1B6WA

Crystal structure of the selenomethionine variant of histone hmfb from methanothermus fervidus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
b'MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE HMFB)
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Dna binding protein
total genus 22
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1b6wA00
5CPJC 5B0ZD 4NE5A 1TAFA 2L5AA 4KUDD 4R8PC 3MGSB 3VH6A 1ZLAC 2FJ7D 4XUJB 3MNNC 4CAYA 3AZID 5KDMB 3KWQB 1M1AC 5B40D 4WU9C 5GT3D 3MGPC 4Z2MG 4KHAA 3REKC 3MNNA 5JRGD 1P3AD 3W98C 3KSYA 1M1AA 3W97A 2HIOC 2YFVB 5GSUC 5E5AB 3B6GD 3MGPA 1P3BA 3MGSC 3REKA 3W98A 4XUJC 4DRBA 2HIOA 5FUGB 3C1CA 3X1TB 3AN2B 5AVCB 4Z66B 2PYOB 3KWQC 3AV1B 3MGSA 3B0DB 4KGCB 4J8WD 4XUJA 2F8NB 4H9SA 4WU8D 3LJAB 4UUZA 1KX4A 4YS3D 3UT9B 3KWQA 4G91B 5B2JA 2RVQC 5B0ZB 3LZ0D 5BT1C 3WAAB 4KUDB 1P3FD 4J8VB 3WA9D 4YM6A 2FJ7B 1M19A 1F1EA 2YFVA 5F99B 5GXQA 3X1TC 3AN2C 5AVCC 4Z66C 5E5AA 2PYOC 1P3OD 3O62D 5B31D 3MNND 5B40B 3AV1C 3B0DC 3AZGA 2BYMB 5BNXA 3W97D 5GT3B 5BNVB 1P34A 1P3AB 5FUGA 3LJAC 4ZUXA 4Z66A 4CSRB 2PYOA 5BO0B 3UT9C 3LELB 1P3BD 4G91C 3REKD 3AV1A 4KGCA 5B33D 3B6GB 5B0ZC 4KUDC 3KUYD 3C1CD 3UTAD 2FJ7C 5AVBD 3UT9A 1P3PA 4QLCD 4XZQD 5B0ZA 3WAAA 4KUDA 1WWSA 4J8VA 3VH5W 1KX4D 4J8WB 5B40C 3LZ1D 5GT3C 5B2JD 4WU8B 3B6FD 5F99A 1P3AC 4YS3B 1TAFB 4H9PB 3AZHD 4YM6D 1BH8B 1M19D 5B40A 3LZ0B 3B6GC 1P3FB 3W96A 5GT3A 3WA9B 5GXQD 4CAYB 5CPKD 1P3AA 5E5AD 4X23D 5B32G 3AV2D 4CSRA 5BO0A 3LELA 3X1VD 3AZGD 1ID3D 1P3OB 3O62B 5B31B 1KX5D 1P34D 2F8NH 4Z2MH 4ZUXD 4Z66D 4J8WC 3W97B 5AV9A 4WU8C 5B1LA 4KGCD 4YS3C 3AZMA 3UTBA 5B33B 4J8WA 3LZ0C 3UT9D 3KUYB 1P3GB 1P3FC 3C1CB 1P3PD 1F66D 3WA9C 3UTAB 5AVBB 4YS3A 4H9PA 3KXBD 3WAAD 4J8VD 3AZJA 1BH8A 5DNMA 4E45A 5AV8A 4XZQB 4QLCB 3LZ0A 1P3OC 3O62C 3MGRD 5B31C 1P3FA 4UUZB 3WA9A 5F99D 1KX4B 3LZ1B 1HTAA 3W97C 5B2JB 3B6FB 1B67A 3AZND 3AZHB 3W96D 1P3OA 3O62A 1P3BC 5B31A 4YM6B 1M19B 5B33C 3KUYC 5GXQB 3LELD 3C1CC 5AY8A 5CPKB 4X23B 3UTAC 4H9OA 3B0CT 5AVBC 3AV2B 3MVDA 5G49A 3X1VB 3AZGB 5BNXB 1ID3B 5GT0A 3NQUA 5B33A 5AV9D 4QLCC 4XZQC 1P34B 4H9NB 1KX5B 4H9SC 3KUYA 5B1LD 1P3GA 3NQJA 4ZUXB 1KX4C 3UTAA 3LZ1C 5AVBA 3AZMD 5B2JC 3REID 1BH9B 3UTBD 3B6FC 2NZDA 2F8NK 3AZHC 4QLCA 4XZQA 4YM6C 1M19C 3AZFB 3LZ1A 3VH6W 1JFIB 1P3PB 1F66B 3AZJD 5GXQC 3B6FA 5DNMD 5CPKC 5AV8D 5E5AC 4X23C 3AZLA 1HQ3D 3KXBB 3AZHA 3AV2C 3X1VC 4NFTA 3WKJD 3AZGC 1ID3C 3W99A 3MGRB 1KX5C 1P34C 2JSSA 5BS7C 5CPKA 4ZUXC 4X23A 2CV5A 3AV2A 3X1VA 3AZNB 4KGCC 1ID3A 3W96B 2BYKB 1KX3D 1AOID 1KX5A 4H9NA 3B0BA 5AY8D 3REHD 5BS7A 4E44A 3WTPD 3MVDD 1P3PC 1F66C 5GT0D 1BH9A 5DNNA 3WAAC 3KXBC 1U35D 1P3GD 4J8VC 3R45B 3RELD 1Q9CA 3AYWB 1S32A 5AV9B 3AZFA 3VH5T 5B32D 1P3MD 5B1LB 3MGRC 1JFIA 1F66A 2NZDD 5F99C 2AROD 3KXBA 3AZMB 3UTBB 3REIB 5B24A 3AZNC 3W96C 5C3IB 1EQZD 3MGRA 1M18D 3AZLD 1P3KD 2YFWB 3AZJB 3LELC 4H9RA 5DNMB 4LD9D 5AV8B 3W99D 3AZNA 1HQ3B 2BYKA 3REJD 4Z5TB 3WKJB 1P3ID 2CV5D 5B2ID 1B6WA 3AYWC 5AV9C 1ULYA 5AV5D 4G92B 5B1LC 4NE6A 4WV4B 2IO5B 5B1MD 3AZMC 5CP6A 1H3OB 1WWIA 4HGAB 3REIC 3UTBC 3R45A 3AYWA 4H9QB 1KX3B 1AOIB 5AY8B 5C3IC 3REHB 4H9OB 3AZED 5DNND 3WTPB 3MVDB 5G49B 5JA4B 3AZJC 5GT0B 3REIA 3NQUB 5DNMC 5CPJB 1S32D 3MGQD 5AV8C 3AZFD 1HQ3C 1U35B 3NQJB 3AFAA 4Z5TC 3RELB 3WKJC 4JJND 5B32B 3C1BD 1P3MB 5B24D 2YFWA 2NZDB 4G92C 2AROB 1HQ3A 4Z5TA 4HGAC 3WKJA 4J8UD 2NQBD 1EQZB 1KX3C 1AOIC 5AY8C 1M18B 3REHC 3AZLB 1P3KB 3WTPC 3MVDC 4LD9B 1H3OA 5GT0C 3W99B 5B0YD 3X1UB 3TU4A 3REJB 1U35C 4H9QA 1P3GC 1KX3A 1AOIA 1P3IB 3RELC 3REHA 2CV5B 5B2IB 3AZKD 1KU5A 5B32C 5AV5B 5CP6D 3WTPA 1P3MC 5JA4A 2NZDC 2AROC 3AYWD 5CPJA 5B1MB 1U35A 1P3LD 5CHLB 4EO5B 4R8PA 3RELA 1ZLAA 5B32A 5AV6D 1P3MA 1EQZC 4WNNB 2F8NG 3VH6T 3AZEB 1M18C 5DNNB 3AZLC 2AROA 1P3KC 3AFAD 1S32B 4LD9C 3MGQB 3W99C 3A6ND 3X1UC 2CWEA 4WU9A 3REJC 4J8XD 1EQZA 1P3IC 4JJNB 1TZYD 3C1BB 2CV5C 5B2IC 1M18A 1P3KA 5B24B 4Z5TD 5AV5C 3X1SD 5GSUA 3B0CW 4LD9A 3X1UA 4ZBJB 5CPID 5B1MC 3REJA 1P3IA 4EO5C 4J8UB 5B2IA 2NQBB 4H9RB 5AV5A 3TU4D 3AZEC 5DNNC 3VH5A 5KDMA 5B1MA 4AWLB 5B0YB 1S32C 3MGQC 3AZFC 1R4VA 4WNNA 1A7WA 5CPJD 4JJNC 3AZEA 3AZKB 3C1BC 5CP6B 5B24C 4R8PD 1ZLAD 3AZIB 3MGQA 1P3LB 4ZBJC 4DRAA 4J8UC 4JJNA 1BFMA 3C1BA 5AV6B 1M1AD 2NQBC 5JRGB 4WU9D 3AN2A 3X1TA 3AFAB 5AVCA 3MGPD 3WTPE 3A6NB 4AWLC 5B0YC 4J8UA 3W98D 1N1JB 2NQBA 4J8XB 2F8NA 2HIOD 5GSUD 1TZYB 3X1UD 3LJAA 3AZKC 5CP6C 3X1SB 3MGSD 5B0YA 3AZIC 4XUJD 5CPIB 4M6BA 1P3LC 5B31G 2LY8A 3AZKA 3V9RB 2FJ7A 3KWQD 5AV6C 2HUEB 3TU4B 5JRGC 3AZIA 3AFAC 1P3LA 3A6NC 2BYMA 5AV6A 4J8XC 5BNVA 2RVQD 1TZYC 5JRGA 5BT1D 4R8PB 3X1SC 1ZLAB 3A6NA 1N1JA 5CPIC 4KHAB 3B6GA 4J8XA 3MNNB 3X1TD 1TZYA 3AN2D 5AVCD 1M1AB 2PYOD 2IO5C 4NE3A 3X1SA 2HUEC 3AV1D 3TU4C 4WU9B 3MGPB 2F8ND 4WZSB 5CPIA 1P3BB 3REKB 3LJAD 3W98B 3V9RA 2HIOB 5GSUB 4WU8A
