JJNC 3MGPD 2ZY5A 5B32C 4H9OA 3A6NA 5DNND 4X23A 1P3LB 5B32G 2ZY2A 3KFUG 4WU9C 3WA9B 3AV2C 3RELA 5B0ZA 4J8WA 3AZJB 1P3PB 1M18D 5GXQA 2CV5C 4J8VA 1F66D 2NZDD 3WKJB 3KUYC 4KUDA 2F2AC 2F8NG 2Y2GA 3AZIB 5AV5D 5KDMB 4DRAA 4WV4B 5B31D 3X1UC 1P34C 4WU9A 3AV2A 4X23D 2AROC 4J8UB 2CV5A 5AVBA 3AZGC 3AZFD 2F8NA 3W98A 1TAFA 5F99C 2FFFB 3KUYA 1M19C 4J8VD 1N1JA 3MGSD 2HUEC 3MNNA 1EQZB 4KUDD 1S32D 1P34A 3AZMC 3H0LC 1BH8B 5AV6C 4DRBA 2AROA 5B1LC 4YM6C 4WU9D 5AVCC 3AZGA 1A7WA 3NQUA 1U35C 5JRGD 3B6GB 1ZLAC 2XD1A 1HQ3A 5F99A 5GT0B 3AN2A 2CV5D 1P3AB 1M19A 5AVBD 3X1VD 2F8ND 3W98D 5C3IB 4WNNA 5AY8C 3KUYD 3REJD 2ZY3A 3W99B 3MNND 4NE6A 3O62B 3AZMA 3MGPB 3UTAC 1P3GB 1P3KC 4KHAB 3UT9C 1P34D 1U35A 1ZLAA 2AROD 4WZSB 3AZJA 1P3PA 3P5JB 5DNMB 4Z66B 2Y2KA 5GT3C 1HQ3D 3AN2D 5B1MC 5B24D 5AY8A 4Z2MG 3REKC 1M19D 3AYWC 3WKJA 1H3OA 3UTBC 4QLCB 4XUJA 1P3FC 4E45A 1M1AC 1P3KA 5AV5B 3LELA 1T3UA 3C1BC 4AWLB 2NQBB 3KXBC 4H9OB 3A6NB 3X1SC 1U35D 2JSSA 2W8SA 3WA9D 5GT3A 5B2IC 3REKA 3AZJD 1TZYC 3RELB 5B0ZB 1P3PD 1P3IC 1AOIC 4J8WB 3UTBA 3MGQC 5GXQB 5AY8D 3LZ1A 3WKJD 1M1AA 5BO0B 4LD9C 3AZNC 4XUJD 5BT1D 4JJNB 3AZLC 4KUDB 2IO5C 3AZID 1P3KD 1KU5A 5B32B 3KXBA 3LELD 3X1SA 4NFTA 5B2IA 3VH5T 4WU9B 3AV2B 1TZYA 4J8UD 1AOIA 3B0DC 2CV5B 4NE3A 3WTPC 3VH5A 5B33C 4Z5TC 2F8NB 3UTBD 1TAFB 1KX3C 2YFWA 3LZ1D 3KUYB 5CP6C 3AZLA 3FDDA 3W99A 1M1AD 1N1JB 1F1EA 3MVDC 1P3GA 1ID3C 3AZEC 2RIQA 3X1UB 3B0CW 5B0YC 3AZKC 1P34B 4YS3A 2AROB 5E5AC 5B2ID 2PYOC 1TZYD 5B33A 3NQUB 5GT0D 3AZGB 4R8PA 3LZ0C 1P3AD 1KX4C 5F99B 1KX3A 5GSUC 1M19B 4QLCA 3MVDA 4WNNB 2HUEB 5G49A 3VH6W 3AZEA 3W99D 5B0YA 3O62D 5JA4A 1W2EA 2VQRA 1P3GD 3AZMB 5CPKC 5AV6B 2NQBA 5B1LB 5E5AA 1P3MC 4YM6B 5AVCB 2PYOA 1U35B 4J8XC 3LZ0A 4YS3D 1KX4A 1ZLAB 5DNMD 4Z66D 2L5AA 2BG1A 4R8PD 2UWXA 5BO0A 5AY8B 4QLCD 1H3OB 5CPIC 4JJNA 3MVDD 4XUJB 5CPKA 5B32A 3UTAB 1B6WA 1P3KB 2LY8A 1P3MA 3REIC 3UT9B 3LELB 4J8XA 2NQBD 5BS7C 3A6ND 3F6TA 5E5AD 2PYOD 2Y2JA 5BNXB 1KX4D 5GT3B 3RELD 5B1MB 5B0ZD 4E44A 3REKB 4J8WD 3AYWB 5GXQD 3UTBB 1B67A 1P3FB 3LZ1B 1M1AB 2G5HC 3WAAC 4JJND 3REIA 3X1UA 1KX5C 5B32D
chains in the Genus database with same CATH topology
5B2JC 1BH9A 3C1BB 3EPJA 3KXBB 5CPJC 3X1SB 3EPLA 2BYKB 3AV2D 5B2IB 4CAYA 1TZYB 1P3IB 1AOIB 3W97C 2HIOC 3MGQB 2BYMA 3WAAA 4LD9B 3AZNB 2YFWB 3AZLB 1KX5A 2IO5B 5B2JA 5AV6A 5B1LA 3X1UD 4YM6A 5AVCA 4UPKA 3W97A 2HIOA 3B0DB 4YS3B 3NQJA 3AZGD 1P3LC 5AV8C 3WTPB 5F99D 5B33B 4Z5TB 4R8PB 1P3BC 1KX3B 5CP6B 4XZQC 3MVDB 3UTAA 5G49B 1ID3B 4UUZA 1KX5D 3AZEB 3UT9A 5B0YB 3V9RB 5JA4B 2Y2PA 5AV6D 3AZMD 5B1LD 4YM6D 5AVCD 5B40C 3W96C 5E5AB 5BNXA 3MGRC 5AV8A 2PYOB 1ZLAD 5B1MA 2F8NK 3LZ0B 1KX4B 3W97D 3AYWA 2FJ7C 1P3OC 1P3FA 4XZQA 4KGCC 3C1CC 5CHLB 3UTAD 5CPKB 3C1BA 3UT9D 1EQZC 3W96A 3MGRA 3AZHC 1P3MB 2BYKA 3EG5B 4DQYB 4J8XB 3TU4C 3X1TC 1P3IA 5GT3D 3H0MC 1P3OA 5B1MD 3MGQA 3REKD 4KGCA 3AYWD 2Y2QA 3EPKA 3C1CA 4LD9A 3AZNA 1P3FD 3KWQC 3VH6A 3AV1C 5AV9C 4WU8C 3AZHA 1PZRA 3REIB 4H9RA 2JCHA 4EO5C 3C1BD 3KXBD 4G92C 1BH9B 3MGRD 3X1SD 5DNNC 3WTPA 4Z5TA 1P3ID 4CAYB 1AOID 3EPHA 3MGQD 5CP6A 3KWQA 4G91C 1M18C 3AV1A 4LD9D 2BYMB 3AZND 4WU8A 2JE5A 2Y2MA 3AZLD 1ID3A 4HGAC 3WAAB 1F66C 2NZDC 3AZKA 3V9RA 1KX5B 5B2JB 5AV5C 5B31C 4CSRB 4H9QA 5GSUA 2HIOB 4X23C 3W97B 5B33D 5B31G 4ZUXC 3NQJB 4Z5TD 3WTPD 2XD5A 3WTPE 1KX3D 3AZFC 5CP6D 1BFMA 1ID3D 4J8VC 4H9PA 3AZED 3MGSC 4UUZB 5B0YD 3AZKD 3IP4C 4KUDC 5B31A 2RVQC 2Y2IA 1S32C 4NE5A 4ZUXA 5AV8B 3LJAC 3LZ0D 2YFVB 5GSUD 3AZFA 1P3BB 5JRGC 5CPIA 1ULYA 4XZQB 5AVBC 