1B6WA

Crystal structure of the selenomethionine variant of histone hmfb from methanothermus fervidus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE HMFB)
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Dna binding protein
total genus 22
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1b6wA00
4CSRA 5BO0B 3AYWD 2NZDA 1TZYA 5GSUA 4KGCA 3REKA 3O62A 5E5AD 5B32D 2F8NH 3AZLB 4CSRB 3WAAC 1P3AA 4DRAA 3MNNB 2YFWB 5AV9A 3X1UB 1H3OA 3B0BA 3AZNB 4KHAA 4UUZB 3W96A 2FJ7B 5B2JB 3LZ0C 3A6ND 3MNND 3X1VA 5AV8B 4XUJA 4YM6D 3KXBA 1P3OC 5JA4B 5CP6C 1P34C 1ID3C 1U35C 4H9OA 1P3BB 1KX4C 5CPJC 4YS3B 3WKJB 3UTBA 5B33C 4Z2MH 5B2JD 5DNNB 4J8XA 3AZIC 5B0ZD 3AZGD 3AFAA 1BH8B 1P3BD 5B24B 5AV6C 3X1SB 1P3FB 4KUDA 3RELC 3X1TA 4JJND 3C1BD 3KUYA 3AYWC 4Z66B 5DNND 1AOIA 5B1LA 1EQZD 3AV1A 3REHA 5E5AC 5B32C 3AN2B 5GXQA 2BYMB 5GT0A 1F66A 5B1MB 5BNVB 3B0CW 3AV2B 5DNMA 2CV5D 1M1AD 3W98B 3AZFB 5GT3B 5FUGA 1P3KD 4ZUXA 3W99B 3MNNC 3AZHD 2YFVA 3REJD 3REIA 3B6GB 1M19A 4YM6C 3VH6W 5GT3D 5AY8D 5JRGA 5CPKA 5G49A 5B40D 5B2JC 3MGQB 3UT9A 3B6GD 4R8PB 1BFMA 5B0ZC 3LZ1B 4J8UB 2HIOA 1P3MD 1P3BC 4Z5TB 3VH5T 2PYOA 3UT9B 5CPIB 4G92C 4H9NB 3LELA 4JJNC 3C1BC 4R8PD 5DNNC 4NE3A 5KDMB 4QLCB 5B2ID 3W97D 2BYKB 5BS7A 5AVBA 3MGSA 2F8ND 3UTAB 2NQBB 5B24C 1P3FC 3C1CA 4M6BA 4X23B 5B32G 3MGRD 2CV5C 1M1AC 5BNXA 4LD9A 4WV4B 1P3KC 1JFIA 3MVDB 3AZEA 1N1JB 1P3IB 5B31D 3REJC 3AZHC 2AROB 4J8WD 3WA9D 5C3IC 5F99B 5GT3C 3AZJA 5AY8C 3WAAA 1KX5D 4DRBA 3B6GC 3AZJB 1P3MC 3LZ0A 3WTPB 3MGPA 3AZMB 3R45B 1P3OA 5CP6A 1P34A 4ZBJC 5B33D 4R8PC 3LJAB 1U35A 1KX4A 3AZKB 5B2IC 4WZSB 3W97C 3LZ1C 4WU8D 3WTPD 5AVCD 3AZMD 4H9QB 1M18B 3AZIA 5CPIC 4WU9A 1P3LB 4QLCC 5AV6A 3MGRC 3TU4B 3RELA 3UTAC 1P3PB 1HQ3D 5B0YB 3B6FB 4J8VA 5B31C 3KWQD 4J8WC 3WA9C 2NZDB 3RELD 5B32A 3TU4D 1TZYB 5GSUB 3KSYA 4KGCB 1KX5C 3REKB 3B6FD 3O62B 4WNNA 1P3AB 3AZLD 1P3IC 4G91B 3NQUA 4HGAB 5AV9B 5F99C 3X1UD 1H3OB 3A6NA 2CWEA 4KHAB 3AZND 3W96B 2FJ7D 3X1VB 4XUJB 5AV8D 4WU8C 3KXBB 3WTPC 5AVCC 3AZMC 4H9OB 3W96D 2F8NG 5B0ZA 3UTBB 3AZGA 4YS3D 3WKJD 4E45A 3X1VD 3B0DC 4J8XB 4XUJD 3AFAB 4JJNA 1HQ3C 3V9RA 3C1BA 4KUDB 5B24D 3X1SD 1P3FD 4H9PA 1EQZA 1P3LC 3X1TB 3KWQC 3KUYB 3TU4C 1AOIB 5B1LB 5AV5A 3VH5W 4Z66D 1WWSA 1P3PC 1HTAA 5B31G 3NQJA 5B0YC 3B6FC 3AV1B 3REHB 2CV5A 5GXQB 3AZLC 4Z2MG 3X1TD 3AN2D 5GT0B 3KUYD 5AV5B 1P3KA 4AWLB 1F66B 5DNMB 4XZQA 5B1MD 3X1UC 1BH9A 3AV2D 4KGCC 3AZHA 3REJA 3W98D 3AZFD 5FUGB 3AV1D 3AZNC 4ZUXB 4NFTA 3W99D 2FJ7C 2YFVB 4XZQB 3REIB 4HGAC 1M19B 5AV8C 5B40A 4NE5A 2LY8A 5JRGB 5CPKB 3W96C 5G49B 1R4VA 4YS3C 1P3MA 1ZLAA 3WKJC 3MGQD 3X1VC 4XUJC 1M19D 4H9RA 2HIOB 1P3GA 3LZ1D 4J8UD 1S32A 1KX3A 2PYOB 3X1SC 4Z5TD 5B2IA 3W97A 2F8NA 4H9SA 3LELB 3UT9D 5CPID 4Z66C 4QLCD 5AVBB 3MGSB 1S32B 2NQBD 3UTAD 3MGRA 4EO5B 3C1CB 3X1TC 1B67A 3AN2C 3KUYC 5B1MC 4X23D 3AV2C 5BNXB 3MGSD 4LD9B 5B31A 3W98C 3AZFC 4J8WA 3AV1C 3WA9A 1JFIB 3VH6A 3AZEB 3MVDD 3W99C 2HUEB 1KX5A 1P3ID 5DNMC 2AROD 3WAAB 5F99D 3AZED 3MGQC 3WTPE 1M19C 1ID3A 5CPJA 3AZJD 3LZ0B 5B33A 3MGPB 4J8UC 5CPKC 4Z5TC 2RVQD 4WU8A 3UT9C 1P3OB 5CP6B 5AVCA 1P34B 1U35B 1KX4B 3LJAD 3AZKD 4CAYA 2NQBC 1F1EA 3AYWA 3AZIB 1M18D 4WU9B 3LELC 1HQ3A 1P3LD 5AV6B 1TAFA 4X23C 5E5AA 3MGSC 3RELB 1P3PD 3AYWB 5CHLB 5B0YD 5BO0A 4J8VB 3MVDC 4WU9D 2AROC 5B32B 2NZDD 2JSSA 3AZLA 1TZYD 5GSUD 4KGCD 3MNNA 3REKD 3O62D 3AZEC 4J8VD 3X1UA 2YFWA 4WNNB 4YM6A 2HUEC 1P3AD 3NQUB 3AZNA 5AV9D 4UUZA 3AZJC 3A6NB 5B2JA 2FJ7A 2IO5B 1Q9CA 2RVQC 4YM6B 5AV8A 5JA4A 1P3BA 3LJAC 3AZKC 1KU5A 4YS3A 3WKJA 3KXBD 3MGPC 5DNNA 5B0ZB 3AZGB 1M18C 3UTBD 1BH8A 3X1SA 5B24A 1P3FA 4J8XD 4G92B 4JJNB 3V9RB 3C1BB 3AFAD 4Z66A 4KUDD 4H9PB 4WU9C 1EQZB 1M1AA 2NZDC 1AOID 1TZYC 5B1LD 3NQJB 5GSUC 3AN2A 3REKC 2BYMA 3O62C 2CV5B 5B1MA 5BNVA 4J8VC 3REHD 3AV2A 1M1AB 3W98A 5GXQD 3AZFA 5GT3A 1P3AC 5AY8A 4G91C 1P3KB 5GT0D 5AV5D 1F66D 5AV9C 1BH9B 5DNMD 3W99A 3AZHB 1ULYA 3REJB 3B6GA 4E44A 5C3IB 4ZUXD 5AY8B 4XZQD 5B40B 3REID 3KXBC 3A6NC 3MGQA 2F8NK 2IO5C 5JRGD 4R8PA 5CPKD 1P3MB 1ZLAB 3UTBC 3LZ1A 5BT1D 4J8UA 4Z5TA 4H9RB 4J8XC 5CPIA 1P3GB 3AFAC 4H9NA 2HIOD 4ZBJB 1KX3B 3VH5A 5B2IB 4KUDC 4QLCA 5KDMA 4NE6A 3AZGC 2F8NB 2PYOD 1ZLAD 3W97B 2BYKA 2NQBA 3B0CT 3UTAA 3LELD 1AOIC 5B1LC 1P3GD 5AVBD 1S32D 1KX3D 3MGRB 4X23A 3REHC 1EQZC 1A7WA 3C1CD 5GXQC 5GT0C 5AV5C 1F66C 4AWLC 3VH6T 3MVDA 5B31B 4LD9D 1N1JA 4J8WB 1P3IA 3WA9B 2AROA 4ZUXC 5F99A 1KX5B 4XZQC 3REIC 3WAAD 5JRGC 5BT1C 3WTPA 3AZMA 1ID3B 5B40C 5CPJB 5B33B 2HIOC 3R45A 3LZ0D 3MGPD 3LJAA 2PYOC 3AZKA 4WU8B 1ZLAC 5AVCB 1P3OD 5CP6D 1P34D 1ID3D 1U35D 4H9QA 1KX4D 1M18A 5CPJD 4CAYB 5AVBC 5BS7C 1P3GC 1S32C 1P3LA 1B6WA 1KX3C 3KWQA 2L5AA 3B0DB 4H9SC 4EO5C 3C1CC 3TU4A 3AZID 1HQ3B 1P3PA 5B0YA 1TAFB 3B6FA 5AV6D 5E5AB 1WWIA 4LD9C 3KWQB
chains in the Genus database with same CATH superfamily
4CSRA 5BO0B 3AYWD 2UWXA 2NZDA 1TZYA 5GSUA 4KGCA 3REKA 3O62A 3H0RC 5E5AD 5B32D 2F8NH 3AZLB 4CSRB 3WAAC 1P3AA 4DRAA 3MNNB 2YFWB 5AV9A 3X1UB 1H3OA 3B0BA 3AZNB 2Y2PA 4KHAA 4UUZB 3W96A 2FJ7B 5B2JB 3LZ0C 3A6ND 3MNND 3X1VA 5AV8B 4XUJA 4YM6D 3KXBA 1P3OC 5JA4B 5CP6C 1P34C 1ID3C 1U35C 4H9OA 1P3BB 1KX4C 5CPJC 4YS3B 3WKJB 3UTBA 5B33C 4Z2MH 5B2JD 2G5IC 5DNNB 4J8XA 3AZIC 5B0ZD 3AZGD 3AFAA 1BH8B 1P3BD 2ZY2A 2DF4C 5AV6C 5B24B 3X1SB 1P3FB 4KUDA 3RELC 3X1TA 4JJND 3C1BD 3KUYA 3AYWC 4Z66B 5DNND 1AOIA 5B1LA 1EQZD 3AV1A 3REHA 5E5AC 5B32C 3AN2B 5GXQA 2BYMB 5GT0A 1F66A 5B1MB 5BNVB 3B0CW 3AV2B 5DNMA 2CV5D 1M1AD 3W98B 3AZFB 5GT3B 2Y2LA 5FUGA 1P3KD 4ZUXA 3W99B 3MNNC 3AZHD 2J8PA 2YFVA 3REIA 3REJD 3B6GB 1M19A 4YM6C 3VH6W 5GT3D 5AY8D 5JRGA 5CPKA 5G49A 5B40D 2ZM5A 5B2JC 3MGQB 3UT9A 3B6GD 4R8PB 1BFMA 5B0ZC 3LZ1B 4J8UB 2HIOA 1P3MD 1P3BC 4Z5TB 3VH5T 2PYOA 3UT9B 5CPIB 4G92C 4H9NB 3LELA 4JJNC 3C1BC 4R8PD 5DNNC 4NE3A 5KDMB 4QLCB 5B2ID 3W97D 2BYKB 5BS7A 5AVBA 3MGSA 2F8ND 3UTAB 2NQBB 5B24C 1P3FC 3C1CA 4M6BA 4X23B 5B32G 3IP4C 3MGRD 2CV5C 1M1AC 5BNXA 4UPKA 4LD9A 4WV4B 1P3KC 1JFIA 3MVDB 3AZEA 1N1JB 1P3IB 5B31D 3REJC 3AZHC 2AROB 4J8WD 3WA9D 2W8SA 2Y2GA 5C3IC 5F99B 5GT3C 3AZJA 5AY8C 3WAAA 1KX5D 4DRBA 3B6GC 4DQYB 3AZJB 1P3MC 3LZ0A 3WTPB 3MGPA 3H0MC 3AZMB 3R45B 1P3OA 5CP6A 1P34A 4ZBJC 5B33D 4R8PC 3LJAB 3F6TA 1U35A 3AZKB 1KX4A 5B2IC 4WZSB 3W97C 3LZ1C 4WU8D 3WTPD 5AVCD 3AZMD 4H9QB 1M18B 3AZIA 5CPIC 4WU9A 1P3LB 4QLCC 5AV6A 3MGRC 3TU4B 3RELA 3UTAC 1P3PB 3KFUG 1HQ3D 5B0YB 3B6FB 2Y2NA 4J8VA 5B31C 3EPKA 2XD5A 3KWQD 4J8WC 3WA9C 3RELD 2NZDB 5B32A 3TU4D 1TZYB 5GSUB 3KSYA 4KGCB 1KX5C 3REKB 3B6FD 3O62B 2Y2JA 4WNNA 1P3AB 3AZLD 1P3IC 4G91B 3A1IA 3NQUA 4HGAB 5AV9B 5F99C 3X1UD 1H3OB 3A6NA 2CWEA 4KHAB 3AZND 3W96B 3H0LC 2FJ7D 3X1VB 4XUJB 5AV8D 4WU8C 3KXBB 3WTPC 5AVCC 3AZMC 4H9OB 3FDDA 3W96D 2F8NG 5B0ZA 3UTBB 3AZGA 4YS3D 3WKJD 4E45A 3X1VD 3B0DC 4J8XB 1W2EA 4XUJD 3AFAB 4JJNA 1HQ3C 3V9RA 3C1BA 4KUDB 5B24D 3X1SD 2G5HC 2ZY4A 1P3FD 4H9PA 1PZRA 1EQZA 1P3LC 3X1TB 3KWQC 3KUYB 3TU4C 1AOIB 2DQNC 5B1LB 3VH5W 5AV5A 1WWSA 4Z66D 1HTAA 5B31G 1P3PC 3NQJA 5B0YC 3B6FC 3AV1B 3REHB 2CV5A 5GXQB 3AZLC 4Z2MG 3X1TD 3AN2D 5GT0B 3KUYD 5AV5B 1P3KA 4AWLB 1F66B 5DNMB 4XZQA 5B1MD 3X1UC 1BH9A 3AV2D 4KGCC 3AZHA 3REJA 3W98D 3AZFD 5FUGB 3AV1D 3AZNC 4ZUXB 4NFTA 3W99D 2FJ7C 2YFVB 4XZQB 3REIB 4HGAC 1M19B 5AV8C 5B40A 4NE5A 2LY8A 5JRGB 3EPJA 5CPKB 3W96C 2BG1A 5G49B 1R4VA 4YS3C 1P3MA 1ZLAA 3WKJC 3MGQD 3X1VC 2FFFB 4XUJC 1M19D 4H9RA 2HIOB 1P3GA 3LZ1D 4J8UD 1S32A 1KX3A 2PYOB 3X1SC 4Z5TD 5B2IA 3W97A 2F8NA 4H9SA 2Y2KA 3LELB 3UT9D 5CPID 4Z66C 4QLCD 5AVBB 3MGSB 1S32B 2NQBD 3UTAD 3MGRA 4EO5B 3C1CB 3X1TC 1B67A 3AN2C 3KUYC 5B1MC 4X23D 3AV2C 5BNXB 3EPHA 3MGSD 4LD9B 5B31A 3W98C 3AZFC 4J8WA 3AV1C 3WA9A 1JFIB 3VH6A 3AZEB 3MVDD 3W99C 2HUEB 1KX5A 2ZY5A 1P3ID 5DNMC 2AROD 3WAAB 5F99D 1Z2CB 3AZED 2RIQA 3MGQC 3WTPE 3AL0C 1M19C 1ID3A 5CPJA 3AZJD 3LZ0B 5B33A 3MGPB 4J8UC 5CPKC 4Z5TC 3EPLA 2RVQD 4WU8A 3UT9C 1P3OB 5CP6B 5AVCA 1P34B 1U35B 3A1KA 1KX4B 3LJAD 3AZKD 4CAYA 2NQBC 3P5JB 1F1EA 3AYWA 3AZIB 1M18D 4WU9B 3LELC 1HQ3A 1P3LD 5AV6B 1TAFA 4X23C 2F2AC 5E5AA 3MGSC 3RELB 2JCHA 1P3PD 3AYWB 5CHLB 5B0YD 5BO0A 4J8VB 3MVDC 4WU9D 2Y2OA 2AROC 5B32B 2NZDD 2JSSA 3AZLA 1TZYD 5GSUD 4KGCD 3MNNA 3REKD 3O62D 3AZEC 4J8VD 2YFWA 4WNNB 3X1UA 4YM6A 2HUEC 1P3AD 3NQUB 3AZNA 5AV9D 4UUZA 3AZJC 3A6NB 5B2JA 2FJ7A 2IO5B 1Q9CA 2RVQC 3EG5B 5AV8A 4YM6B 5JA4A 1P3BA 3LJAC 3AZKC 1KU5A 4YS3A 3WKJA 3KXBD 3MGPC 5DNNA 5B0ZB 3AZGB 1M18C 3UTBD 1BH8A 3X1SA 5B24A 1P3FA 4J8XD 4G92B 4JJNB 3V9RB 3C1BB 3AFAD 4Z66A 4KUDD 1T3UA 4H9PB 4WU9C 1EQZB 1M1AA 2NZDC 2XD1A 2Y2QA 1AOID 1TZYC 5B1LD 3NQJB 5GSUC 3AN2A 3REKC 2BYMA 3O62C 2CV5B 5B1MA 5BNVA 4J8VC 3REHD 3AV2A 1M1AB 3W98A 5GXQD 3AZFA 5GT3A 1P3AC 5AY8A 4G91C 1P3KB 5GT0D 5AV5D 1F66D 5AV9C 1BH9B 5DNMD 3W99A 3AZHB 1ULYA 3REJB 3B6GA 4E44A 2Y2MA 5C3IB 4ZUXD 5AY8B 4XZQD 5B40B 3REID 3KXBC 3A6NC 3MGQA 2F8NK 2IO5C 5JRGD 4R8PA 5CPKD 4WJ3C 1P3MB 1ZLAB 3UTBC 3LZ1A 5BT1D 4J8UA 4Z5TA 4H9RB 