chains in the Genus database with same CATH superfamily
5CPJC 3IP4C 5B0ZD 4NE5A 1TAFA 2L5AA 4KUDD 4R8PC 3MGSB 3VH6A 1ZLAC 2FJ7D 4XUJB 2ZY3A 3H0RC 3MNNC 4CAYA 3AZID 5KDMB 3KWQB 1M1AC 5B40D 4WU9C 5GT3D 3MGPC 4Z2MG 4KHAA 3REKC 3MNNA 5JRGD 1P3AD 3W98C 3KSYA 1M1AA 3W97A 2HIOC 2YFVB 5GSUC 5E5AB 3B6GD 3MGPA 1P3BA 3MGSC 3REKA 3EPJA 3W98A 4XUJC 4DRBA 2HIOA 2XD5A 5FUGB 3C1CA 3X1TB 3AN2B 5AVCB 4Z66B 2PYOB 3KWQC 3AV1B 3MGSA 3B0DB 4KGCB 4J8WD 4XUJA 2F8NB 3EG5B 4H9SA 4WU8D 3LJAB 4UUZA 1KX4A 4YS3D 3UT9B 3KWQA 4G91B 5B2JA 2RVQC 5B0ZB 3LZ0D 5BT1C 3WAAB 4KUDB 1P3FD 3A1IA 4J8VB 3WA9D 4YM6A 2FJ7B 3FDDA 1M19A 1F1EA 2YFVA 5F99B 5GXQA 1T3UA 3X1TC 3AN2C 5AVCC 4Z66C 5E5AA 2PYOC 1P3OD 3O62D 5B31D 3MNND 5B40B 3AV1C 3B0DC 3AZGA 2BYMB 5BNXA 3W97D 5GT3B 5BNVB 1P34A 1P3AB 5FUGA 3LJAC 4ZUXA 4Z66A 4CSRB 2PYOA 5BO0B 3UT9C 3LELB 1P3BD 4G91C 3REKD 3A1KA 3AV1A 4KGCA 5B33D 3B6GB 5B0ZC 4KUDC 3KUYD 3C1CD 2JE5A 2DF4C 3UTAD 2FJ7C 1W2EA 5AVBD 3UT9A 1P3PA 4QLCD 4XZQD 5B0ZA 3WAAA 4KUDA 1WWSA 4J8VA 3VH5W 1KX4D 4J8WB 5B40C 3LZ1D 5GT3C 5B2JD 4WU8B 3B6FD 5F99A 1P3AC 4YS3B 1TAFB 4H9PB 3AZHD 4YM6D 1BH8B 1M19D 5B40A 3LZ0B 3B6GC 2J8PA 1P3FB 3W96A 2Y2IA 5GT3A 3WA9B 5GXQD 4CAYB 5CPKD 1P3AA 5E5AD 4X23D 5B32G 3AV2D 4CSRA 5BO0A 3LELA 3X1VD 3AZGD 1ID3D 2Y2HA 1P3OB 3O62B 2Y2JA 5B31B 1P34D 1KX5D 4Z2MH 2F8NH 4ZUXD 4Z66D 4J8WC 3W97B 2UWXA 5AV9A 4WU8C 5B1LA 4KGCD 2JCHA 2G5IC 4YS3C 2ZY2A 3AZMA 3UTBA 5B33B 4J8WA 3LZ0C 3UT9D 3KUYB 1P3GB 1P3FC 3C1CB 1P3PD 1F66D 3WA9C 3UTAB 5AVBB 4YS3A 2BG1A 4H9PA 3KXBD 3WAAD 4J8VD 3AZJA 1BH8A 5DNMA 4E45A 5AV8A 4XZQB 4QLCB 3LZ0A 1P3OC 3O62C 3MGRD 5B31C 3EPLA 1P3FA 4UUZB 3WA9A 5F99D 1KX4B 3LZ1B 1HTAA 3W97C 3F6TA 5B2JB 3B6FB 1B67A 2XD1A 2Y2GA 3AZND 3AZHB 3W96D 1P3OA 3O62A 1P3BC 5B31A 4YM6B 2Y2OA 1M19B 5B33C 4UPKA 5GXQB 3LELD 3KUYC 3C1CC 5AY8A 5CPKB 4X23B 3UTAC 4H9OA 3B0CT 5AVBC 3AV2B 3MVDA 5G49A 3X1VB 3AZGB 5BNXB 1ID3B 5GT0A 3NQUA 5B33A 3KFUG 5AV9D 4QLCC 4XZQC 1P34B 4H9NB 1KX5B 4H9SC 3KUYA 5B1LD 1P3GA 3NQJA 4ZUXB 1KX4C 3UTAA 3LZ1C 5AVBA 3EPKA 3AZMD 5B2JC 3REID 1BH9B 3UTBD 3B6FC 2Y2NA 2NZDA 2F8NK 3AZHC 4QLCA 4XZQA 2G5HC 4YM6C 1M19C 3AZFB 3LZ1A 3VH6W 1JFIB 1P3PB 1F66B 3AZJD 5GXQC 3B6FA 5DNMD 5CPKC 5AV8D 5E5AC 4X23C 3AZLA 1HQ3D 3KXBB 3AZHA 3AV2C 3X1VC 4NFTA 3WKJD 3AZGC 1ID3C 3W99A 3MGRB 1KX5C 1P34C 2JSSA 5BS7C 5CPKA 4ZUXC 4X23A 2CV5A 3AV2A 3X1VA 3AZNB 4KGCC 1ID3A 3W96B 2BYKB 1KX3D 1AOID 1KX5A 4H9NA 3B0BA 5AY8D 3REHD 5BS7A 4E44A 3WTPD 3AL0C 3MVDD 1P3PC 1F66C 5GT0D 1BH9A 2ZY5A 3WAAC 5DNNA 3KXBC 1U35D 1P3GD 4J8VC 3R45B 3RELD 1Q9CA 3AYWB 1S32A 5AV9B 3AZFA 3VH5T 5B32D 4WJ3C 1P3MD 5B1LB 3MGRC 2Y2LA 1JFIA 1F66A 2NZDD 5F99C 2AROD 3KXBA 3AZMB 3UTBB 3REIB 5B24A 3AZNC 2W8SA 3W96C 2Y2PA 5C3IB 1EQZD 3MGRA 1M18D 3AZLD 1P3KD 2YFWB 3AZJB 3LELC 4H9RA 5DNMB 4LD9D 5AV8B 3W99D 3AZNA 1HQ3B 2BYKA 3REJD 4Z5TB 3WKJB 1P3ID 2CV5D 5B2ID 1B6WA 3AYWC 5AV9C 1ULYA 5AV5D 4G92B 5B1LC 4NE6A 4WV4B 2IO5B 5B1MD 3AZMC 5CP6A 1H3OB 1WWIA 4HGAB 3REIC 3UTBC 3R45A 3AYWA 4H9QB 1KX3B 1AOIB 5AY8B 5C3IC 3REHB 4H9OB 3AZED 5DNND 3WTPB 3MVDB 5G49B 5JA4B 3AZJC 5GT0B 3REIA 3NQUB 5DNMC 2RIQA 5CPJB 3MGQD 5AV8C 3AZFD 1S32D 1HQ3C 1U35B 3NQJB 3AFAA 4Z5TC 3RELB 3WKJC 4JJND 5B32B 3C1BD 1P3MB 5B24D 2YFWA 2NZDB 4G92C 2AROB 2Y2KA 1HQ3A 4Z5TA 4HGAC 3WKJA 4J8UD 2NQBD 1EQZB 1KX3C 1AOIC 5AY8C 1M18B 3REHC 3AZLB 1P3KB 3WTPC 3MVDC 4LD9B 1H3OA 5GT0C 3W99B 5B0YD 3X1UB 3TU4A 3REJB 1U35C 4H9QA 1P3GC 1KX3A 1AOIA 1P3IB 3RELC 3REHA 2CV5B 5B2IB 3AZKD 1KU5A 5B32C 5AV5B 5CP6D 3WTPA 1P3MC 5JA4A 2NZDC 2AROC 3AYWD 5CPJA 5B1MB 1U35A 1P3LD 3H0LC 5CHLB 4EO5B 4R8PA 3RELA 1ZLAA 5B32A 3P5JB 5AV6D 1P3MA 1EQZC 4WNNB 2F8NG 3VH6T 3AZEB 1M18C 2DQNC 5DNNB 2AROA 3AZLC 3H0MC 1P3KC 3AFAD 1S32B 4LD9C 2Y2QA 3MGQB 3W99C 3A6ND 2CWEA 3X1UC 4WU9A 3REJC 4J8XD 2Y2MA 1EQZA 1P3IC 4JJNB 1TZYD 3C1BB 2CV5C 5B2IC 1M18A 1P3KA 5B24B 4Z5TD 5AV5C 3X1SD 5GSUA 3B0CW 4LD9A 3X1UA 4ZBJB 5CPID 5B1MC 3REJA 1P3IA 4EO5C 4J8UB 5B2IA 2NQBB 4H9RB 5AV5A 2F2AC 3TU4D 3AZEC 5DNNC 3VH5A 5KDMA 5B1MA 4AWLB 5B0YB 1S32C 3MGQC 3AZFC 1R4VA 4WNNA 1A7WA 5CPJD 4JJNC 3AZEA 