3X1VC 1JFIB 3MGSA 4ZBJC 3W98C 4H9NA 3REJC 5CPKD 1S32A 3AFAC 5BS7A 1P3MD 5BNVA 3MNNC 5B40B 3MGRB 3H0RC 3W96B 4J8XD 3REHC 5FUGA 3LJAA 3B6FC 4ZUXD 5JRGA 2FJ7B 2DQNC 1P3OB 2DF4C 3X1VA 4KGCB 3B0BA 5CPID 3AN2C 1HQ3C 3C1CB 5B24C 3REJA 3AFAA 1HTAA 3REID 5CPJA 3AZHB 4H9RB 3REHA 2RVQD 3B6FA 3A1IA 3TU4B 3X1TB 4CSRA 3LJAD 3KSYA 3WA9C 5B24A 3AZJC 1P3PC 3KWQB 2Y2OA 5AV9B 3AV1B 3WAAD 4H9SC 4WU8B 3WKJC 3AFAD 4EO5B 5B2JD 3AZKB 4XUJC 5CPJD 5BT1C 4G92B 2F8NH 3AZIC 3REHD 3B6FD 1P3LA 5DNNB 3LELC 3WA9A 2YFVA 2HIOD 3R45B 3A1KA 1P3BA 4H9QB 5GSUB 3AL0C 2ZY4A 4J8UC 4G91B 1M18B 4H9SA 3B0CT 1JFIA 4HGAB 1F66B 2NZDB 3LZ1C 3AZIA 2ZM5A 4H9PB 5KDMA 5B40A 1Z2CB 5B31B 1P3LD 5AV8D 2FJ7A 4X23B 4J8UA 4ZUXB 3VH6T 1P3BD 1Q9CA 4M6BA 3B6GC 5GT0C 3AZFB 5CPIB 1P3AC 4XZQD 1WWSA 1R4VA 5C3IC 4J8VB 1EQZA 3MGSB 4H9NB 2Y2HA 3W99C 1S32B 3O62C 5B40D 3TU4A 1BH8A 5BNVB 3X1TA 3MGPC 3W96D 1P3GC 5FUGB 3LJAB 1WWIA 2FJ7D 3B6GA 5GT0A 5JRGB 1P3OD 4YS3C 1P3AA 4KGCD 5DNMC 4Z66C 5AVBB 3X1VB 3C1CD 5AV9A 4R8PC 2CWEA 4ZBJB 4Z2MH 3W98B 3REJB 2G5IC 4QLCC 3AFAB 3O62A 1EQZD 3AZHD 3MGPA 3MNNB 5CPJB 2Y2LA 4KHAA 2J8PA 3REHB 5DNNA 3X1TD 3TU4D 3B6FB 3R45A 4AWLC 2NQBC 3A6NC 4WJ3C 5DNMA 3B6GD 4Z66A 1M18A 3AN2B 1HQ3B 3RELC 5B0ZC 5B24B 3KWQD 3VH5W 1F66A 4J8WC 2NZDA 2Y2NA 3AV1D 5AV9D 5GXQC 4WU8D 5AV5A 4JJNC 3MGPD 2ZY5A 5B32C 4H9OA 3A6NA 5DNND 4X23A 1P3LB 5B32G 2ZY2A 3KFUG 4WU9C 3WA9B 3AV2C 3RELA 5B0ZA 4J8WA 3AZJB 1P3PB 1M18D 5GXQA 2CV5C 4J8VA 1F66D 2NZDD 3WKJB 3KUYC 4KUDA 2F2AC 2F8NG 2Y2GA 3AZIB 5AV5D 5KDMB 4DRAA 4WV4B 5B31D 3X1UC 1P34C 4WU9A 3AV2A 4X23D 2AROC 4J8UB 2CV5A 5AVBA 3AZGC 3AZFD 2F8NA 3W98A 1TAFA 5F99C 2FFFB 3KUYA 1M19C 4J8VD 1N1JA 3MGSD 2HUEC 3MNNA 1EQZB 4KUDD 1S32D 1P34A 3AZMC 3H0LC 1BH8B 5AV6C 4DRBA 2AROA 5B1LC 4YM6C 4WU9D 5AVCC 3AZGA 1A7WA 3NQUA 1U35C 5JRGD 3B6GB 1ZLAC 2XD1A 1HQ3A 5F99A 5GT0B 3AN2A 2CV5D 1P3AB 1M19A 5AVBD 3X1VD 2F8ND 3W98D 5C3IB 4WNNA 5AY8C 3KUYD 3REJD 2ZY3A 3W99B 3MNND 4NE6A 3O62B 3AZMA 3MGPB 3UTAC 1P3GB 1P3KC 4KHAB 3UT9C 1P34D 1U35A 1ZLAA 2AROD 4WZSB 3AZJA 1P3PA 3P5JB 5DNMB 4Z66B 2Y2KA 5GT3C 1HQ3D 3AN2D 5B1MC 5B24D 5AY8A 4Z2MG 3REKC 1M19D 3AYWC 3WKJA 1H3OA 3UTBC 4QLCB 4XUJA 1P3FC 4E45A 1M1AC 1P3KA 5AV5B 3LELA 1T3UA 3C1BC 4AWLB 2NQBB 3KXBC 4H9OB 3A6NB 3X1SC 1U35D 2JSSA 2W8SA 3WA9D 5GT3A 5B2IC 3REKA 3AZJD 1TZYC 3RELB 5B0ZB 1P3PD 1P3IC 1AOIC 4J8WB 3UTBA 3MGQC 5GXQB 5AY8D 3LZ1A 3WKJD 1M1AA 5BO0B 4LD9C 3AZNC 4XUJD 5BT1D 4JJNB 3AZLC 4KUDB 2IO5C 3AZID 1P3KD 1KU5A 5B32B 3KXBA 3LELD 3X1SA 4NFTA 5B2IA 3VH5T 4WU9B 3AV2B 1TZYA 4J8UD 1AOIA 3B0DC 2CV5B 4NE3A 3WTPC 3VH5A 5B33C 4Z5TC 2F8NB 3UTBD 1TAFB 1KX3C 2YFWA 3LZ1D 3KUYB 5CP6C 3AZLA 3FDDA 3W99A 1M1AD 1N1JB 1F1EA 3MVDC 1P3GA 1ID3C 3AZEC 2RIQA 3X1UB 3B0CW 5B0YC 3AZKC 1P34B 4YS3A 2AROB 5E5AC 5B2ID 2PYOC 1TZYD 5B33A 3NQUB 5GT0D 3AZGB 4R8PA 3LZ0C 1P3AD 1KX4C 5F99B 1KX3A 5GSUC 1M19B 4QLCA 3MVDA 4WNNB 2HUEB 5G49A 3VH6W 3AZEA 3W99D 5B0YA 3O62D 5JA4A 1W2EA 2VQRA 1P3GD 3AZMB 5CPKC 5AV6B 2NQBA 5B1LB 5E5AA 1P3MC 4YM6B 5AVCB 2PYOA 1U35B 4J8XC 3LZ0A 4YS3D 1KX4A 1ZLAB 5DNMD 4Z66D 2L5AA 2BG1A 4R8PD 2UWXA 5BO0A 5AY8B 4QLCD 1H3OB 5CPIC 4JJNA 3MVDD 4XUJB 5CPKA 5B32A 3UTAB 1B6WA 1P3KB 2LY8A 1P3MA 3REIC 3UT9B 3LELB 4J8XA 2NQBD 5BS7C 3A6ND 3F6TA 5E5AD 2PYOD 2Y2JA 5BNXB 1KX4D 5GT3B 3RELD 5B1MB 5B0ZD 4E44A 3REKB 4J8WD 3AYWB 5GXQD 3UTBB 1B67A 1P3FB 3LZ1B 1M1AB 2G5HC 3WAAC 4JJND 3REIA 3X1UA 1KX5C 5B32D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J C;  1BH9 A;  3C1B B;  3KXB B;  5CPJ C;  3X1S B;  2BYK B;  3AV2 D;  5B2I B;  4CAY A;  1TZY B;  1P3I B;  1AOI B;  3W97 C;  2HIO C;  3MGQ B;  2BYM A;  3WAA A;  4LD9 B;  3AZN B;  2YFW B;  3AZL B;  1KX5 A;  2IO5 B;  5B2J A;  5AV6 A;  5B1L A;  3X1U D;  4YM6 A;  5AVC A;  3W97 A;  3B0D B;  2HIO A;  4YS3 B;  3NQJ A;  3AZG D;  1P3L C;  5AV8 C;  3WTP B;  5F99 D;  5B33 B;  4Z5T B;  4R8P B;  1P3B C;  1KX3 B;  5CP6 B;  4XZQ C;  3MVD B;  3UTA A;  5G49 B;  1ID3 B;  4UUZ A;  1KX5 D;  3AZE B;  3UT9 A;  5B0Y B;  3V9R B;  5JA4 B;  3AZM D;  5AV6 D;  5B1L D;  4YM6 D;  5AVC D;  5B40 C;  3W96 C;  5E5A B;  5BNX A;  3MGR C;  5AV8 A;  2PYO B;  1ZLA D;  5B1M A;  2F8N K;  3LZ0 B;  1KX4 B;  3W97 D;  3AYW A;  2FJ7 C;  1P3O C;  1P3F A;  4XZQ A;  4KGC C;  3C1C C;  5CHL B;  3UTA D;  5CPK B;  3C1B A;  3UT9 D;  1EQZ C;  3W96 A;  3MGR A;  3AZH C;  1P3M B;  2BYK A;  4J8X B;  3TU4 C;  3X1T C;  1P3I A;  5GT3 D;  1P3O A;  5B1M D;  3MGQ A;  3REK D;  4KGC A;  3AYW D;  3C1C A;  4LD9 A;  3AZN A;  1P3F D;  3KWQ C;  3VH6 A;  3AV1 C;  5AV9 C;  4WU8 C;  3AZH A;  3REI B;  4H9R A;  4EO5 C;  3C1B D;  3KXB D;  4G92 C;  1BH9 B;  3MGR D;  3X1S D;  5DNN C;  3WTP A;  4Z5T A;  1P3I D;  4CAY B;  1AOI D;  3MGQ D;  5CP6 A;  3KWQ A;  4G91 C;  1M18 C;  3AV1 A;  4LD9 D;  2BYM B;  3AZN D;  4WU8 A;  1ID3 A;  3WAA B;  3AZL D;  4HGA C;  1F66 C;  2NZD C;  3AZK A;  3V9R A;  1KX5 B;  5B2J B;  5AV5 C;  5B31 C;  4CSR B;  4H9Q A;  5GSU A;  2HIO B;  4X23 C;  3W97 B;  5B33 D;  5B31 G;  3WTP D;  3NQJ B;  4ZUX C;  4Z5T D;  3WTP E;  1KX3 D;  3AZF C;  5CP6 D;  1BFM A;  1ID3 D;  4J8V C;  4H9P A;  3AZE D;  3MGS C;  4UUZ B;  5B0Y D;  3AZK D;  4KUD C;  5B31 A;  2RVQ C;  1S32 C;  4NE5 A;  4ZUX A;  5AV8 B;  3LJA C;  3LZ0 D;  2YFV B;  5GSU D;  3AZF A;  1P3B B;  5JRG C;  5CPI A;  1ULY A;  4XZQ B;  5AVB C;  3X1V C;  1JFI B;  3MGS A;  4ZBJ C;  3W98 C;  4H9N A;  3REJ C;  5CPK D;  1S32 A;  3AFA C;  5BS7 A;  1P3M D;  5BNV A;  3MNN C;  5B40 B;  3MGR B;  3W96 B;  4J8X D;  3REH C;  5FUG A;  3LJA A;  3B6F C;  4ZUX D;  5JRG A;  2FJ7 B;  1P3O B;  3X1V A;  4KGC B;  3B0B A;  5CPI D;  3AN2 C;  1HQ3 C;  3C1C B;  5B24 C;  3REJ A;  3AFA A;  1HTA A;  3REI D;  5CPJ A;  3AZH B;  4H9R B;  3REH A;  2RVQ D;  3B6F A;  3TU4 B;  3X1T B;  4CSR A;  3LJA D;  3KSY A;  3WA9 C;  5B24 A;  3AZJ C;  1P3P C;  3KWQ B;  3AV1 B;  5AV9 B;  3WAA D;  4H9S C;  4WU8 B;  3WKJ C;  3AFA D;  4EO5 B;  5B2J D;  3AZK B;  4XUJ C;  5CPJ D;  5BT1 C;  4G92 B;  2F8N H;  3AZI C;  3REH D;  3B6F D;  1P3L A;  5DNN B;  3LEL C;  3WA9 A;  2YFV A;  2HIO D;  3R45 B;  1P3B A;  4H9Q B;  5GSU B;  4J8U C;  4G91 B;  1M18 B;  4H9S A;  3B0C T;  1JFI A;  4HGA B;  1F66 B;  2NZD B;  3LZ1 C;  3AZI A;  4H9P B;  5KDM A;  5B40 A;  5B31 B;  1P3L D;  5AV8 D;  2FJ7 A;  4X23 B;  4J8U A;  4ZUX B;  3VH6 T;  1P3B D;  1Q9C A;  4M6B A;  3B6G C;  5GT0 C;  3AZF B;  5CPI B;  1P3A C;  4XZQ D;  1WWS A;  1R4V A;  5C3I C;  4J8V B;  1EQZ A;  3MGS B;  4H9N B;  3W99 C;  1S32 B;  3O62 C;  5B40 D;  3TU4 A;  1BH8 A;  5BNV B;  3X1T A;  3MGP C;  3W96 D;  1P3G C;  5FUG B;  3LJA B;  1WWI A;  2FJ7 D;  3B6G A;  5GT0 A;  5JRG B;  1P3O D;  4YS3 C;  1P3A A;  4KGC D;  5DNM C;  4Z66 C;  5AVB B;  3X1V B;  3C1C D;  5AV9 A;  4R8P C;  2CWE A;  4ZBJ B;  4Z2M H;  3W98 B;  3REJ B;  4QLC C;  3AFA B;  3O62 A;  1EQZ D;  3AZH D;  3MGP A;  3MNN B;  5CPJ B;  4KHA A;  3REH B;  5DNN A;  3X1T D;  3TU4 D;  3B6F B;  3R45 A;  4AWL C;  2NQB C;  3A6N C;  5DNM A;  3B6G D;  4Z66 A;  1M18 A;  3AN2 B;  1HQ3 