2ZY3A 4J8XC 5CPIA 1P3GB 3AFAC 4H9NA 2HIOD 4ZBJB 1KX3B 3VH5A 5B2IB 4KUDC 4QLCA 5KDMA 4NE6A 3AZGC 2F8NB 2PYOD 2Y2IA 1ZLAD 3W97B 2BYKA 2NQBA 3B0CT 3UTAA 3LELD 1AOIC 5B1LC 1P3GD 5AVBD 1S32D 1KX3D 3MGRB 2VQRA 4X23A 3REHC 1EQZC 1A7WA 3C1CD 5GXQC 5GT0C 5AV5C 1F66C 4AWLC 3VH6T 3MVDA 5B31B 4LD9D 1N1JA 4J8WB 1P3IA 3WA9B 2AROA 4ZUXC 5F99A 1KX5B 4XZQC 3REIC 3WAAD 5JRGC 2JE5A 5BT1C 3WTPA 3AZMA 1ID3B 5B40C 5CPJB 5B33B 2HIOC 3R45A 3LZ0D 2Y2HA 3LJAA 3MGPD 2PYOC 3AZKA 4WU8B 1ZLAC 5AVCB 1P3OD 5CP6D 1P34D 1ID3D 1U35D 4H9QA 1KX4D 1M18A 5CPJD 4CAYB 5AVBC 5BS7C 1P3GC 1S32C 1P3LA 1B6WA 1KX3C 3KWQA 2L5AA 3B0DB 4H9SC 4EO5C 3C1CC 3TU4A 3AZID 1HQ3B 1P3PA 5B0YA 1TAFB 3B6FA 5AV6D 5E5AB 1WWIA 4LD9C 3KWQB
chains in the Genus database with same CATH topology
4CSRA 5BO0B 3AYWD 2UWXA 2NZDA 1TZYA 5GSUA 4KGCA 3REKA 3O62A 3H0RC 5E5AD 5B32D 2F8NH 3AZLB 4CSRB 3WAAC 1P3AA 4DRAA 3MNNB 2YFWB 5AV9A 3X1UB 1H3OA 3B0BA 3AZNB 2Y2PA 4KHAA 4UUZB 3W96A 2FJ7B 5B2JB 3LZ0C 3A6ND 3MNND 3X1VA 5AV8B 4XUJA 4YM6D 3KXBA 1P3OC 5JA4B 5CP6C 1P34C 1ID3C 1U35C 4H9OA 1P3BB 1KX4C 5CPJC 4YS3B 3WKJB 3UTBA 5B33C 4Z2MH 5B2JD 2G5IC 5DNNB 4J8XA 3AZIC 5B0ZD 3AZGD 3AFAA 1BH8B 1P3BD 2ZY2A 2DF4C 5AV6C 5B24B 3X1SB 1P3FB 4KUDA 3RELC 3X1TA 4JJND 3C1BD 3KUYA 3AYWC 4Z66B 5DNND 1AOIA 5B1LA 1EQZD 3AV1A 3REHA 5E5AC 5B32C 3AN2B 5GXQA 2BYMB 5GT0A 1F66A 5B1MB 5BNVB 3B0CW 3AV2B 5DNMA 2CV5D 1M1AD 3W98B 3AZFB 5GT3B 2Y2LA 5FUGA 1P3KD 4ZUXA 3W99B 3MNNC 3AZHD 2J8PA 2YFVA 3REIA 3REJD 3B6GB 1M19A 4YM6C 3VH6W 5GT3D 5AY8D 5JRGA 5CPKA 5G49A 5B40D 2ZM5A 5B2JC 3MGQB 3UT9A 3B6GD 4R8PB 1BFMA 5B0ZC 3LZ1B 4J8UB 2HIOA 1P3MD 1P3BC 4Z5TB 3VH5T 2PYOA 3UT9B 5CPIB 4G92C 4H9NB 3LELA 4JJNC 3C1BC 4R8PD 5DNNC 4NE3A 5KDMB 4QLCB 5B2ID 3W97D 2BYKB 5BS7A 5AVBA 3MGSA 2F8ND 3UTAB 2NQBB 5B24C 1P3FC 3C1CA 4M6BA 4X23B 5B32G 3IP4C 3MGRD 2CV5C 1M1AC 5BNXA 4UPKA 4LD9A 4WV4B 1P3KC 1JFIA 3MVDB 3AZEA 1N1JB 1P3IB 5B31D 3REJC 3AZHC 2AROB 4J8WD 3WA9D 2W8SA 2Y2GA 5C3IC 5F99B 5GT3C 3AZJA 5AY8C 3WAAA 1KX5D 4DRBA 3B6GC 4DQYB 3AZJB 1P3MC 3LZ0A 3WTPB 3MGPA 3H0MC 3AZMB 3R45B 1P3OA 5CP6A 1P34A 4ZBJC 5B33D 4R8PC 3LJAB 3F6TA 1U35A 3AZKB 1KX4A 5B2IC 4WZSB 3W97C 3LZ1C 4WU8D 3WTPD 5AVCD 3AZMD 4H9QB 1M18B 3AZIA 5CPIC 4WU9A 1P3LB 4QLCC 5AV6A 3MGRC 3TU4B 3RELA 3UTAC 1P3PB 3KFUG 1HQ3D 5B0YB 3B6FB 2Y2NA 4J8VA 5B31C 3EPKA 2XD5A 3KWQD 4J8WC 3WA9C 3RELD 2NZDB 5B32A 3TU4D 1TZYB 5GSUB 3KSYA 4KGCB 1KX5C 3REKB 3B6FD 3O62B 2Y2JA 4WNNA 1P3AB 3AZLD 1P3IC 4G91B 3A1IA 3NQUA 4HGAB 5AV9B 5F99C 3X1UD 1H3OB 3A6NA 2CWEA 4KHAB 3AZND 3W96B 3H0LC 2FJ7D 3X1VB 4XUJB 5AV8D 4WU8C 3KXBB 3WTPC 5AVCC 3AZMC 4H9OB 3FDDA 3W96D 2F8NG 5B0ZA 3UTBB 3AZGA 4YS3D 3WKJD 4E45A 3X1VD 3B0DC 4J8XB 1W2EA 4XUJD 3AFAB 4JJNA 1HQ3C 3V9RA 3C1BA 4KUDB 5B24D 3X1SD 2G5HC 2ZY4A 1P3FD 4H9PA 1PZRA 1EQZA 1P3LC 3X1TB 3KWQC 3KUYB 3TU4C 1AOIB 2DQNC 5B1LB 3VH5W 5AV5A 1WWSA 4Z66D 1HTAA 5B31G 1P3PC 3NQJA 5B0YC 3B6FC 3AV1B 3REHB 2CV5A 5GXQB 3AZLC 4Z2MG 3X1TD 3AN2D 5GT0B 3KUYD 5AV5B 1P3KA 4AWLB 1F66B 5DNMB 4XZQA 5B1MD 3X1UC 1BH9A 3AV2D 4KGCC 3AZHA 3REJA 3W98D 3AZFD 5FUGB 3AV1D 3AZNC 4ZUXB 4NFTA 3W99D 2FJ7C 2YFVB 4XZQB 3REIB 4HGAC 1M19B 5AV8C 5B40A 4NE5A 2LY8A 5JRGB 3EPJA 5CPKB 3W96C 2BG1A 5G49B 1R4VA 4YS3C 1P3MA 1ZLAA 3WKJC 3MGQD 3X1VC 2FFFB 4XUJC 1M19D 4H9RA 2HIOB 1P3GA 3LZ1D 4J8UD 1S32A 1KX3A 2PYOB 3X1SC 4Z5TD 5B2IA 3W97A 2F8NA 4H9SA 2Y2KA 3LELB 3UT9D 5CPID 4Z66C 4QLCD 5AVBB 3MGSB 1S32B 2NQBD 3UTAD 3MGRA 4EO5B 3C1CB 3X1TC 1B67A 3AN2C 3KUYC 5B1MC 4X23D 3AV2C 5BNXB 3EPHA 3MGSD 4LD9B 5B31A 3W98C 3AZFC 4J8WA 3AV1C 3WA9A 1JFIB 3VH6A 3AZEB 3MVDD 3W99C 2HUEB 1KX5A 2ZY5A 1P3ID 5DNMC 2AROD 3WAAB 5F99D 1Z2CB 3AZED 2RIQA 3MGQC 3WTPE 3AL0C 1M19C 1ID3A 5CPJA 3AZJD 3LZ0B 5B33A 3MGPB 4J8UC 5CPKC 4Z5TC 3EPLA 2RVQD 4WU8A 3UT9C 1P3OB 5CP6B 5AVCA 1P34B 1U35B 3A1KA 1KX4B 3LJAD 3AZKD 4CAYA 2NQBC 3P5JB 1F1EA 3AYWA 3AZIB 1M18D 4WU9B 3LELC 1HQ3A 1P3LD 5AV6B 1TAFA 4X23C 2F2AC 5E5AA 3MGSC 3RELB 2JCHA 1P3PD 3AYWB 5CHLB 5B0YD 5BO0A 4J8VB 3MVDC 4WU9D 2Y2OA 2AROC 5B32B 2NZDD 2JSSA 3AZLA 1TZYD 5GSUD 4KGCD 3MNNA 3REKD 3O62D 3AZEC 4J8VD 2YFWA 4WNNB 3X1UA 4YM6A 2HUEC 1P3AD 3NQUB 3AZNA 5AV9D 4UUZA 3AZJC 3A6NB 5B2JA 2FJ7A 2IO5B 1Q9CA 2RVQC 3EG5B 5AV8A 4YM6B 5JA4A 1P3BA 3LJAC 3AZKC 1KU5A 4YS3A 3WKJA 3KXBD 3MGPC 5DNNA 5B0ZB 3AZGB 1M18C 3UTBD 1BH8A 3X1SA 5B24A 1P3FA 4J8XD 4G92B 4JJNB 3V9RB 3C1BB 3AFAD 4Z66A 4KUDD 1T3UA 4H9PB 4WU9C 1EQZB 1M1AA 2NZDC 