3AZKB 3C1BC 5CP6B 5B24C 4R8PD 1ZLAD 3AZIB 2VQRA 3MGQA 1P3LB 4ZBJC 4DRAA 4J8UC 4JJNA 1BFMA 3C1BA 5AV6B 1M1AD 1PZRA 2NQBC 5JRGB 4WU9D 3AN2A 3X1TA 3AFAB 5AVCA 3MGPD 3WTPE 3A6NB 4AWLC 5B0YC 4J8UA 3W98D 1N1JB 2ZY4A 4J8XB 2NQBA 2F8NA 2HIOD 1Z2CB 5GSUD 1TZYB 3X1UD 3LJAA 3AZKC 4DQYB 5CP6C 3X1SB 3MGSD 5B0YA 3AZIC 4XUJD 5CPIB 4M6BA 1P3LC 2FFFB 5B31G 2LY8A 3AZKA 3V9RB 2FJ7A 3KWQD 5AV6C 2HUEB 3TU4B 5JRGC 3AZIA 3AFAC 1P3LA 3A6NC 2BYMA 5AV6A 4J8XC 5BNVA 2RVQD 1TZYC 5JRGA 5BT1D 4R8PB 3X1SC 1ZLAB 3A6NA 1N1JA 5CPIC 4KHAB 3B6GA 4J8XA 3MNNB 3X1TD 1TZYA 3AN2D 5AVCD 1M1AB 2PYOD 3EPHA 2IO5C 4NE3A 3X1SA 2HUEC 3AV1D 3TU4C 4WU9B 3MGPB 2F8ND 4WZSB 5CPIA 1P3BB 3REKB 3LJAD 3W98B 3V9RA 2HIOB 5GSUB 4WU8A 2ZM5A
chains in the Genus database with same CATH topology
5CPJC 3IP4C 5B0ZD 4NE5A 1TAFA 2L5AA 4KUDD 4R8PC 3MGSB 3VH6A 1ZLAC 2FJ7D 4XUJB 2ZY3A 3H0RC 3MNNC 4CAYA 3AZID 5KDMB 3KWQB 1M1AC 5B40D 4WU9C 5GT3D 3MGPC 4Z2MG 4KHAA 3REKC 3MNNA 5JRGD 1P3AD 3W98C 3KSYA 1M1AA 3W97A 2HIOC 2YFVB 5GSUC 5E5AB 3B6GD 3MGPA 1P3BA 3MGSC 3REKA 3EPJA 3W98A 4XUJC 4DRBA 2HIOA 2XD5A 5FUGB 3C1CA 3X1TB 3AN2B 5AVCB 4Z66B 2PYOB 3KWQC 3AV1B 3MGSA 3B0DB 4KGCB 4J8WD 4XUJA 2F8NB 3EG5B 4H9SA 4WU8D 3LJAB 4UUZA 1KX4A 4YS3D 3UT9B 3KWQA 4G91B 5B2JA 2RVQC 5B0ZB 3LZ0D 5BT1C 3WAAB 4KUDB 1P3FD 3A1IA 4J8VB 3WA9D 4YM6A 2FJ7B 3FDDA 1M19A 1F1EA 2YFVA 5F99B 5GXQA 1T3UA 3X1TC 3AN2C 5AVCC 4Z66C 5E5AA 2PYOC 1P3OD 3O62D 5B31D 3MNND 5B40B 3AV1C 3B0DC 3AZGA 2BYMB 5BNXA 3W97D 5GT3B 5BNVB 1P34A 1P3AB 5FUGA 3LJAC 4ZUXA 4Z66A 4CSRB 2PYOA 5BO0B 3UT9C 3LELB 1P3BD 4G91C 3REKD 3A1KA 3AV1A 4KGCA 5B33D 3B6GB 5B0ZC 4KUDC 3KUYD 3C1CD 2JE5A 2DF4C 3UTAD 2FJ7C 1W2EA 5AVBD 3UT9A 1P3PA 4QLCD 4XZQD 5B0ZA 3WAAA 4KUDA 1WWSA 4J8VA 3VH5W 1KX4D 4J8WB 5B40C 3LZ1D 5GT3C 5B2JD 4WU8B 3B6FD 5F99A 1P3AC 4YS3B 1TAFB 4H9PB 3AZHD 4YM6D 1BH8B 1M19D 5B40A 3LZ0B 3B6GC 2J8PA 1P3FB 3W96A 2Y2IA 5GT3A 3WA9B 5GXQD 4CAYB 5CPKD 1P3AA 5E5AD 4X23D 5B32G 3AV2D 4CSRA 5BO0A 3LELA 3X1VD 3AZGD 1ID3D 2Y2HA 1P3OB 3O62B 2Y2JA 5B31B 1P34D 1KX5D 4Z2MH 2F8NH 4ZUXD 4Z66D 4J8WC 3W97B 2UWXA 5AV9A 4WU8C 5B1LA 4KGCD 2JCHA 2G5IC 4YS3C 2ZY2A 3AZMA 3UTBA 5B33B 4J8WA 3LZ0C 3UT9D 3KUYB 1P3GB 1P3FC 3C1CB 1P3PD 1F66D 3WA9C 3UTAB 5AVBB 4YS3A 2BG1A 4H9PA 3KXBD 3WAAD 4J8VD 3AZJA 1BH8A 5DNMA 4E45A 5AV8A 4XZQB 4QLCB 3LZ0A 1P3OC 3O62C 3MGRD 5B31C 3EPLA 1P3FA 4UUZB 3WA9A 5F99D 1KX4B 3LZ1B 1HTAA 3W97C 3F6TA 5B2JB 3B6FB 1B67A 2XD1A 2Y2GA 3AZND 3AZHB 3W96D 1P3OA 3O62A 1P3BC 5B31A 4YM6B 2Y2OA 1M19B 5B33C 4UPKA 5GXQB 3LELD 3KUYC 3C1CC 5AY8A 5CPKB 4X23B 3UTAC 4H9OA 3B0CT 5AVBC 3AV2B 3MVDA 5G49A 3X1VB 3AZGB 5BNXB 1ID3B 5GT0A 3NQUA 5B33A 3KFUG 5AV9D 4QLCC 4XZQC 1P34B 4H9NB 1KX5B 4H9SC 3KUYA 5B1LD 1P3GA 3NQJA 4ZUXB 1KX4C 3UTAA 3LZ1C 5AVBA 3EPKA 3AZMD 5B2JC 3REID 1BH9B 3UTBD 3B6FC 2Y2NA 2NZDA 2F8NK 3AZHC 4QLCA 4XZQA 2G5HC 4YM6C 1M19C 3AZFB 3LZ1A 3VH6W 1JFIB 1P3PB 1F66B 3AZJD 5GXQC 3B6FA 5DNMD 5CPKC 5AV8D 5E5AC 4X23C 3AZLA 1HQ3D 3KXBB 3AZHA 3AV2C 3X1VC 4NFTA 3WKJD 3AZGC 1ID3C 3W99A 3MGRB 1KX5C 1P34C 2JSSA 5BS7C 5CPKA 4ZUXC 4X23A 2CV5A 3AV2A 3X1VA 3AZNB 4KGCC 1ID3A 3W96B 2BYKB 1KX3D 1AOID 1KX5A 4H9NA 3B0BA 5AY8D 3REHD 5BS7A 4E44A 3WTPD 3AL0C 3MVDD 1P3PC 1F66C 5GT0D 1BH9A 2ZY5A 3WAAC 5DNNA 3KXBC 1U35D 1P3GD 4J8VC 3R45B 3RELD 1Q9CA 3AYWB 1S32A 5AV9B 3AZFA 3VH5T 5B32D 4WJ3C 1P3MD 5B1LB 3MGRC 2Y2LA 1JFIA 1F66A 2NZDD 5F99C 2AROD 3KXBA 3AZMB 3UTBB 3REIB 5B24A 3AZNC 2W8SA 3W96C 2Y2PA 5C3IB 1EQZD 3MGRA 1M18D 3AZLD 1P3KD 2YFWB 3AZJB 3LELC 4H9RA 5DNMB 4LD9D 5AV8B 3W99D 3AZNA 1HQ3B 2BYKA 3REJD 4Z5TB 3WKJB 1P3ID 2CV5D 5B2ID 1B6WA 3AYWC 5AV9C 1ULYA 5AV5D 4G92B 5B1LC 4NE6A 4WV4B 2IO5B 5B1MD 3AZMC 5CP6A 1H3OB 1WWIA 4HGAB 3REIC 3UTBC 3R45A 3AYWA 4H9QB 1KX3B 1AOIB 5AY8B 5C3IC 3REHB 4H9OB 3AZED 5DNND 3WTPB 3MVDB 5G49B 5JA4B 3AZJC 5GT0B 3REIA 3NQUB 5DNMC 2RIQA 5CPJB 3MGQD 5AV8C 3AZFD 1S32D 1HQ3C 1U35B 3NQJB 3AFAA 4Z5TC 3RELB 3WKJC 4JJND 5B32B 3C1BD 1P3MB 5B24D 2YFWA 2NZDB 4G92C 2AROB 2Y2KA 1HQ3A 4Z5TA 4HGAC 3WKJA 4J8UD 2NQBD 1EQZB 1KX3C 1AOIC 5AY8C 1M18B 3REHC 3AZLB 1P3KB 3WTPC 3MVDC 4LD9B 1H3OA 5GT0C 3W99B 5B0YD 3X1UB 3TU4A 3REJB 1U35C 4H9QA 1P3GC 1KX3A 1AOIA 1P3IB 3RELC 3REHA 2CV5B 5B2IB 3AZKD 1KU5A 5B32C 5AV5B 5CP6D 3WTPA 1P3MC 5JA4A 2NZDC 2AROC 3AYWD 5CPJA 5B1MB 1U35A 1P3LD 3H0LC 5CHLB 4EO5B 4R8PA 3RELA 1ZLAA 5B32A 3P5JB 5AV6D 1P3MA 1EQZC 4WNNB 2F8NG 3VH6T 3AZEB 1M18C 2DQNC 5DNNB 2AROA 3AZLC 3H0MC 1P3KC 