B;  3REL C;  5B0Z C;  5B24 B;  3KWQ D;  3VH5 W;  1F66 A;  4J8W C;  2NZD A;  3AV1 D;  5AV9 D;  5GXQ C;  4WU8 D;  5AV5 A;  4JJN C;  3MGP D;  5B32 C;  4H9O A;  3A6N A;  5DNN D;  4X23 A;  1P3L B;  5B32 G;  4WU9 C;  3WA9 B;  3AV2 C;  3REL A;  5B0Z A;  4J8W A;  3AZJ B;  1P3P B;  1M18 D;  5GXQ A;  2CV5 C;  4J8V A;  1F66 D;  2NZD D;  3WKJ B;  3KUY C;  4KUD A;  2F8N G;  3AZI B;  5AV5 D;  5KDM B;  4DRA A;  4WV4 B;  5B31 D;  3X1U C;  1P34 C;  4WU9 A;  3AV2 A;  4X23 D;  2ARO C;  4J8U B;  2CV5 A;  5AVB A;  3AZG C;  3AZF D;  2F8N A;  3W98 A;  1TAF A;  5F99 C;  3KUY A;  1M19 C;  4J8V D;  1N1J A;  3MGS D;  2HUE C;  3MNN A;  1EQZ B;  4KUD D;  1S32 D;  1P34 A;  3AZM C;  4DRB A;  1BH8 B;  5AV6 C;  2ARO A;  5B1L C;  4YM6 C;  4WU9 D;  5AVC C;  3AZG A;  1A7W A;  3NQU A;  1U35 C;  5JRG D;  3B6G B;  1ZLA C;  5GT0 B;  1HQ3 A;  5F99 A;  3AN2 A;  2CV5 D;  1P3A B;  1M19 A;  5AVB D;  3X1V D;  2F8N D;  3W98 D;  5C3I B;  4WNN A;  5AY8 C;  3KUY D;  3REJ D;  3W99 B;  3MNN D;  4NE6 A;  3O62 B;  3AZM A;  3MGP B;  3UTA C;  1P3G B;  1P3K C;  4KHA B;  3UT9 C;  1P34 D;  1U35 A;  1ZLA A;  2ARO D;  4WZS B;  3AZJ A;  1P3P A;  5DNM B;  4Z66 B;  5GT3 C;  3AN2 D;  1HQ3 D;  5B1M C;  5B24 D;  5AY8 A;  4Z2M G;  3REK C;  1M19 D;  3AYW C;  3WKJ A;  1H3O A;  3UTB C;  4QLC B;  4XUJ A;  1P3F C;  4E45 A;  1M1A C;  1P3K A;  5AV5 B;  3LEL A;  3C1B C;  4AWL B;  2NQB B;  3KXB C;  4H9O B;  3A6N B;  3X1S C;  1U35 D;  2JSS A;  3WA9 D;  5GT3 A;  5B2I C;  3REK A;  3AZJ D;  1TZY C;  3REL B;  5B0Z B;  1P3P D;  1P3I C;  1AOI C;  4J8W B;  3UTB A;  3MGQ C;  5GXQ B;  5AY8 D;  3LZ1 A;  3WKJ D;  1M1A A;  5BO0 B;  4LD9 C;  3AZN C;  4XUJ D;  5BT1 D;  4JJN B;  3AZL C;  4KUD B;  2IO5 C;  3AZI D;  1P3K D;  1KU5 A;  5B32 B;  3KXB A;  3LEL D;  3X1S A;  4NFT A;  5B2I A;  3VH5 T;  4WU9 B;  3AV2 B;  1TZY A;  4J8U D;  1AOI A;  3B0D C;  2CV5 B;  4NE3 A;  3WTP C;  3VH5 A;  5B33 C;  4Z5T C;  2F8N B;  3UTB D;  1TAF B;  1KX3 C;  2YFW A;  3LZ1 D;  3KUY B;  5CP6 C;  3AZL A;  3W99 A;  1M1A D;  1N1J B;  1F1E A;  3MVD C;  1P3G A;  1ID3 C;  3AZE C;  3X1U B;  3B0C W;  5B0Y C;  3AZK C;  1P34 B;  4YS3 A;  2ARO B;  5E5A C;  5B2I D;  2PYO C;  1TZY D;  5B33 A;  3NQU B;  5GT0 D;  3AZG B;  4R8P A;  3LZ0 C;  1P3A D;  1KX4 C;  5F99 B;  1KX3 A;  5GSU C;  1M19 B;  4QLC A;  3MVD A;  4WNN B;  2HUE B;  5G49 A;  3VH6 W;  3AZE A;  3W99 D;  5B0Y A;  3O62 D;  5JA4 A;  1P3G D;  3AZM B;  5CPK C;  5AV6 B;  2NQB A;  5B1L B;  5E5A A;  1P3M C;  4YM6 B;  5AVC B;  2PYO A;  1U35 B;  4J8X C;  3LZ0 A;  4YS3 D;  1KX4 A;  1ZLA B;  5DNM D;  4Z66 D;  2L5A A;  4R8P D;  5BO0 A;  5AY8 B;  4QLC D;  1H3O B;  5CPI C;  4JJN A;  3MVD D;  4XUJ B;  5CPK A;  5B32 A;  3UTA B;  1B6W A;  1P3K B;  2LY8 A;  1P3M A;  3REI C;  3UT9 B;  3LEL B;  4J8X A;  2NQB D;  5BS7 C;  3A6N D;  5E5A D;  2PYO D;  5BNX B;  1KX4 D;  5GT3 B;  3REL D;  5B1M B;  5B0Z D;  4E44 A;  3REK B;  4J8W D;  3AYW B;  5GXQ D;  3UTB B;  1B67 A;  1P3F B;  3LZ1 B;  1M1A B;  3WAA C;  4JJN D;  3REI A;  3X1U A;  1KX5 C;  5B32 D; 
#chains in the Genus database with same CATH topology