2XD1A 2Y2QA 1AOID 1TZYC 5B1LD 3NQJB 5GSUC 3AN2A 3REKC 2BYMA 3O62C 2CV5B 5B1MA 5BNVA 4J8VC 3REHD 3AV2A 1M1AB 3W98A 5GXQD 3AZFA 5GT3A 1P3AC 5AY8A 4G91C 1P3KB 5GT0D 5AV5D 1F66D 5AV9C 1BH9B 5DNMD 3W99A 3AZHB 1ULYA 3REJB 3B6GA 4E44A 2Y2MA 5C3IB 4ZUXD 5AY8B 4XZQD 5B40B 3REID 3KXBC 3A6NC 3MGQA 2F8NK 2IO5C 5JRGD 4R8PA 5CPKD 4WJ3C 1P3MB 1ZLAB 3UTBC 3LZ1A 5BT1D 4J8UA 4Z5TA 4H9RB 2ZY3A 4J8XC 5CPIA 1P3GB 3AFAC 4H9NA 2HIOD 4ZBJB 1KX3B 3VH5A 5B2IB 4KUDC 4QLCA 5KDMA 4NE6A 3AZGC 2F8NB 2PYOD 2Y2IA 1ZLAD 3W97B 2BYKA 2NQBA 3B0CT 3UTAA 3LELD 1AOIC 5B1LC 1P3GD 5AVBD 1S32D 1KX3D 3MGRB 2VQRA 4X23A 3REHC 1EQZC 1A7WA 3C1CD 5GXQC 5GT0C 5AV5C 1F66C 4AWLC 3VH6T 3MVDA 5B31B 4LD9D 1N1JA 4J8WB 1P3IA 3WA9B 2AROA 4ZUXC 5F99A 1KX5B 4XZQC 3REIC 3WAAD 5JRGC 2JE5A 5BT1C 3WTPA 3AZMA 1ID3B 5B40C 5CPJB 5B33B 2HIOC 3R45A 3LZ0D 2Y2HA 3LJAA 3MGPD 2PYOC 3AZKA 4WU8B 1ZLAC 5AVCB 1P3OD 5CP6D 1P34D 1ID3D 1U35D 4H9QA 1KX4D 1M18A 5CPJD 4CAYB 5AVBC 5BS7C 1P3GC 1S32C 1P3LA 1B6WA 1KX3C 3KWQA 2L5AA 3B0DB 4H9SC 4EO5C 3C1CC 3TU4A 3AZID 1HQ3B 1P3PA 5B0YA 1TAFB 3B6FA 5AV6D 5E5AB 1WWIA 4LD9C 3KWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSR A;  5BO0 B;  3AYW D;  2NZD A;  1TZY A;  5GSU A;  4KGC A;  3REK A;  3O62 A;  5E5A D;  5B32 D;  2F8N H;  3AZL B;  4CSR B;  3WAA C;  1P3A A;  4DRA A;  3MNN B;  2YFW B;  5AV9 A;  3X1U B;  1H3O A;  3B0B A;  3AZN B;  4KHA A;  4UUZ B;  3W96 A;  2FJ7 B;  5B2J B;  3LZ0 C;  3A6N D;  3MNN D;  3X1V A;  5AV8 B;  4XUJ A;  4YM6 D;  3KXB A;  1P3O C;  5JA4 B;  5CP6 C;  1P34 C;  1ID3 C;  1U35 C;  4H9O A;  1P3B B;  1KX4 C;  5CPJ C;  4YS3 B;  3WKJ B;  3UTB A;  5B33 C;  4Z2M H;  5B2J D;  5DNN B;  4J8X A;  3AZI C;  5B0Z D;  3AZG D;  3AFA A;  1BH8 B;  1P3B D;  5B24 B;  5AV6 C;  3X1S B;  1P3F B;  4KUD A;  3REL C;  3X1T A;  4JJN D;  3C1B D;  3KUY A;  3AYW C;  4Z66 B;  5DNN D;  1AOI A;  5B1L A;  1EQZ D;  3AV1 A;  3REH A;  5E5A C;  5B32 C;  3AN2 B;  5GXQ A;  2BYM B;  5GT0 A;  1F66 A;  5B1M B;  5BNV B;  3B0C W;  3AV2 B;  5DNM A;  2CV5 D;  1M1A D;  3W98 B;  3AZF B;  5GT3 B;  5FUG A;  1P3K D;  4ZUX A;  3W99 B;  3MNN C;  3AZH D;  2YFV A;  3REJ D;  3REI A;  3B6G B;  1M19 A;  4YM6 C;  3VH6 W;  5GT3 D;  5AY8 D;  5JRG A;  5CPK A;  5G49 A;  5B40 D;  5B2J C;  3MGQ B;  3UT9 A;  3B6G D;  4R8P B;  1BFM A;  5B0Z C;  3LZ1 B;  4J8U B;  2HIO A;  1P3M D;  1P3B C;  4Z5T B;  3VH5 T;  2PYO A;  3UT9 B;  5CPI B;  4G92 C;  4H9N B;  3LEL A;  4JJN C;  3C1B C;  4R8P D;  5DNN C;  4NE3 A;  5KDM B;  4QLC B;  5B2I D;  3W97 D;  2BYK B;  5BS7 A;  5AVB A;  3MGS A;  2F8N D;  3UTA B;  2NQB B;  5B24 C;  1P3F C;  3C1C A;  4M6B A;  4X23 B;  5B32 G;  3MGR D;  2CV5 C;  1M1A C;  5BNX A;  4LD9 A;  4WV4 B;  1P3K C;  1JFI A;  3MVD B;  3AZE A;  1N1J B;  1P3I B;  5B31 D;  3REJ C;  3AZH C;  2ARO B;  4J8W D;  3WA9 D;  5C3I C;  5F99 B;  5GT3 C;  3AZJ A;  5AY8 C;  3WAA A;  1KX5 D;  4DRB A;  3B6G C;  3AZJ B;  1P3M C;  3LZ0 A;  3WTP B;  3MGP A;  3AZM B;  3R45 B;  1P3O A;  5CP6 A;  1P34 A;  4ZBJ C;  5B33 D;  4R8P C;  3LJA B;  1U35 A;  1KX4 A;  3AZK B;  5B2I C;  4WZS B;  3W97 C;  3LZ1 C;  4WU8 D;  3WTP D;  5AVC D;  3AZM D;  4H9Q B;  1M18 B;  3AZI A;  5CPI C;  4WU9 A;  1P3L B;  4QLC C;  5AV6 A;  3MGR C;  3TU4 B;  3REL A;  3UTA C;  1P3P B;  1HQ3 D;  5B0Y B;  3B6F B;  4J8V A;  5B31 C;  3KWQ D;  4J8W C;  3WA9 C;  2NZD B;  3REL D;  5B32 A;  3TU4 D;  1TZY B;  5GSU B;  3KSY A;  4KGC B;  1KX5 C;  3REK B;  3B6F D;  3O62 B;  4WNN A;  1P3A B;  3AZL D;  1P3I C;  4G91 B;  3NQU A;  4HGA B;  5AV9 B;  5F99 C;  3X1U D;  1H3O B;  3A6N A;  2CWE A;  4KHA B;  3AZN D;  3W96 B;  2FJ7 D;  3X1V B;  4XUJ B;  5AV8 D;  4WU8 C;  3KXB B;  3WTP C;  5AVC C;  3AZM C;  4H9O B;  3W96 D;  2F8N G;  5B0Z A;  3UTB B;  3AZG A;  4YS3 D;  3WKJ D;  4E45 A;  3X1V D;  3B0D C;  4J8X B;  4XUJ D;  3AFA B;  4JJN A;  1HQ3 C;  3V9R A;  3C1B A;  4KUD B;  5B24 D;  3X1S D;  1P3F D;  4H9P A;  1EQZ A;  1P3L C;  3X1T B;  3KWQ C;  3KUY B;  3TU4 C;  1AOI B;  5B1L B;  5AV5 A;  3VH5 W;  4Z66 D;  1WWS A;  1P3P C;  1HTA A;  5B31 G;  3NQJ A;  5B0Y C;  3B6F C;  3AV1 B;  3REH B;  2CV5 A;  5GXQ B;  3AZL C;  4Z2M G;  3X1T D;  3AN2 D;  5GT0 B;  3KUY D;  5AV5 B;  1P3K A;  4AWL B;  1F66 B;  5DNM B;  4XZQ A;  5B1M D;  3X1U C;  1BH9 A;  3AV2 D;  4KGC C;  3AZH A;  3REJ A;  3W98 D;  3AZF D;  5FUG B;  3AV1 D;  3AZN C;  4ZUX B;  4NFT A;  3W99 D;  2FJ7 C;  2YFV B;  