3AFAD 1S32B 4LD9C 2Y2QA 3MGQB 3W99C 3A6ND 2CWEA 3X1UC 4WU9A 3REJC 4J8XD 2Y2MA 1EQZA 1P3IC 4JJNB 1TZYD 3C1BB 2CV5C 5B2IC 1M18A 1P3KA 5B24B 4Z5TD 5AV5C 3X1SD 5GSUA 3B0CW 4LD9A 3X1UA 4ZBJB 5CPID 5B1MC 3REJA 1P3IA 4EO5C 4J8UB 5B2IA 2NQBB 4H9RB 5AV5A 2F2AC 3TU4D 3AZEC 5DNNC 3VH5A 5KDMA 5B1MA 4AWLB 5B0YB 1S32C 3MGQC 3AZFC 1R4VA 4WNNA 1A7WA 5CPJD 4JJNC 3AZEA 3AZKB 3C1BC 5CP6B 5B24C 4R8PD 1ZLAD 3AZIB 2VQRA 3MGQA 1P3LB 4ZBJC 4DRAA 4J8UC 4JJNA 1BFMA 3C1BA 5AV6B 1M1AD 1PZRA 2NQBC 5JRGB 4WU9D 3AN2A 3X1TA 3AFAB 5AVCA 3MGPD 3WTPE 3A6NB 4AWLC 5B0YC 4J8UA 3W98D 1N1JB 2ZY4A 4J8XB 2NQBA 2F8NA 2HIOD 1Z2CB 5GSUD 1TZYB 3X1UD 3LJAA 3AZKC 4DQYB 5CP6C 3X1SB 3MGSD 5B0YA 3AZIC 4XUJD 5CPIB 4M6BA 1P3LC 2FFFB 5B31G 2LY8A 3AZKA 3V9RB 2FJ7A 3KWQD 5AV6C 2HUEB 3TU4B 5JRGC 3AZIA 3AFAC 1P3LA 3A6NC 2BYMA 5AV6A 4J8XC 5BNVA 2RVQD 1TZYC 5JRGA 5BT1D 4R8PB 3X1SC 1ZLAB 3A6NA 1N1JA 5CPIC 4KHAB 3B6GA 4J8XA 3MNNB 3X1TD 1TZYA 3AN2D 5AVCD 1M1AB 2PYOD 3EPHA 2IO5C 4NE3A 3X1SA 2HUEC 3AV1D 3TU4C 4WU9B 3MGPB 2F8ND 4WZSB 5CPIA 1P3BB 3REKB 3LJAD 3W98B 3V9RA 2HIOB 5GSUB 4WU8A 2ZM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ C;  5B0Z D;  4NE5 A;  1TAF A;  2L5A A;  4KUD D;  4R8P C;  3MGS B;  3VH6 A;  1ZLA C;  2FJ7 D;  4XUJ B;  3MNN C;  4CAY A;  3AZI D;  5KDM B;  3KWQ B;  1M1A C;  5B40 D;  4WU9 C;  5GT3 D;  3MGP C;  4Z2M G;  4KHA A;  3REK C;  3MNN A;  5JRG D;  1P3A D;  3W98 C;  3KSY A;  1M1A A;  3W97 A;  2HIO C;  2YFV B;  5GSU C;  5E5A B;  3B6G D;  3MGP A;  1P3B A;  3MGS C;  3REK A;  3W98 A;  4XUJ C;  4DRB A;  2HIO A;  5FUG B;  3C1C A;  3X1T B;  3AN2 B;  5AVC B;  4Z66 B;  2PYO B;  3KWQ C;  3AV1 B;  3MGS A;  3B0D B;  4KGC B;  4J8W D;  4XUJ A;  2F8N B;  4H9S A;  4WU8 D;  3LJA B;  4UUZ A;  1KX4 A;  4YS3 D;  3UT9 B;  3KWQ A;  4G91 B;  5B2J A;  2RVQ C;  5B0Z B;  3LZ0 D;  5BT1 C;  3WAA B;  4KUD B;  1P3F D;  4J8V B;  3WA9 D;  4YM6 A;  2FJ7 B;  1M19 A;  1F1E A;  2YFV A;  5F99 B;  5GXQ A;  3X1T C;  3AN2 C;  5AVC C;  4Z66 C;  5E5A A;  2PYO C;  1P3O D;  3O62 D;  5B31 D;  3MNN D;  5B40 B;  3AV1 C;  3B0D C;  3AZG A;  2BYM B;  5BNX A;  3W97 D;  5GT3 B;  5BNV B;  1P34 A;  1P3A B;  5FUG A;  3LJA C;  4ZUX A;  4Z66 A;  4CSR B;  2PYO A;  5BO0 B;  3UT9 C;  3LEL B;  1P3B D;  4G91 C;  3REK D;  3AV1 A;  4KGC A;  5B33 D;  3B6G B;  5B0Z C;  4KUD C;  3KUY D;  3C1C D;  3UTA D;  2FJ7 C;  5AVB D;  3UT9 A;  1P3P A;  4QLC D;  4XZQ D;  5B0Z A;  3WAA A;  4KUD A;  1WWS A;  4J8V A;  3VH5 W;  1KX4 D;  4J8W B;  5B40 C;  3LZ1 D;  5GT3 C;  5B2J D;  4WU8 B;  3B6F D;  5F99 A;  1P3A C;  4YS3 B;  1TAF B;  4H9P B;  3AZH D;  4YM6 D;  1BH8 B;  1M19 D;  5B40 A;  3LZ0 B;  3B6G C;  1P3F B;  3W96 A;  5GT3 A;  3WA9 B;  5GXQ D;  4CAY B;  5CPK D;  1P3A A;  5E5A D;  4X23 D;  5B32 G;  3AV2 D;  4CSR A;  5BO0 A;  3LEL A;  3X1V D;  3AZG D;  1ID3 D;  1P3O B;  3O62 B;  5B31 B;  1KX5 D;  1P34 D;  2F8N H;  4Z2M H;  4ZUX D;  4Z66 D;  4J8W C;  3W97 B;  5AV9 A;  4WU8 C;  5B1L A;  4KGC D;  4YS3 C;  3AZM A;  3UTB A;  5B33 B;  4J8W A;  3LZ0 C;  3UT9 D;  3KUY B;  1P3G B;  1P3F C;  3C1C B;  1P3P D;  1F66 D;  3WA9 C;  3UTA B;  5AVB B;  4YS3 A;  4H9P A;  3KXB D;  3WAA D;  4J8V D;  3AZJ A;  1BH8 A;  5DNM A;  4E45 A;  5AV8 A;  4XZQ B;  4QLC B;  3LZ0 A;  1P3O C;  3O62 C;  3MGR D;  5B31 C;  1P3F A;  4UUZ B;  3WA9 A;  5F99 D;  1KX4 B;  3LZ1 B;  1HTA A;  3W97 C;  5B2J B;  3B6F B;  1B67 A;  3AZN D;  3AZH B;  3W96 D;  1P3O A;  3O62 A;  1P3B C;  5B31 A;  4YM6 B;  1M19 B;  5B33 C;  3KUY C;  5GXQ B;  3LEL D;  3C1C C;  5AY8 A;  5CPK B;  4X23 B;  3UTA C;  4H9O A;  3B0C T;  5AVB C;  3AV2 B;  3MVD A;  5G49 A;  3X1V B;  3AZG B;  5BNX B;  1ID3 B;  5GT0 A;  3NQU A;  5B33 A;  5AV9 D;  4QLC C;  4XZQ C;  1P34 B;  4H9N B;  1KX5 B;  4H9S C;  3KUY A;  5B1L D;  1P3G A;  3NQJ A;  4ZUX B;  1KX4 C;  3UTA A;  3LZ1 C;  5AVB A;  3AZM D;  5B2J C;  3REI D;  1BH9 B;  3UTB D;  3B6F C;  2NZD A;  2F8N K;  3AZH C;  4QLC A;  4XZQ A;  4YM6 C;  1M19 C;  3AZF B;  3LZ1 A;  3VH6 W;  1JFI B;  1P3P B;  1F66 B;  3AZJ D;  5GXQ C;  3B6F A;  5DNM D;  5CPK C;  5AV8 D;  5E5A C;  4X23 C;  3AZL A;  1HQ3 D;  3KXB B;  3AZH A;  3AV2 C;  3X1V C;  4NFT A;  3WKJ D;  3AZG C;  1ID3 C;  3W99 A;  3MGR B;  1KX5 C;  1P34 C;  2JSS A;  5BS7 C;  5CPK A;  4ZUX C;  4X23 A;  2CV5 A;  3AV2 A;  3X1V A;  3AZN B;  4KGC C;  1ID3 A;  3W96 B;  2BYK B;  1KX3 D;  1AOI D;  1KX5 A;  4H9N A;  3B0B A;  5AY8 D;  3REH D;  5BS7 