 5B2J C;  1BH9 A;  3C1B B;  3EPJ A;  3KXB B;  5CPJ C;  3X1S B;  3EPL A;  2BYK B;  3AV2 D;  5B2I B;  4CAY A;  1TZY B;  1P3I B;  1AOI B;  3W97 C;  2HIO C;  3MGQ B;  2BYM A;  3WAA A;  4LD9 B;  3AZN B;  2YFW B;  3AZL B;  1KX5 A;  2IO5 B;  5B2J A;  5AV6 A;  5B1L A;  3X1U D;  4YM6 A;  5AVC A;  4UPK A;  3W97 A;  2HIO A;  3B0D B;  4YS3 B;  3NQJ A;  3AZG D;  1P3L C;  5AV8 C;  3WTP B;  5F99 D;  5B33 B;  4Z5T B;  4R8P B;  1P3B C;  1KX3 B;  5CP6 B;  4XZQ C;  3MVD B;  3UTA A;  5G49 B;  1ID3 B;  4UUZ A;  1KX5 D;  3AZE B;  3UT9 A;  5B0Y B;  3V9R B;  5JA4 B;  2Y2P A;  5AV6 D;  3AZM D;  5B1L D;  4YM6 D;  5AVC D;  5B40 C;  3W96 C;  5E5A B;  5BNX A;  3MGR C;  5AV8 A;  2PYO B;  1ZLA D;  5B1M A;  2F8N K;  3LZ0 B;  1KX4 B;  3W97 D;  3AYW A;  2FJ7 C;  1P3O C;  1P3F A;  4XZQ A;  4KGC C;  3C1C C;  5CHL B;  3UTA D;  5CPK B;  3C1B A;  3UT9 D;  1EQZ C;  3W96 A;  3MGR A;  3AZH C;  1P3M B;  2BYK A;  3EG5 B;  4DQY B;  4J8X B;  3TU4 C;  3X1T C;  1P3I A;  5GT3 D;  3H0M C;  1P3O A;  5B1M D;  3MGQ A;  3REK D;  4KGC A;  3AYW D;  2Y2Q A;  3EPK A;  3C1C A;  4LD9 A;  3AZN A;  1P3F D;  3KWQ C;  3VH6 A;  3AV1 C;  5AV9 C;  4WU8 C;  3AZH A;  1PZR A;  3REI B;  4H9R A;  2JCH A;  4EO5 C;  3C1B D;  3KXB D;  4G92 C;  1BH9 B;  3MGR D;  3X1S D;  5DNN C;  3WTP A;  4Z5T A;  1P3I D;  4CAY B;  1AOI D;  3EPH A;  3MGQ D;  5CP6 A;  3KWQ A;  4G91 C;  1M18 C;  3AV1 A;  4LD9 D;  2BYM B;  3AZN D;  4WU8 A;  2JE5 A;  2Y2M A;  3AZL D;  1ID3 A;  4HGA C;  3WAA B;  1F66 C;  2NZD C;  3AZK A;  3V9R A;  1KX5 B;  5B2J B;  5AV5 C;  5B31 C;  4CSR B;  4H9Q A;  5GSU A;  2HIO B;  4X23 C;  3W97 B;  5B33 D;  5B31 G;  4ZUX C;  3NQJ B;  4Z5T D;  3WTP D;  2XD5 A;  3WTP E;  1KX3 D;  3AZF C;  5CP6 D;  1BFM A;  1ID3 D;  4J8V C;  4H9P A;  3AZE D;  3MGS C;  4UUZ B;  5B0Y D;  3AZK D;  3IP4 C;  4KUD C;  5B31 A;  2RVQ C;  2Y2I A;  1S32 C;  4NE5 A;  4ZUX A;  5AV8 B;  3LJA C;  3LZ0 D;  2YFV B;  5GSU D;  3AZF A;  1P3B B;  5JRG C;  5CPI A;  1ULY A;  4XZQ B;  5AVB C;  3X1V C;  1JFI B;  3MGS A;  4ZBJ C;  3W98 C;  4H9N A;  3REJ C;  5CPK D;  1S32 A;  3AFA C;  5BS7 A;  1P3M D;  5BNV A;  3MNN C;  5B40 B;  3MGR B;  3H0R C;  3W96 B;  4J8X D;  3REH C;  5FUG A;  3LJA A;  3B6F C;  4ZUX D;  5JRG A;  2FJ7 B;  2DQN C;  1P3O B;  2DF4 C;  3X1V A;  4KGC B;  3B0B A;  5CPI D;  3AN2 C;  1HQ3 C;  3C1C B;  5B24 C;  3REJ A;  3AFA A;  1HTA A;  3REI D;  5CPJ A;  3AZH B;  4H9R B;  3REH A;  2RVQ D;  3B6F A;  3A1I A;  3TU4 B;  3X1T B;  4CSR A;  3LJA D;  3KSY A;  3WA9 C;  5B24 A;  3AZJ C;  1P3P C;  3KWQ B;  2Y2O A;  5AV9 B;  3AV1 B;  3WAA D;  4H9S C;  4WU8 B;  3WKJ C;  3AFA D;  4EO5 B;  5B2J D;  3AZK B;  4XUJ C;  5CPJ D;  5BT1 C;  4G92 B;  2F8N H;  3AZI C;  3REH D;  3B6F D;  1P3L A;  5DNN B;  3LEL C;  3WA9 A;  2YFV A;  2HIO D;  3R45 B;  3A1K A;  1P3B A;  4H9Q B;  5GSU B;  3AL0 C;  2ZY4 A;  4J8U C;  4G91 B;  1M18 B;  4H9S A;  3B0C T;  1JFI A;  4HGA B;  1F66 B;  2NZD B;  3LZ1 C;  3AZI A;  2ZM5 A;  4H9P B;  5KDM A;  5B40 A;  1Z2C B;  5B31 B;  1P3L D;  5AV8 D;  2FJ7 A;  4X23 B;  4J8U A;  4ZUX B;  3VH6 T;  1P3B D;  1Q9C A;  4M6B A;  3B6G C;  5GT0 C;  3AZF B;  5CPI B;  1P3A C;  4XZQ D;  1WWS A;  1R4V A;  5C3I C;  4J8V B;  1EQZ A;  3MGS B;  4H9N B;  2Y2H A;  3W99 C;  1S32 B;  3O62 C;  5B40 D;  3TU4 A;  1BH8 A;  5BNV B;  3X1T A;  3MGP C;  3W96 D;  1P3G C;  5FUG B;  3LJA B;  1WWI A;  2FJ7 D;  3B6G A;  5GT0 A;  5JRG B;  1P3O D;  4YS3 C;  1P3A A;  4KGC D;  5DNM C;  4Z66 C;  5AVB B;  3X1V B;  3C1C D;  5AV9 A;  4R8P C;  2CWE A;  4ZBJ B;  4Z2M H;  3W98 B;  3REJ B;  2G5I C;  4QLC C;  3AFA B;  3O62 A;  1EQZ D;  3AZH D;  3MGP A;  3MNN B;  5CPJ B;  2Y2L A;  4KHA A;  2J8P A;  3REH B;  5DNN A;  3X1T D;  3TU4 D;  3B6F B;  3R45 A;  4AWL C;  2NQB C;  3A6N C;  4WJ3 C;  5DNM A;  3B6G D;  4Z66 A;  1M18 A;  3AN2 B;  1HQ3 B;  3REL C;  5B0Z C;  5B24 