4XZQ B;  3REI B;  4HGA C;  1M19 B;  5AV8 C;  5B40 A;  4NE5 A;  2LY8 A;  5JRG B;  5CPK B;  3W96 C;  5G49 B;  1R4V A;  4YS3 C;  1P3M A;  1ZLA A;  3WKJ C;  3MGQ D;  3X1V C;  4XUJ C;  1M19 D;  4H9R A;  2HIO B;  1P3G A;  3LZ1 D;  4J8U D;  1S32 A;  1KX3 A;  2PYO B;  3X1S C;  4Z5T D;  5B2I A;  3W97 A;  2F8N A;  4H9S A;  3LEL B;  3UT9 D;  5CPI D;  4Z66 C;  4QLC D;  5AVB B;  3MGS B;  1S32 B;  2NQB D;  3UTA D;  3MGR A;  4EO5 B;  3C1C B;  3X1T C;  1B67 A;  3AN2 C;  3KUY C;  5B1M C;  4X23 D;  3AV2 C;  5BNX B;  3MGS D;  4LD9 B;  5B31 A;  3W98 C;  3AZF C;  4J8W A;  3AV1 C;  3WA9 A;  1JFI B;  3VH6 A;  3AZE B;  3MVD D;  3W99 C;  2HUE B;  1KX5 A;  1P3I D;  5DNM C;  2ARO D;  3WAA B;  5F99 D;  3AZE D;  3MGQ C;  3WTP E;  1M19 C;  1ID3 A;  5CPJ A;  3AZJ D;  3LZ0 B;  5B33 A;  3MGP B;  4J8U C;  5CPK C;  4Z5T C;  2RVQ D;  4WU8 A;  3UT9 C;  1P3O B;  5CP6 B;  5AVC A;  1P34 B;  1U35 B;  1KX4 B;  3LJA D;  3AZK D;  4CAY A;  2NQB C;  1F1E A;  3AYW A;  3AZI B;  1M18 D;  4WU9 B;  3LEL C;  1HQ3 A;  1P3L D;  5AV6 B;  1TAF A;  4X23 C;  5E5A A;  3MGS C;  3REL B;  1P3P D;  3AYW B;  5CHL B;  5B0Y D;  5BO0 A;  4J8V B;  3MVD C;  4WU9 D;  2ARO C;  5B32 B;  2NZD D;  2JSS A;  3AZL A;  1TZY D;  5GSU D;  4KGC D;  3MNN A;  3REK D;  3O62 D;  3AZE C;  4J8V D;  3X1U A;  2YFW A;  4WNN B;  4YM6 A;  2HUE C;  1P3A D;  3NQU B;  3AZN A;  5AV9 D;  4UUZ A;  3AZJ C;  3A6N B;  5B2J A;  2FJ7 A;  2IO5 B;  1Q9C A;  2RVQ C;  4YM6 B;  5AV8 A;  5JA4 A;  1P3B A;  3LJA C;  3AZK C;  1KU5 A;  4YS3 A;  3WKJ A;  3KXB D;  3MGP C;  5DNN A;  5B0Z B;  3AZG B;  1M18 C;  3UTB D;  1BH8 A;  3X1S A;  5B24 A;  1P3F A;  4J8X D;  4G92 B;  4JJN B;  3V9R B;  3C1B B;  3AFA D;  4Z66 A;  4KUD D;  4H9P B;  4WU9 C;  1EQZ B;  1M1A A;  2NZD C;  1AOI D;  1TZY C;  5B1L D;  3NQJ B;  5GSU C;  3AN2 A;  3REK C;  2BYM A;  3O62 C;  2CV5 B;  5B1M A;  5BNV A;  4J8V C;  3REH D;  3AV2 A;  1M1A B;  3W98 A;  5GXQ D;  3AZF A;  5GT3 A;  1P3A C;  5AY8 A;  4G91 C;  1P3K B;  5GT0 D;  5AV5 D;  1F66 D;  5AV9 C;  1BH9 B;  5DNM D;  3W99 A;  3AZH B;  1ULY A;  3REJ B;  3B6G A;  4E44 A;  5C3I B;  4ZUX D;  5AY8 B;  4XZQ D;  5B40 B;  3REI D;  3KXB C;  3A6N C;  3MGQ A;  2F8N K;  2IO5 C;  5JRG D;  4R8P A;  5CPK D;  1P3M B;  1ZLA B;  3UTB C;  3LZ1 A;  5BT1 D;  4J8U A;  4Z5T A;  4H9R B;  4J8X C;  5CPI A;  1P3G B;  3AFA C;  4H9N A;  2HIO D;  4ZBJ B;  1KX3 B;  3VH5 A;  5B2I B;  4KUD C;  4QLC A;  5KDM A;  4NE6 A;  3AZG C;  2F8N B;  2PYO D;  1ZLA D;  3W97 B;  2BYK A;  2NQB A;  3B0C T;  3UTA A;  3LEL D;  1AOI C;  5B1L C;  1P3G D;  5AVB D;  1S32 D;  1KX3 D;  3MGR B;  4X23 A;  3REH C;  1EQZ C;  1A7W A;  3C1C D;  5GXQ C;  5GT0 C;  5AV5 C;  1F66 C;  4AWL C;  3VH6 T;  3MVD A;  5B31 B;  4LD9 D;  1N1J A;  4J8W B;  1P3I A;  3WA9 B;  2ARO A;  4ZUX C;  5F99 A;  1KX5 B;  4XZQ C;  3REI C;  3WAA D;  5JRG C;  5BT1 C;  3WTP A;  3AZM A;  1ID3 B;  5B40 C;  5CPJ B;  5B33 B;  2HIO C;  3R45 A;  3LZ0 D;  3MGP D;  3LJA A;  2PYO C;  3AZK A;  4WU8 B;  1ZLA C;  5AVC B;  1P3O D;  5CP6 D;  1P34 D;  1ID3 D;  1U35 D;  4H9Q A;  1KX4 D;  1M18 A;  5CPJ D;  4CAY B;  5AVB C;  5BS7 C;  1P3G C;  1S32 C;  1P3L A;  1B6W A;  1KX3 C;  3KWQ A;  2L5A A;  3B0D B;  4H9S C;  4EO5 C;  3C1C C;  3TU4 A;  3AZI D;  1HQ3 B;  1P3P A;  5B0Y A;  1TAF B;  3B6F A;  5AV6 D;  5E5A B;  1WWI A;  4LD9 C;  3KWQ B; 
#chains in the Genus database with same CATH topology
 4CSR A;  5BO0 B;  3AYW D;  2UWX A;  2NZD A;  1TZY A;  5GSU A;  4KGC A;  3REK A;  3O62 A;  3H0R C;  5E5A D;  5B32 D;  2F8N H;  3AZL B;  4CSR B;  3WAA C;  1P3A A;  4DRA A;  3MNN B;  2YFW B;  5AV9 A;  3X1U B;  1H3O A;  3B0B A;  3AZN B;  2Y2P A;  4KHA A;  4UUZ B;  3W96 A;  2FJ7 B;  5B2J B;  3LZ0 C;  3A6N D;  3MNN D;  3X1V A;  5AV8 B;  4XUJ A;  4YM6 D;  3KXB A;  1P3O C;  5JA4 B;  5CP6 C;  1P34 C;  1ID3 C;  1U35 C;  4H9O A;  1P3B B;  1KX4 C;  5CPJ C;  4YS3 B;  3WKJ B;  3UTB A;  5B33 C;  4Z2M H;  5B2J D;  2G5I C;  5DNN B;  4J8X A;  3AZI C;  5B0Z D;  3AZG D;  3AFA A;  1BH8 B;  1P3B D;  2ZY2 A;  2DF4 C;  5AV6 C;  5B24 B;  3X1S B;  1P3F B;  4KUD A;  3REL C;  3X1T A;  4JJN D;  3C1B D;  3KUY A;  3AYW C;  4Z66 B;  5DNN D;  1AOI A;  5B1L A;  1EQZ D;  3AV1 A;  3REH A;  5E5A C;  5B32 C;  3AN2 B;  5GXQ A;  2BYM B;  5GT0 A;  1F66 A;  5B1M B;  5BNV B;  3B0C W;  3AV2 B;  5DNM A;  2CV5 D;  1M1A D;  3W98 B;  3AZF B;  5GT3 B;  2Y2L A;  5FUG A;  