A;  4E44 A;  3WTP D;  3MVD D;  1P3P C;  1F66 C;  5GT0 D;  1BH9 A;  5DNN A;  3WAA C;  3KXB C;  1U35 D;  1P3G D;  4J8V C;  3R45 B;  3REL D;  1Q9C A;  3AYW B;  1S32 A;  5AV9 B;  3AZF A;  3VH5 T;  5B32 D;  1P3M D;  5B1L B;  3MGR C;  1JFI A;  1F66 A;  2NZD D;  5F99 C;  2ARO D;  3KXB A;  3AZM B;  3UTB B;  3REI B;  5B24 A;  3AZN C;  3W96 C;  5C3I B;  1EQZ D;  3MGR A;  1M18 D;  3AZL D;  1P3K D;  2YFW B;  3AZJ B;  3LEL C;  4H9R A;  5DNM B;  4LD9 D;  5AV8 B;  3W99 D;  3AZN A;  1HQ3 B;  2BYK A;  3REJ D;  4Z5T B;  3WKJ B;  1P3I D;  2CV5 D;  5B2I D;  1B6W A;  3AYW C;  5AV9 C;  1ULY A;  5AV5 D;  4G92 B;  5B1L C;  4NE6 A;  4WV4 B;  2IO5 B;  5B1M D;  3AZM C;  5CP6 A;  1H3O B;  1WWI A;  4HGA B;  3REI C;  3UTB C;  3R45 A;  3AYW A;  4H9Q B;  1KX3 B;  1AOI B;  5AY8 B;  5C3I C;  3REH B;  4H9O B;  3AZE D;  5DNN D;  3WTP B;  3MVD B;  5G49 B;  5JA4 B;  3AZJ C;  5GT0 B;  3REI A;  3NQU B;  5DNM C;  5CPJ B;  1S32 D;  3MGQ D;  5AV8 C;  3AZF D;  1HQ3 C;  1U35 B;  3NQJ B;  3AFA A;  4Z5T C;  3REL B;  3WKJ C;  4JJN D;  5B32 B;  3C1B D;  1P3M B;  5B24 D;  2YFW A;  2NZD B;  4G92 C;  2ARO B;  1HQ3 A;  4Z5T A;  4HGA C;  3WKJ A;  4J8U D;  2NQB D;  1EQZ B;  1KX3 C;  1AOI C;  5AY8 C;  1M18 B;  3REH C;  3AZL B;  1P3K B;  3WTP C;  3MVD C;  4LD9 B;  1H3O A;  5GT0 C;  3W99 B;  5B0Y D;  3X1U B;  3TU4 A;  3REJ B;  1U35 C;  4H9Q A;  1P3G C;  1KX3 A;  1AOI A;  1P3I B;  3REL C;  3REH A;  2CV5 B;  5B2I B;  3AZK D;  1KU5 A;  5B32 C;  5AV5 B;  5CP6 D;  3WTP A;  1P3M C;  5JA4 A;  2NZD C;  2ARO C;  3AYW D;  5CPJ A;  5B1M B;  1U35 A;  1P3L D;  5CHL B;  4EO5 B;  4R8P A;  3REL A;  1ZLA A;  5B32 A;  5AV6 D;  1P3M A;  1EQZ C;  4WNN B;  2F8N G;  3VH6 T;  3AZE B;  1M18 C;  5DNN B;  3AZL C;  2ARO A;  1P3K C;  3AFA D;  1S32 B;  4LD9 C;  3MGQ B;  3W99 C;  3A6N D;  3X1U C;  2CWE A;  4WU9 A;  3REJ C;  4J8X D;  1EQZ A;  1P3I C;  4JJN B;  1TZY D;  3C1B B;  2CV5 C;  5B2I C;  1M18 A;  1P3K A;  5B24 B;  4Z5T D;  5AV5 C;  3X1S D;  5GSU A;  3B0C W;  4LD9 A;  3X1U A;  4ZBJ B;  5CPI D;  5B1M C;  3REJ A;  1P3I A;  4EO5 C;  4J8U B;  5B2I A;  2NQB B;  4H9R B;  5AV5 A;  3TU4 D;  3AZE C;  5DNN C;  3VH5 A;  5KDM A;  5B1M A;  4AWL B;  5B0Y B;  1S32 C;  3MGQ C;  3AZF C;  1R4V A;  4WNN A;  1A7W A;  5CPJ D;  4JJN C;  3AZE A;  3AZK B;  3C1B C;  5CP6 B;  5B24 C;  4R8P D;  1ZLA D;  3AZI B;  3MGQ A;  1P3L B;  4ZBJ C;  4DRA A;  4J8U C;  4JJN A;  1BFM A;  3C1B A;  5AV6 B;  1M1A D;  2NQB C;  5JRG B;  4WU9 D;  3AN2 A;  3X1T A;  3AFA B;  5AVC A;  3MGP D;  3WTP E;  3A6N B;  4AWL C;  5B0Y C;  4J8U A;  3W98 D;  1N1J B;  2NQB A;  4J8X B;  2F8N A;  2HIO D;  5GSU D;  1TZY B;  3X1U D;  3LJA A;  3AZK C;  5CP6 C;  3X1S B;  3MGS D;  5B0Y A;  3AZI C;  4XUJ D;  5CPI B;  4M6B A;  1P3L C;  5B31 G;  2LY8 A;  3AZK A;  3V9R B;  2FJ7 A;  3KWQ D;  5AV6 C;  2HUE B;  3TU4 B;  5JRG C;  3AZI A;  3AFA C;  1P3L A;  3A6N C;  2BYM A;  5AV6 A;  4J8X C;  5BNV A;  2RVQ D;  1TZY C;  5JRG A;  5BT1 D;  4R8P B;  3X1S C;  1ZLA B;  3A6N A;  1N1J A;  5CPI C;  4KHA B;  3B6G A;  4J8X A;  3MNN B;  3X1T D;  1TZY A;  3AN2 D;  5AVC D;  1M1A B;  2PYO D;  2IO5 C;  4NE3 A;  3X1S A;  2HUE C;  3AV1 D;  3TU4 C;  4WU9 B;  3MGP B;  2F8N D;  4WZS B;  5CPI A;  1P3B B;  3REK B;  3LJA D;  3W98 B;  3V9R A;  2HIO B;  5GSU B;  4WU8 A; 
#chains in the Genus database with same CATH topology
 5CPJ C;  3IP4 C;  5B0Z D;  4NE5 A;  1TAF A;  2L5A A;  4KUD D;  4R8P C;  3MGS B;  3VH6 A;  1ZLA C;  2FJ7 D;  4XUJ B;  2ZY3 A;  3H0R C;  3MNN C;  4CAY A;  3AZI D;  5KDM B;  3KWQ B;  1M1A C;  5B40 D;  4WU9 C;  5GT3 D;  3MGP C;  4Z2M G;  4KHA A;  3REK C;  3MNN A;  5JRG D;  1P3A D;  3W98 C;  3KSY A;  1M1A A;  3W97 A;  2HIO C;  2YFV B;  5GSU C;  5E5A B;  3B6G D;  3MGP A;  1P3B A;  3MGS C;  3REK A;  3EPJ A;  3W98 A;  4XUJ C;  4DRB A;  2HIO A;  2XD5 A;  5FUG B;  3C1C A;  3X1T B;  3AN2 B;  5AVC B;  4Z66 B;  2PYO B;  3KWQ C;  3AV1 B;  3MGS A;  3B0D B;  4KGC B;  4J8W D;  4XUJ A;  2F8N B;  3EG5 B;  4H9S A;  4WU8 D;  3LJA B;  4UUZ A;  1KX4 A;  4YS3 D;  3UT9 B;  3KWQ A;  4G91 B;  5B2J A;  2RVQ C;  5B0Z B;  3LZ0 D;  5BT1 C;  3WAA B;  4KUD B;  1P3F D;  3A1I A;  4J8V B;  3WA9 D;  4YM6 A;  2FJ7 B;  3FDD A;  1M19 A;  1F1E A;  2YFV A;  5F99 B;  5GXQ A;  1T3U A;  3X1T C;  3AN2 C;  5AVC C;  4Z66 C;  5E5A A;  2PYO C;  1P3O D;  3O62 D;  5B31 D;  3MNN D;  5B40 B;  3AV1 C;  3B0D C;  3AZG A;  2BYM B;  5BNX A;  3W97 