B;  3KWQ D;  3VH5 W;  1F66 A;  4J8W C;  2NZD A;  2Y2N A;  3AV1 D;  5AV9 D;  5GXQ C;  4WU8 D;  5AV5 A;  4JJN C;  3MGP D;  2ZY5 A;  5B32 C;  4H9O A;  3A6N A;  5DNN D;  4X23 A;  1P3L B;  5B32 G;  2ZY2 A;  3KFU G;  4WU9 C;  3WA9 B;  3AV2 C;  3REL A;  5B0Z A;  4J8W A;  3AZJ B;  1P3P B;  1M18 D;  5GXQ A;  2CV5 C;  4J8V A;  1F66 D;  2NZD D;  3WKJ B;  3KUY C;  4KUD A;  2F2A C;  2F8N G;  2Y2G A;  3AZI B;  5AV5 D;  5KDM B;  4DRA A;  4WV4 B;  5B31 D;  3X1U C;  1P34 C;  4WU9 A;  3AV2 A;  4X23 D;  2ARO C;  4J8U B;  2CV5 A;  5AVB A;  3AZG C;  3AZF D;  2F8N A;  3W98 A;  1TAF A;  5F99 C;  2FFF B;  3KUY A;  1M19 C;  4J8V D;  1N1J A;  3MGS D;  2HUE C;  3MNN A;  1EQZ B;  4KUD D;  1S32 D;  1P34 A;  3AZM C;  3H0L C;  1BH8 B;  5AV6 C;  4DRB A;  2ARO A;  5B1L C;  4YM6 C;  4WU9 D;  5AVC C;  3AZG A;  1A7W A;  3NQU A;  1U35 C;  5JRG D;  3B6G B;  1ZLA C;  2XD1 A;  1HQ3 A;  5F99 A;  5GT0 B;  3AN2 A;  2CV5 D;  1P3A B;  1M19 A;  5AVB D;  3X1V D;  2F8N D;  3W98 D;  5C3I B;  4WNN A;  5AY8 C;  3KUY D;  3REJ D;  2ZY3 A;  3W99 B;  3MNN D;  4NE6 A;  3O62 B;  3AZM A;  3MGP B;  3UTA C;  1P3G B;  1P3K C;  4KHA B;  3UT9 C;  1P34 D;  1U35 A;  1ZLA A;  2ARO D;  4WZS B;  3AZJ A;  1P3P A;  3P5J B;  5DNM B;  4Z66 B;  2Y2K A;  5GT3 C;  1HQ3 D;  3AN2 D;  5B1M C;  5B24 D;  5AY8 A;  4Z2M G;  3REK C;  1M19 D;  3AYW C;  3WKJ A;  1H3O A;  3UTB C;  4QLC B;  4XUJ A;  1P3F C;  4E45 A;  1M1A C;  1P3K A;  5AV5 B;  3LEL A;  1T3U A;  3C1B C;  4AWL B;  2NQB B;  3KXB C;  4H9O B;  3A6N B;  3X1S C;  1U35 D;  2JSS A;  2W8S A;  3WA9 D;  5GT3 A;  5B2I C;  3REK A;  3AZJ D;  1TZY C;  3REL B;  5B0Z B;  1P3P D;  1P3I C;  1AOI C;  4J8W B;  3UTB A;  3MGQ C;  5GXQ B;  5AY8 D;  3LZ1 A;  3WKJ D;  1M1A A;  5BO0 B;  4LD9 C;  3AZN C;  4XUJ D;  5BT1 D;  4JJN B;  3AZL C;  4KUD B;  2IO5 C;  3AZI D;  1P3K D;  1KU5 A;  5B32 B;  3KXB A;  3LEL D;  3X1S A;  4NFT A;  5B2I A;  3VH5 T;  4WU9 B;  3AV2 B;  1TZY A;  4J8U D;  1AOI A;  3B0D C;  2CV5 B;  4NE3 A;  3WTP C;  3VH5 A;  5B33 C;  4Z5T C;  2F8N B;  3UTB D;  1TAF B;  1KX3 C;  2YFW A;  3LZ1 D;  3KUY B;  5CP6 C;  3AZL A;  3FDD A;  3W99 A;  1M1A D;  1N1J B;  1F1E A;  3MVD C;  1P3G A;  1ID3 C;  3AZE C;  2RIQ A;  3X1U B;  3B0C W;  5B0Y C;  3AZK C;  1P34 B;  4YS3 A;  2ARO B;  5E5A C;  5B2I D;  2PYO C;  1TZY D;  5B33 A;  3NQU B;  5GT0 D;  3AZG B;  4R8P A;  3LZ0 C;  1P3A D;  1KX4 C;  5F99 B;  1KX3 A;  5GSU C;  1M19 B;  4QLC A;  3MVD A;  4WNN B;  2HUE B;  5G49 A;  3VH6 W;  3AZE A;  3W99 D;  5B0Y A;  3O62 D;  5JA4 A;  1W2E A;  2VQR A;  1P3G D;  3AZM B;  5CPK C;  5AV6 B;  2NQB A;  5B1L B;  5E5A A;  1P3M C;  4YM6 B;  5AVC B;  2PYO A;  1U35 B;  4J8X C;  3LZ0 A;  4YS3 D;  1KX4 A;  1ZLA B;  5DNM D;  4Z66 D;  2L5A A;  2BG1 A;  4R8P D;  2UWX A;  5BO0 A;  5AY8 B;  4QLC D;  1H3O B;  5CPI C;  4JJN A;  3MVD D;  4XUJ B;  5CPK A;  5B32 A;  3UTA B;  1B6W A;  1P3K B;  2LY8 A;  1P3M A;  3REI C;  3UT9 B;  3LEL B;  4J8X A;  2NQB D;  5BS7 C;  3A6N D;  3F6T A;  5E5A D;  2PYO D;  2Y2J A;  5BNX B;  1KX4 D;  5GT3 B;  3REL D;  5B1M B;  5B0Z D;  4E44 A;  3REK B;  4J8W D;  3AYW B;  5GXQ D;  3UTB B;  1B67 A;  1P3F B;  3LZ1 B;  1M1A B;  2G5H C;  3WAA C;  4JJN D;  3REI A;  3X1U A;  1KX5 C;  5B32 D; 
#chains in the Genus database with same CATH homology