1P3K D;  4ZUX A;  3W99 B;  3MNN C;  3AZH D;  2J8P A;  2YFV A;  3REI A;  3REJ D;  3B6G B;  1M19 A;  4YM6 C;  3VH6 W;  5GT3 D;  5AY8 D;  5JRG A;  5CPK A;  5G49 A;  5B40 D;  2ZM5 A;  5B2J C;  3MGQ B;  3UT9 A;  3B6G D;  4R8P B;  1BFM A;  5B0Z C;  3LZ1 B;  4J8U B;  2HIO A;  1P3M D;  1P3B C;  4Z5T B;  3VH5 T;  2PYO A;  3UT9 B;  5CPI B;  4G92 C;  4H9N B;  3LEL A;  4JJN C;  3C1B C;  4R8P D;  5DNN C;  4NE3 A;  5KDM B;  4QLC B;  5B2I D;  3W97 D;  2BYK B;  5BS7 A;  5AVB A;  3MGS A;  2F8N D;  3UTA B;  2NQB B;  5B24 C;  1P3F C;  3C1C A;  4M6B A;  4X23 B;  5B32 G;  3IP4 C;  3MGR D;  2CV5 C;  1M1A C;  5BNX A;  4UPK A;  4LD9 A;  4WV4 B;  1P3K C;  1JFI A;  3MVD B;  3AZE A;  1N1J B;  1P3I B;  5B31 D;  3REJ C;  3AZH C;  2ARO B;  4J8W D;  3WA9 D;  2W8S A;  2Y2G A;  5C3I C;  5F99 B;  5GT3 C;  3AZJ A;  5AY8 C;  3WAA A;  1KX5 D;  4DRB A;  3B6G C;  4DQY B;  3AZJ B;  1P3M C;  3LZ0 A;  3WTP B;  3MGP A;  3H0M C;  3AZM B;  3R45 B;  1P3O A;  5CP6 A;  1P34 A;  4ZBJ C;  5B33 D;  4R8P C;  3LJA B;  3F6T A;  1U35 A;  3AZK B;  1KX4 A;  5B2I C;  4WZS B;  3W97 C;  3LZ1 C;  4WU8 D;  3WTP D;  5AVC D;  3AZM D;  4H9Q B;  1M18 B;  3AZI A;  5CPI C;  4WU9 A;  1P3L B;  4QLC C;  5AV6 A;  3MGR C;  3TU4 B;  3REL A;  3UTA C;  1P3P B;  3KFU G;  1HQ3 D;  5B0Y B;  3B6F B;  2Y2N A;  4J8V A;  5B31 C;  3EPK A;  2XD5 A;  3KWQ D;  4J8W C;  3WA9 C;  3REL D;  2NZD B;  5B32 A;  3TU4 D;  1TZY B;  5GSU B;  3KSY A;  4KGC B;  1KX5 C;  3REK B;  3B6F D;  3O62 B;  2Y2J A;  4WNN A;  1P3A B;  3AZL D;  1P3I C;  4G91 B;  3A1I A;  3NQU A;  4HGA B;  5AV9 B;  5F99 C;  3X1U D;  1H3O B;  3A6N A;  2CWE A;  4KHA B;  3AZN D;  3W96 B;  3H0L C;  2FJ7 D;  3X1V B;  4XUJ B;  5AV8 D;  4WU8 C;  3KXB B;  3WTP C;  5AVC C;  3AZM C;  4H9O B;  3FDD A;  3W96 D;  2F8N G;  5B0Z A;  3UTB B;  3AZG A;  4YS3 D;  3WKJ D;  4E45 A;  3X1V D;  3B0D C;  4J8X B;  1W2E A;  4XUJ D;  3AFA B;  4JJN A;  1HQ3 C;  3V9R A;  3C1B A;  4KUD B;  5B24 D;  3X1S D;  2G5H C;  2ZY4 A;  1P3F D;  4H9P A;  1PZR A;  1EQZ A;  1P3L C;  3X1T B;  3KWQ C;  3KUY B;  3TU4 C;  1AOI B;  2DQN C;  5B1L B;  3VH5 W;  5AV5 A;  1WWS A;  4Z66 D;  1HTA A;  5B31 G;  1P3P C;  3NQJ A;  5B0Y C;  3B6F C;  3AV1 B;  3REH B;  2CV5 A;  5GXQ B;  3AZL C;  4Z2M G;  3X1T D;  3AN2 D;  5GT0 B;  3KUY D;  5AV5 B;  1P3K A;  4AWL B;  1F66 B;  5DNM B;  4XZQ A;  5B1M D;  3X1U C;  1BH9 A;  3AV2 D;  4KGC C;  3AZH A;  3REJ A;  3W98 D;  3AZF D;  5FUG B;  3AV1 D;  3AZN C;  4ZUX B;  4NFT A;  3W99 D;  2FJ7 C;  2YFV B;  4XZQ B;  3REI B;  4HGA C;  1M19 B;  5AV8 C;  5B40 A;  4NE5 A;  2LY8 A;  5JRG B;  3EPJ A;  5CPK B;  3W96 C;  2BG1 A;  5G49 B;  1R4V A;  4YS3 C;  1P3M A;  1ZLA A;  3WKJ C;  3MGQ D;  3X1V C;  2FFF B;  4XUJ C;  1M19 D;  4H9R A;  2HIO B;  1P3G A;  3LZ1 D;  4J8U D;  1S32 A;  1KX3 A;  2PYO B;  3X1S C;  4Z5T D;  5B2I A;  3W97 A;  2F8N A;  4H9S A;  2Y2K A;  3LEL B;  3UT9 D;  5CPI D;  4Z66 C;  4QLC D;  5AVB B;  3MGS B;  1S32 B;  2NQB D;  3UTA D;  3MGR A;  4EO5 B;  3C1C B;  3X1T C;  1B67 A;  3AN2 C;  3KUY C;  5B1M C;  4X23 D;  3AV2 C;  5BNX B;  3EPH A;  3MGS D;  4LD9 B;  5B31 A;  3W98 C;  3AZF C;  4J8W A;  3AV1 C;  3WA9 A;  1JFI B;  3VH6 A;  3AZE B;  3MVD D;  3W99 C;  2HUE B;  1KX5 A;  2ZY5 A;  1P3I D;  5DNM C;  2ARO D;  3WAA B;  5F99 D;  1Z2C B;  3AZE D;  2RIQ A;  3MGQ C;  3WTP E;  3AL0 C;  1M19 C;  1ID3 A;  5CPJ A;  3AZJ D;  3LZ0 B;  5B33 A;  3MGP B;  4J8U C;  5CPK C;  4Z5T C;  3EPL A;  2RVQ D;  4WU8 A;  3UT9 C;  1P3O B;  5CP6 B;  5AVC A;  1P34 B;  1U35 B;  3A1K A;  1KX4 B;  3LJA D;  3AZK D;  4CAY A;  2NQB C;  3P5J B;  1F1E A;  3AYW A;  3AZI B;  1M18 D;  4WU9 B;  3LEL C;  1HQ3 A;  1P3L D;  5AV6 B;  1TAF A;  4X23 C;  2F2A C;  5E5A A;  3MGS C;  3REL B;  2JCH A;  1P3P D;  3AYW B;  5CHL B;  5B0Y D;  5BO0 A;  4J8V B;  3MVD C;  4WU9 D;  2Y2O A;  2ARO C;  5B32 B;  2NZD D;  2JSS A;  3AZL A;  1TZY D;  5GSU D;  4KGC D;  3MNN A;  3REK D;  3O62 D;  3AZE C;  4J8V D;  2YFW A;  4WNN B;  3X1U A;  4YM6 A;  2HUE C;  1P3A D;  3NQU B;  3AZN A;  5AV9 D;  4UUZ A;  3AZJ C;  3A6N B;  5B2J A;  2FJ7 A;  2IO5 B;  1Q9C A;  2RVQ C;  3EG5 B;  5AV8 A;  4YM6 B;  5JA4 A;  1P3B A;  3LJA C;  3AZK C;  1KU5 A;  4YS3 A;  3WKJ A;  3KXB D;  3MGP C;  5DNN A;  5B0Z B;  3AZG B;  1M18 C;  3UTB D;  1BH8 A;  3X1S A;  5B24 A;  1P3F A;  4J8X D;  4G92 B;  4JJN B;  3V9R B;  3C1B B;  3AFA D;  4Z66 A;  4KUD D;  1T3U