D;  5GT3 B;  5BNV B;  1P34 A;  1P3A B;  5FUG A;  3LJA C;  4ZUX A;  4Z66 A;  4CSR B;  2PYO A;  5BO0 B;  3UT9 C;  3LEL B;  1P3B D;  4G91 C;  3REK D;  3A1K A;  3AV1 A;  4KGC A;  5B33 D;  3B6G B;  5B0Z C;  4KUD C;  3KUY D;  3C1C D;  2JE5 A;  2DF4 C;  3UTA D;  2FJ7 C;  1W2E A;  5AVB D;  3UT9 A;  1P3P A;  4QLC D;  4XZQ D;  5B0Z A;  3WAA A;  4KUD A;  1WWS A;  4J8V A;  3VH5 W;  1KX4 D;  4J8W B;  5B40 C;  3LZ1 D;  5GT3 C;  5B2J D;  4WU8 B;  3B6F D;  5F99 A;  1P3A C;  4YS3 B;  1TAF B;  4H9P B;  3AZH D;  4YM6 D;  1BH8 B;  1M19 D;  5B40 A;  3LZ0 B;  3B6G C;  2J8P A;  1P3F B;  3W96 A;  2Y2I A;  5GT3 A;  3WA9 B;  5GXQ D;  4CAY B;  5CPK D;  1P3A A;  5E5A D;  4X23 D;  5B32 G;  3AV2 D;  4CSR A;  5BO0 A;  3LEL A;  3X1V D;  3AZG D;  1ID3 D;  2Y2H A;  1P3O B;  3O62 B;  2Y2J A;  5B31 B;  1P34 D;  1KX5 D;  4Z2M H;  2F8N H;  4ZUX D;  4Z66 D;  4J8W C;  3W97 B;  2UWX A;  5AV9 A;  4WU8 C;  5B1L A;  4KGC D;  2JCH A;  2G5I C;  4YS3 C;  2ZY2 A;  3AZM A;  3UTB A;  5B33 B;  4J8W A;  3LZ0 C;  3UT9 D;  3KUY B;  1P3G B;  1P3F C;  3C1C B;  1P3P D;  1F66 D;  3WA9 C;  3UTA B;  5AVB B;  4YS3 A;  2BG1 A;  4H9P A;  3KXB D;  3WAA D;  4J8V D;  3AZJ A;  1BH8 A;  5DNM A;  4E45 A;  5AV8 A;  4XZQ B;  4QLC B;  3LZ0 A;  1P3O C;  3O62 C;  3MGR D;  5B31 C;  3EPL A;  1P3F A;  4UUZ B;  3WA9 A;  5F99 D;  1KX4 B;  3LZ1 B;  1HTA A;  3W97 C;  3F6T A;  5B2J B;  3B6F B;  1B67 A;  2XD1 A;  2Y2G A;  3AZN D;  3AZH B;  3W96 D;  1P3O A;  3O62 A;  1P3B C;  5B31 A;  4YM6 B;  2Y2O A;  1M19 B;  5B33 C;  4UPK A;  5GXQ B;  3LEL D;  3KUY C;  3C1C C;  5AY8 A;  5CPK B;  4X23 B;  3UTA C;  4H9O A;  3B0C T;  5AVB C;  3AV2 B;  3MVD A;  5G49 A;  3X1V B;  3AZG B;  5BNX B;  1ID3 B;  5GT0 A;  3NQU A;  5B33 A;  3KFU G;  5AV9 D;  4QLC C;  4XZQ C;  1P34 B;  4H9N B;  1KX5 B;  4H9S C;  3KUY A;  5B1L D;  1P3G A;  3NQJ A;  4ZUX B;  1KX4 C;  3UTA A;  3LZ1 C;  5AVB A;  3EPK A;  3AZM D;  5B2J C;  3REI D;  1BH9 B;  3UTB D;  3B6F C;  2Y2N A;  2NZD A;  2F8N K;  3AZH C;  4QLC A;  4XZQ A;  2G5H C;  4YM6 C;  1M19 C;  3AZF B;  3LZ1 A;  3VH6 W;  1JFI B;  1P3P B;  1F66 B;  3AZJ D;  5GXQ C;  3B6F A;  5DNM D;  5CPK C;  5AV8 D;  5E5A C;  4X23 C;  3AZL A;  1HQ3 D;  3KXB B;  3AZH A;  3AV2 C;  3X1V C;  4NFT A;  3WKJ D;  3AZG C;  1ID3 C;  3W99 A;  3MGR B;  1KX5 C;  1P34 C;  2JSS A;  5BS7 C;  5CPK A;  4ZUX C;  4X23 A;  2CV5 A;  3AV2 A;  3X1V A;  3AZN B;  4KGC C;  1ID3 A;  3W96 B;  2BYK B;  1KX3 D;  1AOI D;  1KX5 A;  4H9N A;  3B0B A;  5AY8 D;  3REH D;  5BS7 A;  4E44 A;  3WTP D;  3AL0 C;  3MVD D;  1P3P C;  1F66 C;  5GT0 D;  1BH9 A;  2ZY5 A;  3WAA C;  5DNN A;  3KXB C;  1U35 D;  1P3G D;  4J8V C;  3R45 B;  3REL D;  1Q9C A;  3AYW B;  1S32 A;  5AV9 B;  3AZF A;  3VH5 T;  5B32 D;  4WJ3 C;  1P3M D;  5B1L B;  3MGR C;  2Y2L A;  1JFI A;  1F66 A;  2NZD D;  5F99 C;  2ARO D;  3KXB A;  3AZM B;  3UTB B;  3REI B;  5B24 A;  3AZN C;  2W8S A;  3W96 C;  2Y2P A;  5C3I B;  1EQZ D;  3MGR A;  1M18 D;  3AZL D;  1P3K D;  2YFW B;  3AZJ B;  3LEL C;  4H9R A;  5DNM B;  4LD9 D;  5AV8 B;  3W99 D;  3AZN A;  1HQ3 B;  2BYK A;  3REJ D;  4Z5T B;  3WKJ B;  1P3I D;  2CV5 D;  5B2I D;  1B6W A;  3AYW C;  5AV9 C;  1ULY A;  5AV5 D;  4G92 B;  5B1L C;  4NE6 A;  4WV4 B;  2IO5 B;  5B1M D;  3AZM C;  5CP6 A;  1H3O B;  1WWI A;  4HGA B;  3REI C;  3UTB C;  3R45 A;  3AYW A;  4H9Q B;  1KX3 B;  1AOI B;  5AY8 B;  5C3I C;  3REH B;  4H9O B;  3AZE D;  5DNN D;  3WTP B;  3MVD B;  5G49 B;  5JA4 B;  3AZJ C;  5GT0 B;  3REI A;  3NQU B;  5DNM C;  2RIQ A;  5CPJ B;  3MGQ D;  5AV8 C;  3AZF D;  1S32 D;  1HQ3 C;  1U35 B;  3NQJ B;  3AFA A;  4Z5T C;  3REL B;  3WKJ C;  4JJN D;  5B32 B;  3C1B D;  1P3M B;  5B24 D;  2YFW A;  2NZD B;  4G92 C;  2ARO B;  2Y2K A;  1HQ3 A;  4Z5T A;  4HGA C;  3WKJ A;  4J8U D;  2NQB D;  1EQZ B;  1KX3 C;  1AOI C;  5AY8 C;  1M18 B;  3REH C;  3AZL B;  1P3K B;  3WTP C;  3MVD C;  4LD9 B;  1H3O A;  5GT0 C;  3W99 B;  5B0Y D;  3X1U B;  3TU4 A;  3REJ B;  1U35 C;  4H9Q A;  1P3G C;  1KX3 A;  1AOI A;  1P3I B;  3REL C;  3REH A;  2CV5 B;  5B2I B;  3AZK D;  1KU5 A;  5B32 C;  5AV5 B;  5CP6 D;  3WTP A;  1P3M C;  5JA4 A;  2NZD C;  2ARO C;  3AYW D;  5CPJ A;  5B1M B;  1U35 A;  1P3L D;  3H0L C;  5CHL B;  4EO5 B;  4R8P A;  3REL A;  1ZLA A;  5B32 A;  3P5J B;  5AV6 D;  1P3M A;  1EQZ C;  4WNN B;  2F8N G;  3VH6 T;  3AZE B;  1M18 C;  2DQN C;  5DNN B;  2ARO A;  3AZL C;  3H0M C;  1P3K C;  3AFA D;  1S32 B;  