 5B2J C;  1BH9 A;  3C1B B;  3EPJ A;  3KXB B;  5CPJ C;  3X1S B;  3EPL A;  2BYK B;  3AV2 D;  5B2I B;  4CAY A;  1TZY B;  1P3I B;  1AOI B;  3W97 C;  2HIO C;  3MGQ B;  2BYM A;  3WAA A;  4LD9 B;  3AZN B;  2YFW B;  3AZL B;  1KX5 A;  2IO5 B;  5B2J A;  5AV6 A;  5B1L A;  3X1U D;  4YM6 A;  5AVC A;  4UPK A;  3W97 A;  2HIO A;  3B0D B;  4YS3 B;  3NQJ A;  3AZG D;  1P3L C;  5AV8 C;  3WTP B;  5F99 D;  5B33 B;  4Z5T B;  4R8P B;  1P3B C;  1KX3 B;  5CP6 B;  4XZQ C;  3MVD B;  3UTA A;  5G49 B;  1ID3 B;  4UUZ A;  1KX5 D;  3AZE B;  3UT9 A;  5B0Y B;  3V9R B;  5JA4 B;  2Y2P A;  5AV6 D;  3AZM D;  5B1L D;  4YM6 D;  5AVC D;  5B40 C;  3W96 C;  5E5A B;  5BNX A;  3MGR C;  5AV8 A;  2PYO B;  1ZLA D;  5B1M A;  2F8N K;  3LZ0 B;  1KX4 B;  3W97 D;  3AYW A;  2FJ7 C;  1P3O C;  1P3F A;  4XZQ A;  4KGC C;  3C1C C;  5CHL B;  3UTA D;  5CPK B;  3C1B A;  3UT9 D;  1EQZ C;  3W96 A;  3MGR A;  3AZH C;  1P3M B;  2BYK A;  3EG5 B;  4DQY B;  4J8X B;  3TU4 C;  3X1T C;  1P3I A;  5GT3 D;  3H0M C;  1P3O A;  5B1M D;  3MGQ A;  3REK D;  4KGC A;  3AYW D;  2Y2Q A;  3EPK A;  3C1C A;  4LD9 A;  3AZN A;  1P3F D;  3KWQ C;  3VH6 A;  3AV1 C;  5AV9 C;  4WU8 C;  3AZH A;  1PZR A;  3REI B;  4H9R A;  2JCH A;  4EO5 C;  3C1B D;  3KXB D;  4G92 C;  1BH9 B;  3MGR D;  3X1S D;  5DNN C;  3WTP A;  4Z5T A;  1P3I D;  4CAY B;  1AOI D;  3EPH A;  3MGQ D;  5CP6 A;  3KWQ A;  4G91 C;  1M18 C;  3AV1 A;  4LD9 D;  2BYM B;  3AZN D;  4WU8 A;  2JE5 A;  2Y2M A;  3AZL D;  1ID3 A;  4HGA C;  3WAA B;  1F66 C;  2NZD C;  3AZK A;  3V9R A;  1KX5 B;  5B2J B;  5AV5 C;  5B31 C;  4CSR B;  4H9Q A;  5GSU A;  2HIO B;  4X23 C;  3W97 B;  5B33 D;  5B31 G;  4ZUX C;  3NQJ B;  4Z5T D;  3WTP D;  2XD5 A;  3WTP E;  1KX3 D;  3AZF C;  5CP6 D;  1BFM A;  1ID3 D;  4J8V C;  4H9P A;  3AZE D;  3MGS C;  4UUZ B;  5B0Y D;  3AZK D;  3IP4 C;  4KUD C;  5B31 A;  2RVQ C;  2Y2I A;  1S32 C;  4NE5 A;  4ZUX A;  5AV8 B;  3LJA C;  3LZ0 D;  2YFV B;  5GSU D;  3AZF A;  1P3B B;  5JRG C;  5CPI A;  1ULY A;  4XZQ B;  5AVB C;  3X1V C;  1JFI B;  3MGS A;  4ZBJ C;  3W98 C;  4H9N A;  3REJ C;  5CPK D;  1S32 A;  3AFA C;  5BS7 A;  1P3M D;  5BNV A;  3MNN C;  5B40 B;  3MGR B;  3H0R C;  3W96 B;  4J8X D;  3REH C;  5FUG A;  3LJA A;  3B6F C;  4ZUX D;  5JRG A;  2FJ7 B;  2DQN C;  1P3O B;  2DF4 C;  3X1V A;  4KGC B;  3B0B A;  5CPI D;  3AN2 C;  1HQ3 C;  3C1C B;  5B24 C;  3REJ A;  3AFA A;  1HTA A;  3REI D;  5CPJ A;  3AZH B;  4H9R B;  3REH A;  2RVQ D;  3B6F A;  3A1I A;  3TU4 B;  3X1T B;  4CSR A;  3LJA D;  3KSY A;  3WA9 C;  5B24 A;  3AZJ C;  1P3P C;  3KWQ B;  2Y2O A;  5AV9 B;  3AV1 B;  3WAA D;  4H9S C;  4WU8 B;  3WKJ C;  3AFA D;  4EO5 B;  5B2J D;  3AZK B;  4XUJ C;  5CPJ D;  5BT1 C;  4G92 B;  2F8N H;  3AZI C;  3REH D;  3B6F D;  1P3L A;  5DNN B;  3LEL C;  3WA9 A;  2YFV A;  2HIO D;  3R45 B;  3A1K A;  1P3B A;  4H9Q B;  5GSU B;  3AL0 C;  2ZY4 A;  4J8U C;  4G91 B;  1M18 B;  4H9S A;  3B0C T;  1JFI A;  4HGA B;  1F66 B;  2NZD B;  3LZ1 C;  3AZI A;  2ZM5 A;  4H9P B;  5KDM A;  5B40 A;  1Z2C B;  5B31 B;  1P3L D;  5AV8 D;  2FJ7 A;  4X23 B;  4J8U A;  4ZUX B;  3VH6 T;  1P3B D;  1Q9C A;  4M6B A;  3B6G C;  5GT0 C;  3AZF B;  5CPI B;  1P3A C;  4XZQ D;  1WWS A;  1R4V A;  5C3I C;  4J8V B;  1EQZ A;  3MGS B;  4H9N B;  2Y2H A;  3W99 C;  1S32 B;  3O62 C;  5B40 D;  3TU4 A;  1BH8 A;  5BNV B;  3X1T A;  3MGP C;  3W96 D;  1P3G C;  5FUG B;  3LJA B;  1WWI A;  2FJ7 D;  3B6G A;  5GT0 A;  5JRG B;  1P3O D;  4YS3 C;  1P3A A;  4KGC D;  5DNM C;  4Z66 C;  5AVB B;  3X1V B;  3C1C D;  5AV9 A;  4R8P C;  2CWE A;  4ZBJ B;  4Z2M H;  3W98 B;  3REJ B;  2G5I C;  4QLC C;  3AFA B;  3O62 A;  1EQZ D;  3AZH D;  3MGP A;  3MNN B;  5CPJ B;  2Y2L A;  4KHA