A;  4H9P B;  4WU9 C;  1EQZ B;  1M1A A;  2NZD C;  2XD1 A;  2Y2Q A;  1AOI D;  1TZY C;  5B1L D;  3NQJ B;  5GSU C;  3AN2 A;  3REK C;  2BYM A;  3O62 C;  2CV5 B;  5B1M A;  5BNV A;  4J8V C;  3REH D;  3AV2 A;  1M1A B;  3W98 A;  5GXQ D;  3AZF A;  5GT3 A;  1P3A C;  5AY8 A;  4G91 C;  1P3K B;  5GT0 D;  5AV5 D;  1F66 D;  5AV9 C;  1BH9 B;  5DNM D;  3W99 A;  3AZH B;  1ULY A;  3REJ B;  3B6G A;  4E44 A;  2Y2M A;  5C3I B;  4ZUX D;  5AY8 B;  4XZQ D;  5B40 B;  3REI D;  3KXB C;  3A6N C;  3MGQ A;  2F8N K;  2IO5 C;  5JRG D;  4R8P A;  5CPK D;  4WJ3 C;  1P3M B;  1ZLA B;  3UTB C;  3LZ1 A;  5BT1 D;  4J8U A;  4Z5T A;  4H9R B;  2ZY3 A;  4J8X C;  5CPI A;  1P3G B;  3AFA C;  4H9N A;  2HIO D;  4ZBJ B;  1KX3 B;  3VH5 A;  5B2I B;  4KUD C;  4QLC A;  5KDM A;  4NE6 A;  3AZG C;  2F8N B;  2PYO D;  2Y2I A;  1ZLA D;  3W97 B;  2BYK A;  2NQB A;  3B0C T;  3UTA A;  3LEL D;  1AOI C;  5B1L C;  1P3G D;  5AVB D;  1S32 D;  1KX3 D;  3MGR B;  2VQR A;  4X23 A;  3REH C;  1EQZ C;  1A7W A;  3C1C D;  5GXQ C;  5GT0 C;  5AV5 C;  1F66 C;  4AWL C;  3VH6 T;  3MVD A;  5B31 B;  4LD9 D;  1N1J A;  4J8W B;  1P3I A;  3WA9 B;  2ARO A;  4ZUX C;  5F99 A;  1KX5 B;  4XZQ C;  3REI C;  3WAA D;  5JRG C;  2JE5 A;  5BT1 C;  3WTP A;  3AZM A;  1ID3 B;  5B40 C;  5CPJ B;  5B33 B;  2HIO C;  3R45 A;  3LZ0 D;  2Y2H A;  3LJA A;  3MGP D;  2PYO C;  3AZK A;  4WU8 B;  1ZLA C;  5AVC B;  1P3O D;  5CP6 D;  1P34 D;  1ID3 D;  1U35 D;  4H9Q A;  1KX4 D;  1M18 A;  5CPJ D;  4CAY B;  5AVB C;  5BS7 C;  1P3G C;  1S32 C;  1P3L A;  1B6W A;  1KX3 C;  3KWQ A;  2L5A A;  3B0D B;  4H9S C;  4EO5 C;  3C1C C;  3TU4 A;  3AZI D;  1HQ3 B;  1P3P A;  5B0Y A;  1TAF B;  3B6F A;  5AV6 D;  5E5A B;  1WWI A;  4LD9 C;  3KWQ B; 
#chains in the Genus database with same CATH homology
 4CSR A;  5BO0 B;  3AYW D;  2UWX A;  2NZD A;  1TZY A;  5GSU A;  4KGC A;  3REK A;  3O62 A;  3H0R C;  5E5A D;  5B32 D;  2F8N H;  3AZL B;  4CSR B;  3WAA C;  1P3A A;  4DRA A;  3MNN B;  2YFW B;  5AV9 A;  3X1U B;  1H3O A;  3B0B A;  3AZN B;  2Y2P A;  4KHA A;  4UUZ B;  3W96 A;  2FJ7 B;  5B2J B;  3LZ0 C;  3A6N D;  3MNN D;  3X1V A;  5AV8 B;  4XUJ A;  4YM6 D;  3KXB A;  1P3O C;  5JA4 B;  5CP6 C;  1P34 C;  1ID3 C;  1U35 C;  4H9O A;  1P3B B;  1KX4 C;  5CPJ C;  4YS3 B;  3WKJ B;  3UTB A;  5B33 C;  4Z2M H;  5B2J D;  2G5I C;  5DNN B;  4J8X A;  3AZI C;  5B0Z D;  3AZG D;  3AFA A;  1BH8 B;  1P3B D;  2ZY2 A;  2DF4 C;  5AV6 C;  5B24 B;  3X1S B;  1P3F B;  4KUD A;  3REL C;  3X1T A;  4JJN D;  3C1B D;  3KUY A;  3AYW C;  4Z66 B;  5DNN D;  1AOI A;  5B1L A;  1EQZ D;  3AV1 A;  3REH A;  5E5A C;  5B32 C;  3AN2 B;  5GXQ A;  2BYM B;  5GT0 A;  1F66 A;  5B1M B;  5BNV B;  3B0C W;  3AV2 B;  5DNM A;  2CV5 D;  1M1A D;  3W98 B;  3AZF B;  5GT3 B;  2Y2L A;  5FUG A;  1P3K D;  4ZUX A;  3W99 B;  3MNN C;  3AZH D;  2J8P A;  2YFV A;  3REI A;  3REJ D;  3B6G B;  1M19 A;  4YM6 C;  3VH6 W;  5GT3 D;  5AY8 D;  5JRG A;  5CPK A;  5G49 A;  5B40 D;  2ZM5 A;  5B2J C;  3MGQ B;  3UT9 A;  3B6G D;  4R8P B;  1BFM A;  5B0Z C;  3LZ1 B;  4J8U B;  2HIO A;  1P3M D;  1P3B C;  4Z5T B;  3VH5 T;  2PYO A;  3UT9 B;  5CPI B;  4G92 C;  4H9N B;  3LEL A;  4JJN C;  3C1B C;  4R8P D;  5DNN C;  4NE3 A;  5KDM B;  4QLC B;  5B2I D;  3W97 D;  2BYK B;  5BS7 A;  5AVB A;  3MGS A;  2F8N D;  3UTA B;  2NQB B;  5B24 C;  1P3F C;  3C1C A;  4M6B A;  4X23 B;  5B32 G;  3IP4 C;  3MGR D;  2CV5 C;  1M1A C;  5BNX A;  4UPK A;  4LD9 A;  4WV4 B;  1P3K C;  1JFI A;  3MVD B;  3AZE A;  1N1J B;  1P3I B;  5B31 D;  3REJ C;  3AZH C;  2ARO B;  4J8W D;  3WA9 D;  2W8S A;  2Y2G A;  5C3I C;  5F99 B;  5GT3 C;  3AZJ A;  5AY8 C;  3WAA A;  1KX5 D;  4DRB A;  3B6G C;  4DQY B;  3AZJ B;  1P3M C;  3LZ0 A;  3WTP B;  3MGP A;  3H0M C;  3AZM B;  3R45 B;  1P3O A;  5CP6 A;  1P34 A;  4ZBJ C;  5B33 D;  4R8P C;  3LJA B;  3F6T A;  1U35 A;  3AZK B;  1KX4 A;  5B2I C;  4WZS B;  3W97 C;  3LZ1 C;  4WU8 D;  3WTP D;  5AVC D;  3AZM D;  4H9Q B;  1M18 B;  3AZI A;  5CPI C;  4WU9 A;  1P3L B;  4QLC C;  5AV6 A;  3MGR C;  3TU4 B;  3REL A;  3UTA C;  1P3P B;  3KFU G;  1HQ3 D;  5B0Y B;  3B6F B;  2Y2N A;  4J8V A;  5B31 C;  3EPK A;  2XD5 A;  3KWQ D;  4J8W C;  3WA9 C;  3REL D;  2NZD B;  5B32 A;  3TU4 D;  1TZY B;  5GSU B;  3KSY A;  4KGC B;  1KX5 C;  3REK B;  3B6F D;  3O62 B;  2Y2J A;  4WNN A;  1P3A B;  3AZL D;  1P3I C;  4G91 B;  3A1I A;  3NQU A;  4HGA B;  5AV9 B;  5F99 C;  3X1U D;  1H3O B;  3A6N A;  2CWE