4LD9 C;  2Y2Q A;  3MGQ B;  3W99 C;  3A6N D;  2CWE A;  3X1U C;  4WU9 A;  3REJ C;  4J8X D;  2Y2M A;  1EQZ A;  1P3I C;  4JJN B;  1TZY D;  3C1B B;  2CV5 C;  5B2I C;  1M18 A;  1P3K A;  5B24 B;  4Z5T D;  5AV5 C;  3X1S D;  5GSU A;  3B0C W;  4LD9 A;  3X1U A;  4ZBJ B;  5CPI D;  5B1M C;  3REJ A;  1P3I A;  4EO5 C;  4J8U B;  5B2I A;  2NQB B;  4H9R B;  5AV5 A;  2F2A C;  3TU4 D;  3AZE C;  5DNN C;  3VH5 A;  5KDM A;  5B1M A;  4AWL B;  5B0Y B;  1S32 C;  3MGQ C;  3AZF C;  1R4V A;  4WNN A;  1A7W A;  5CPJ D;  4JJN C;  3AZE A;  3AZK B;  3C1B C;  5CP6 B;  5B24 C;  4R8P D;  1ZLA D;  3AZI B;  2VQR A;  3MGQ A;  1P3L B;  4ZBJ C;  4DRA A;  4J8U C;  4JJN A;  1BFM A;  3C1B A;  5AV6 B;  1M1A D;  1PZR A;  2NQB C;  5JRG B;  4WU9 D;  3AN2 A;  3X1T A;  3AFA B;  5AVC A;  3MGP D;  3WTP E;  3A6N B;  4AWL C;  5B0Y C;  4J8U A;  3W98 D;  1N1J B;  2ZY4 A;  4J8X B;  2NQB A;  2F8N A;  2HIO D;  1Z2C B;  5GSU D;  1TZY B;  3X1U D;  3LJA A;  3AZK C;  4DQY B;  5CP6 C;  3X1S B;  3MGS D;  5B0Y A;  3AZI C;  4XUJ D;  5CPI B;  4M6B A;  1P3L C;  2FFF B;  5B31 G;  2LY8 A;  3AZK A;  3V9R B;  2FJ7 A;  3KWQ D;  5AV6 C;  2HUE B;  3TU4 B;  5JRG C;  3AZI A;  3AFA C;  1P3L A;  3A6N C;  2BYM A;  5AV6 A;  4J8X C;  5BNV A;  2RVQ D;  1TZY C;  5JRG A;  5BT1 D;  4R8P B;  3X1S C;  1ZLA B;  3A6N A;  1N1J A;  5CPI C;  4KHA B;  3B6G A;  4J8X A;  3MNN B;  3X1T D;  1TZY A;  3AN2 D;  5AVC D;  1M1A B;  2PYO D;  3EPH A;  2IO5 C;  4NE3 A;  3X1S A;  2HUE C;  3AV1 D;  3TU4 C;  4WU9 B;  3MGP B;  2F8N D;  4WZS B;  5CPI A;  1P3B B;  3REK B;  3LJA D;  3W98 B;  3V9R A;  2HIO B;  5GSU B;  4WU8 A;  2ZM5 A; 
#chains in the Genus database with same CATH homology
 5CPJ C;  3IP4 C;  5B0Z D;  4NE5 A;  1TAF A;  2L5A A;  4KUD D;  4R8P C;  3MGS B;  3VH6 A;  1ZLA C;  2FJ7 D;  4XUJ B;  2ZY3 A;  3H0R C;  3MNN C;  4CAY A;  3AZI D;  5KDM B;  3KWQ B;  1M1A C;  5B40 D;  4WU9 C;  5GT3 D;  3MGP C;  4Z2M G;  4KHA A;  3REK C;  3MNN A;  5JRG D;  1P3A D;  3W98 C;  3KSY A;  1M1A A;  3W97 A;  2HIO C;  2YFV B;  5GSU C;  5E5A B;  3B6G D;  3MGP A;  1P3B A;  3MGS C;  3REK A;  3EPJ A;  3W98 A;  4XUJ C;  4DRB A;  2HIO A;  2XD5 A;  5FUG B;  3C1C A;  3X1T B;  3AN2 B;  5AVC B;  4Z66 B;  2PYO B;  3KWQ C;  3AV1 B;  3MGS A;  3B0D B;  4KGC B;  4J8W D;  4XUJ A;  2F8N B;  3EG5 B;  4H9S A;  4WU8 D;  3LJA B;  4UUZ A;  1KX4 A;  4YS3 D;  3UT9 B;  3KWQ A;  4G91 B;  5B2J A;  2RVQ C;  5B0Z B;  3LZ0 D;  5BT1 C;  3WAA B;  4KUD B;  1P3F D;  3A1I A;  4J8V B;  3WA9 D;  4YM6 A;  2FJ7 B;  3FDD A;  1M19 A;  1F1E A;  2YFV A;  5F99 B;  5GXQ A;  1T3U A;  3X1T C;  3AN2 C;  5AVC C;  4Z66 C;  5E5A A;  2PYO C;  1P3O D;  3O62 D;  5B31 D;  3MNN D;  5B40 B;  3AV1 C;  3B0D C;  3AZG A;  2BYM B;  5BNX A;  3W97 D;  5GT3 B;  5BNV B;  1P34 A;  1P3A B;  5FUG A;  3LJA C;  4ZUX A;  4Z66 A;  4CSR B;  2PYO A;  5BO0 B;  3UT9 C;  3LEL B;  1P3B D;  4G91 C;  3REK D;  3A1K A;  3AV1 A;  4KGC A;  5B33 D;  3B6G B;  5B0Z C;  4KUD C;  3KUY D;  3C1C D;  2JE5 A;  2DF4 C;  3UTA D;  2FJ7 C;  1W2E A;  5AVB D;  3UT9 A;  1P3P A;  4QLC D;  4XZQ D;  5B0Z A;  3WAA A;  4KUD A;  1WWS A;  4J8V A;  3VH5 W;  1KX4 D;  4J8W B;  5B40 C;  3LZ1 D;  5GT3 C;  5B2J D;  4WU8 B;  3B6F D;  5F99 A;  1P3A C;  4YS3 B;  1TAF B;  4H9P B;  3AZH D;  4YM6 D;  1BH8 B;  1M19 D;  5B40 A;  3LZ0 B;  3B6G C;  2J8P A;  1P3F B;  3W96 A;  2Y2I A;  5GT3 A;  3WA9 B;  5GXQ D;  4CAY B;  5CPK D;  1P3A A;  5E5A D;  4X23 D;  5B32 G;  3AV2 D;  4CSR A;  5BO0 A;  3LEL A;  3X1V D;  3AZG D;  1ID3 D;  2Y2H A;  1P3O B;  3O62 B;  2Y2J A;  5B31 B;  1P34 D;  1KX5 D;  4Z2M H;  2F8N H;  4ZUX D;  4Z66 D;  4J8W C;  3W97 B;  2UWX A;  5AV9 A;  4WU8 C;  5B1L A;  4KGC D;  2JCH A;  2G5I C;  4YS3 C;  2ZY2 A;  3AZM A;  3UTB A;  5B33 B;  4J8W A;  3LZ0 C;  3UT9 D;  3KUY B;  1P3G B;  1P3F C;  3C1C B;  1P3P D;  1F66 D;  3WA9 C;  3UTA B;  5AVB B;  4YS3 A;  2BG1 A;  4H9P A;  3KXB D;  3WAA D;  4J8V D;  3AZJ A;  1BH8 A;  5DNM A;  4E45 A;  5AV8 A;  4XZQ B;  4QLC B;  3LZ0 A;  1P3O C;  3O62 C;  3MGR D;  5B31 C;  3EPL A;  1P3F A;  4UUZ B;  3WA9 A;  5F99 D;  1KX4 B;  3LZ1 B;  1HTA A;  3W97 C;  3F6T A;  5B2J B;  3B6F B;  1B67 A;  2XD1 A;  2Y2G A;  3AZN D;  3AZH B;  3W96 D;  1P3O A;  3O62 A;  1P3B C;  5B31 A;  4YM6 B;  2Y2O A;  1M19 B;  5B33 C;  4UPK A;  5GXQ B;  3LEL D;  3KUY C;  3C1C C;  5AY8 A;  5CPK B;  4X23 B;  3UTA C;  4H9O A;  3B0C T;  5AVB C;  3AV2 B;  3MVD A;  5G49 