A;  2J8P A;  3REH B;  5DNN A;  3X1T D;  3TU4 D;  3B6F B;  3R45 A;  4AWL C;  2NQB C;  3A6N C;  4WJ3 C;  5DNM A;  3B6G D;  4Z66 A;  1M18 A;  3AN2 B;  1HQ3 B;  3REL C;  5B0Z C;  5B24 B;  3KWQ D;  3VH5 W;  1F66 A;  4J8W C;  2NZD A;  2Y2N A;  3AV1 D;  5AV9 D;  5GXQ C;  4WU8 D;  5AV5 A;  4JJN C;  3MGP D;  2ZY5 A;  5B32 C;  4H9O A;  3A6N A;  5DNN D;  4X23 A;  1P3L B;  5B32 G;  2ZY2 A;  3KFU G;  4WU9 C;  3WA9 B;  3AV2 C;  3REL A;  5B0Z A;  4J8W A;  3AZJ B;  1P3P B;  1M18 D;  5GXQ A;  2CV5 C;  4J8V A;  1F66 D;  2NZD D;  3WKJ B;  3KUY C;  4KUD A;  2F2A C;  2F8N G;  2Y2G A;  3AZI B;  5AV5 D;  5KDM B;  4DRA A;  4WV4 B;  5B31 D;  3X1U C;  1P34 C;  4WU9 A;  3AV2 A;  4X23 D;  2ARO C;  4J8U B;  2CV5 A;  5AVB A;  3AZG C;  3AZF D;  2F8N A;  3W98 A;  1TAF A;  5F99 C;  2FFF B;  3KUY A;  1M19 C;  4J8V D;  1N1J A;  3MGS D;  2HUE C;  3MNN A;  1EQZ B;  4KUD D;  1S32 D;  1P34 A;  3AZM C;  3H0L C;  1BH8 B;  5AV6 C;  4DRB A;  2ARO A;  5B1L C;  4YM6 C;  4WU9 D;  5AVC C;  3AZG A;  1A7W A;  3NQU A;  1U35 C;  5JRG D;  3B6G B;  1ZLA C;  2XD1 A;  1HQ3 A;  5F99 A;  5GT0 B;  3AN2 A;  2CV5 D;  1P3A B;  1M19 A;  5AVB D;  3X1V D;  2F8N D;  3W98 D;  5C3I B;  4WNN A;  5AY8 C;  3KUY D;  3REJ D;  2ZY3 A;  3W99 B;  3MNN D;  4NE6 A;  3O62 B;  3AZM A;  3MGP B;  3UTA C;  1P3G B;  1P3K C;  4KHA B;  3UT9 C;  1P34 D;  1U35 A;  1ZLA A;  2ARO D;  4WZS B;  3AZJ A;  1P3P A;  3P5J B;  5DNM B;  4Z66 B;  2Y2K A;  5GT3 C;  1HQ3 D;  3AN2 D;  5B1M C;  5B24 D;  5AY8 A;  4Z2M G;  3REK C;  1M19 D;  3AYW C;  3WKJ A;  1H3O A;  3UTB C;  4QLC B;  4XUJ A;  1P3F C;  4E45 A;  1M1A C;  1P3K A;  5AV5 B;  3LEL A;  1T3U A;  3C1B C;  4AWL B;  2NQB B;  3KXB C;  4H9O B;  3A6N B;  3X1S C;  1U35 D;  2JSS A;  2W8S A;  3WA9 D;  5GT3 A;  5B2I C;  3REK A;  3AZJ D;  1TZY C;  3REL B;  5B0Z B;  1P3P D;  1P3I C;  1AOI C;  4J8W B;  3UTB A;  3MGQ C;  5GXQ B;  5AY8 D;  3LZ1 A;  3WKJ D;  1M1A A;  5BO0 B;  4LD9 C;  3AZN C;  4XUJ D;  5BT1 D;  4JJN B;  3AZL C;  4KUD B;  2IO5 C;  3AZI D;  1P3K D;  1KU5 A;  5B32 B;  3KXB A;  3LEL D;  3X1S A;  4NFT A;  5B2I A;  3VH5 T;  4WU9 B;  3AV2 B;  1TZY A;  4J8U D;  1AOI A;  3B0D C;  2CV5 B;  4NE3 A;  3WTP C;  3VH5 A;  5B33 C;  4Z5T C;  2F8N B;  3UTB D;  1TAF B;  1KX3 C;  2YFW A;  3LZ1 D;  3KUY B;  5CP6 C;  3AZL A;  3FDD A;  3W99 A;  1M1A D;  1N1J B;  1F1E A;  3MVD C;  1P3G A;  1ID3 C;  3AZE C;  2RIQ A;  3X1U B;  3B0C W;  5B0Y C;  3AZK C;  1P34 B;  4YS3 A;  2ARO B;  5E5A C;  5B2I D;  2PYO C;  1TZY D;  5B33 A;  3NQU B;  5GT0 D;  3AZG B;  4R8P A;  3LZ0 C;  1P3A D;  1KX4 C;  5F99 B;  1KX3 A;  5GSU C;  1M19 B;  4QLC A;  3MVD A;  4WNN B;  2HUE B;  5G49 A;  3VH6 W;  3AZE A;  3W99 D;  5B0Y A;  3O62 D;  5JA4 A;  1W2E A;  2VQR A;  1P3G D;  3AZM B;  5CPK C;  5AV6 B;  2NQB A;  5B1L B;  5E5A A;  1P3M C;  4YM6 B;  5AVC B;  2PYO A;  1U35 B;  4J8X C;  3LZ0 A;  4YS3 D;  1KX4 A;  1ZLA B;  5DNM D;  4Z66 D;  2L5A A;  2BG1 A;  4R8P D;  2UWX A;  5BO0 A;  5AY8 B;  4QLC D;  1H3O B;  5CPI C;  4JJN A;  3MVD D;  4XUJ B;  5CPK A;  5B32 A;  3UTA B;  1B6W A;  1P3K B;  2LY8 A;  1P3M A;  3REI C;  3UT9 B;  3LEL B;  4J8X A;  2NQB D;  5BS7 C;  3A6N D;  3F6T A;  5E5A D;  2PYO D;  2Y2J A;  5BNX B;  1KX4 D;  5GT3 B;  3REL D;  5B1M B;  5B0Z D;  4E44 A;  3REK B;  4J8W D;  3AYW B;  5GXQ D;  3UTB B;  1B67 A;  1P3F B;  3LZ1 B;  1M1A B;  2G5H C;  3WAA C;  4JJN D;  3REI A;  3X1U A;  1KX5 C;  5B32 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...