A;  3X1V B;  3AZG B;  5BNX B;  1ID3 B;  5GT0 A;  3NQU A;  5B33 A;  3KFU G;  5AV9 D;  4QLC C;  4XZQ C;  1P34 B;  4H9N B;  1KX5 B;  4H9S C;  3KUY A;  5B1L D;  1P3G A;  3NQJ A;  4ZUX B;  1KX4 C;  3UTA A;  3LZ1 C;  5AVB A;  3EPK A;  3AZM D;  5B2J C;  3REI D;  1BH9 B;  3UTB D;  3B6F C;  2Y2N A;  2NZD A;  2F8N K;  3AZH C;  4QLC A;  4XZQ A;  2G5H C;  4YM6 C;  1M19 C;  3AZF B;  3LZ1 A;  3VH6 W;  1JFI B;  1P3P B;  1F66 B;  3AZJ D;  5GXQ C;  3B6F A;  5DNM D;  5CPK C;  5AV8 D;  5E5A C;  4X23 C;  3AZL A;  1HQ3 D;  3KXB B;  3AZH A;  3AV2 C;  3X1V C;  4NFT A;  3WKJ D;  3AZG C;  1ID3 C;  3W99 A;  3MGR B;  1KX5 C;  1P34 C;  2JSS A;  5BS7 C;  5CPK A;  4ZUX C;  4X23 A;  2CV5 A;  3AV2 A;  3X1V A;  3AZN B;  4KGC C;  1ID3 A;  3W96 B;  2BYK B;  1KX3 D;  1AOI D;  1KX5 A;  4H9N A;  3B0B A;  5AY8 D;  3REH D;  5BS7 A;  4E44 A;  3WTP D;  3AL0 C;  3MVD D;  1P3P C;  1F66 C;  5GT0 D;  1BH9 A;  2ZY5 A;  3WAA C;  5DNN A;  3KXB C;  1U35 D;  1P3G D;  4J8V C;  3R45 B;  3REL D;  1Q9C A;  3AYW B;  1S32 A;  5AV9 B;  3AZF A;  3VH5 T;  5B32 D;  4WJ3 C;  1P3M D;  5B1L B;  3MGR C;  2Y2L A;  1JFI A;  1F66 A;  2NZD D;  5F99 C;  2ARO D;  3KXB A;  3AZM B;  3UTB B;  3REI B;  5B24 A;  3AZN C;  2W8S A;  3W96 C;  2Y2P A;  5C3I B;  1EQZ D;  3MGR A;  1M18 D;  3AZL D;  1P3K D;  2YFW B;  3AZJ B;  3LEL C;  4H9R A;  5DNM B;  4LD9 D;  5AV8 B;  3W99 D;  3AZN A;  1HQ3 B;  2BYK A;  3REJ D;  4Z5T B;  3WKJ B;  1P3I D;  2CV5 D;  5B2I D;  1B6W A;  3AYW C;  5AV9 C;  1ULY A;  5AV5 D;  4G92 B;  5B1L C;  4NE6 A;  4WV4 B;  2IO5 B;  5B1M D;  3AZM C;  5CP6 A;  1H3O B;  1WWI A;  4HGA B;  3REI C;  3UTB C;  3R45 A;  3AYW A;  4H9Q B;  1KX3 B;  1AOI B;  5AY8 B;  5C3I C;  3REH B;  4H9O B;  3AZE D;  5DNN D;  3WTP B;  3MVD B;  5G49 B;  5JA4 B;  3AZJ C;  5GT0 B;  3REI A;  3NQU B;  5DNM C;  2RIQ A;  5CPJ B;  3MGQ D;  5AV8 C;  3AZF D;  1S32 D;  1HQ3 C;  1U35 B;  3NQJ B;  3AFA A;  4Z5T C;  3REL B;  3WKJ C;  4JJN D;  5B32 B;  3C1B D;  1P3M B;  5B24 D;  2YFW A;  2NZD B;  4G92 C;  2ARO B;  2Y2K A;  1HQ3 A;  4Z5T A;  4HGA C;  3WKJ A;  4J8U D;  2NQB D;  1EQZ B;  1KX3 C;  1AOI C;  5AY8 C;  1M18 B;  3REH C;  3AZL B;  1P3K B;  3WTP C;  3MVD C;  4LD9 B;  1H3O A;  5GT0 C;  3W99 B;  5B0Y D;  3X1U B;  3TU4 A;  3REJ B;  1U35 C;  4H9Q A;  1P3G C;  1KX3 A;  1AOI A;  1P3I B;  3REL C;  3REH A;  2CV5 B;  5B2I B;  3AZK D;  1KU5 A;  5B32 C;  5AV5 B;  5CP6 D;  3WTP A;  1P3M C;  5JA4 A;  2NZD C;  2ARO C;  3AYW D;  5CPJ A;  5B1M B;  1U35 A;  1P3L D;  3H0L C;  5CHL B;  4EO5 B;  4R8P A;  3REL A;  1ZLA A;  5B32 A;  3P5J B;  5AV6 D;  1P3M A;  1EQZ C;  4WNN B;  2F8N G;  3VH6 T;  3AZE B;  1M18 C;  2DQN C;  5DNN B;  2ARO A;  3AZL C;  3H0M C;  1P3K C;  3AFA D;  1S32 B;  4LD9 C;  2Y2Q A;  3MGQ B;  3W99 C;  3A6N D;  2CWE A;  3X1U C;  4WU9 A;  3REJ C;  4J8X D;  2Y2M A;  1EQZ A;  1P3I C;  4JJN B;  1TZY D;  3C1B B;  2CV5 C;  5B2I C;  1M18 A;  1P3K A;  5B24 B;  4Z5T D;  5AV5 C;  3X1S D;  5GSU A;  3B0C W;  4LD9 A;  3X1U A;  4ZBJ B;  5CPI D;  5B1M C;  3REJ A;  1P3I A;  4EO5 C;  4J8U B;  5B2I A;  2NQB B;  4H9R B;  5AV5 A;  2F2A C;  3TU4 D;  3AZE C;  5DNN C;  3VH5 A;  5KDM A;  5B1M A;  4AWL B;  5B0Y B;  1S32 C;  3MGQ C;  3AZF C;  1R4V A;  4WNN A;  1A7W A;  5CPJ D;  4JJN C;  3AZE A;  3AZK B;  3C1B C;  5CP6 B;  5B24 C;  4R8P D;  1ZLA D;  3AZI B;  2VQR A;  3MGQ A;  1P3L B;  4ZBJ C;  4DRA A;  4J8U C;  4JJN A;  1BFM A;  3C1B A;  5AV6 B;  1M1A D;  1PZR A;  2NQB C;  5JRG B;  4WU9 D;  3AN2 A;  3X1T A;  3AFA B;  5AVC A;  3MGP D;  3WTP E;  3A6N B;  4AWL C;  5B0Y C;  4J8U A;  3W98 D;  1N1J B;  2ZY4 A;  4J8X B;  2NQB A;  2F8N A;  2HIO D;  1Z2C B;  5GSU D;  1TZY B;  3X1U D;  3LJA A;  3AZK C;  4DQY B;  5CP6 C;  3X1S B;  3MGS D;  5B0Y A;  3AZI C;  4XUJ D;  5CPI B;  4M6B A;  1P3L C;  2FFF B;  5B31 G;  2LY8 A;  3AZK A;  3V9R B;  2FJ7 A;  3KWQ D;  5AV6 C;  2HUE B;  3TU4 B;  5JRG C;  3AZI A;  3AFA C;  1P3L A;  3A6N C;  2BYM A;  5AV6 A;  4J8X C;  5BNV A;  2RVQ D;  1TZY C;  5JRG A;  5BT1 D;  4R8P B;  3X1S C;  1ZLA B;  3A6N A;  1N1J A;  5CPI C;  4KHA B;  3B6G A;  4J8X A;  3MNN B;  3X1T D;  1TZY A;  3AN2 D;  5AVC D;  1M1A B;  2PYO D;  3EPH A;  2IO5 C;  4NE3 A;  3X1S A;  2HUE C;  3AV1 D;  3TU4 C;  4WU9 B;  3MGP B;  2F8N D;  4WZS B;  5CPI A;  1P3B B;  3REK B;  3LJA D;  3W98 B;  3V9R A;  2HIO B;  5GSU B;  4WU8 A;  2ZM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...