A;  4KHA B;  3AZN D;  3W96 B;  3H0L C;  2FJ7 D;  3X1V B;  4XUJ B;  5AV8 D;  4WU8 C;  3KXB B;  3WTP C;  5AVC C;  3AZM C;  4H9O B;  3FDD A;  3W96 D;  2F8N G;  5B0Z A;  3UTB B;  3AZG A;  4YS3 D;  3WKJ D;  4E45 A;  3X1V D;  3B0D C;  4J8X B;  1W2E A;  4XUJ D;  3AFA B;  4JJN A;  1HQ3 C;  3V9R A;  3C1B A;  4KUD B;  5B24 D;  3X1S D;  2G5H C;  2ZY4 A;  1P3F D;  4H9P A;  1PZR A;  1EQZ A;  1P3L C;  3X1T B;  3KWQ C;  3KUY B;  3TU4 C;  1AOI B;  2DQN C;  5B1L B;  3VH5 W;  5AV5 A;  1WWS A;  4Z66 D;  1HTA A;  5B31 G;  1P3P C;  3NQJ A;  5B0Y C;  3B6F C;  3AV1 B;  3REH B;  2CV5 A;  5GXQ B;  3AZL C;  4Z2M G;  3X1T D;  3AN2 D;  5GT0 B;  3KUY D;  5AV5 B;  1P3K A;  4AWL B;  1F66 B;  5DNM B;  4XZQ A;  5B1M D;  3X1U C;  1BH9 A;  3AV2 D;  4KGC C;  3AZH A;  3REJ A;  3W98 D;  3AZF D;  5FUG B;  3AV1 D;  3AZN C;  4ZUX B;  4NFT A;  3W99 D;  2FJ7 C;  2YFV B;  4XZQ B;  3REI B;  4HGA C;  1M19 B;  5AV8 C;  5B40 A;  4NE5 A;  2LY8 A;  5JRG B;  3EPJ A;  5CPK B;  3W96 C;  2BG1 A;  5G49 B;  1R4V A;  4YS3 C;  1P3M A;  1ZLA A;  3WKJ C;  3MGQ D;  3X1V C;  2FFF B;  4XUJ C;  1M19 D;  4H9R A;  2HIO B;  1P3G A;  3LZ1 D;  4J8U D;  1S32 A;  1KX3 A;  2PYO B;  3X1S C;  4Z5T D;  5B2I A;  3W97 A;  2F8N A;  4H9S A;  2Y2K A;  3LEL B;  3UT9 D;  5CPI D;  4Z66 C;  4QLC D;  5AVB B;  3MGS B;  1S32 B;  2NQB D;  3UTA D;  3MGR A;  4EO5 B;  3C1C B;  3X1T C;  1B67 A;  3AN2 C;  3KUY C;  5B1M C;  4X23 D;  3AV2 C;  5BNX B;  3EPH A;  3MGS D;  4LD9 B;  5B31 A;  3W98 C;  3AZF C;  4J8W A;  3AV1 C;  3WA9 A;  1JFI B;  3VH6 A;  3AZE B;  3MVD D;  3W99 C;  2HUE B;  1KX5 A;  2ZY5 A;  1P3I D;  5DNM C;  2ARO D;  3WAA B;  5F99 D;  1Z2C B;  3AZE D;  2RIQ A;  3MGQ C;  3WTP E;  3AL0 C;  1M19 C;  1ID3 A;  5CPJ A;  3AZJ D;  3LZ0 B;  5B33 A;  3MGP B;  4J8U C;  5CPK C;  4Z5T C;  3EPL A;  2RVQ D;  4WU8 A;  3UT9 C;  1P3O B;  5CP6 B;  5AVC A;  1P34 B;  1U35 B;  3A1K A;  1KX4 B;  3LJA D;  3AZK D;  4CAY A;  2NQB C;  3P5J B;  1F1E A;  3AYW A;  3AZI B;  1M18 D;  4WU9 B;  3LEL C;  1HQ3 A;  1P3L D;  5AV6 B;  1TAF A;  4X23 C;  2F2A C;  5E5A A;  3MGS C;  3REL B;  2JCH A;  1P3P D;  3AYW B;  5CHL B;  5B0Y D;  5BO0 A;  4J8V B;  3MVD C;  4WU9 D;  2Y2O A;  2ARO C;  5B32 B;  2NZD D;  2JSS A;  3AZL A;  1TZY D;  5GSU D;  4KGC D;  3MNN A;  3REK D;  3O62 D;  3AZE C;  4J8V D;  2YFW A;  4WNN B;  3X1U A;  4YM6 A;  2HUE C;  1P3A D;  3NQU B;  3AZN A;  5AV9 D;  4UUZ A;  3AZJ C;  3A6N B;  5B2J A;  2FJ7 A;  2IO5 B;  1Q9C A;  2RVQ C;  3EG5 B;  5AV8 A;  4YM6 B;  5JA4 A;  1P3B A;  3LJA C;  3AZK C;  1KU5 A;  4YS3 A;  3WKJ A;  3KXB D;  3MGP C;  5DNN A;  5B0Z B;  3AZG B;  1M18 C;  3UTB D;  1BH8 A;  3X1S A;  5B24 A;  1P3F A;  4J8X D;  4G92 B;  4JJN B;  3V9R B;  3C1B B;  3AFA D;  4Z66 A;  4KUD D;  1T3U A;  4H9P B;  4WU9 C;  1EQZ B;  1M1A A;  2NZD C;  2XD1 A;  2Y2Q A;  1AOI D;  1TZY C;  5B1L D;  3NQJ B;  5GSU C;  3AN2 A;  3REK C;  2BYM A;  3O62 C;  2CV5 B;  5B1M A;  5BNV A;  4J8V C;  3REH D;  3AV2 A;  1M1A B;  3W98 A;  5GXQ D;  3AZF A;  5GT3 A;  1P3A C;  5AY8 A;  4G91 C;  1P3K B;  5GT0 D;  5AV5 D;  1F66 D;  5AV9 C;  1BH9 B;  5DNM D;  3W99 A;  3AZH B;  1ULY A;  3REJ B;  3B6G A;  4E44 A;  2Y2M A;  5C3I B;  4ZUX D;  5AY8 B;  4XZQ D;  5B40 B;  3REI D;  3KXB C;  3A6N C;  3MGQ A;  2F8N K;  2IO5 C;  5JRG D;  4R8P A;  5CPK D;  4WJ3 C;  1P3M B;  1ZLA B;  3UTB C;  3LZ1 A;  5BT1 D;  4J8U A;  4Z5T A;  4H9R B;  2ZY3 A;  4J8X C;  5CPI A;  1P3G B;  3AFA C;  4H9N A;  2HIO D;  4ZBJ B;  1KX3 B;  3VH5 A;  5B2I B;  4KUD C;  4QLC A;  5KDM A;  4NE6 A;  3AZG C;  2F8N B;  2PYO D;  2Y2I A;  1ZLA D;  3W97 B;  2BYK A;  2NQB A;  3B0C T;  3UTA A;  3LEL D;  1AOI C;  5B1L C;  1P3G D;  5AVB D;  1S32 D;  1KX3 D;  3MGR B;  2VQR A;  4X23 A;  3REH C;  1EQZ C;  1A7W A;  3C1C D;  5GXQ C;  5GT0 C;  5AV5 C;  1F66 C;  4AWL C;  3VH6 T;  3MVD A;  5B31 B;  4LD9 D;  1N1J A;  4J8W B;  1P3I A;  3WA9 B;  2ARO A;  4ZUX C;  5F99 A;  1KX5 B;  4XZQ C;  3REI C;  3WAA D;  5JRG C;  2JE5 A;  5BT1 C;  3WTP A;  3AZM A;  1ID3 B;  5B40 C;  5CPJ B;  5B33 B;  2HIO C;  3R45 A;  3LZ0 D;  2Y2H A;  3LJA A;  3MGP D;  2PYO C;  3AZK A;  4WU8 B;  1ZLA C;  5AVC B;  1P3O D;  5CP6 D;  1P34 D;  1ID3 D;  1U35 D;  4H9Q A;  1KX4 D;  1M18 A;  5CPJ D;  4CAY B;  5AVB C;  5BS7 C;  1P3G C;  1S32 C;  1P3L A;  1B6W A;  1KX3 C;  3KWQ A;  2L5A A;  3B0D B;  4H9S C;  4EO5 C;  3C1C C;  3TU4 A;  3AZI D;  1HQ3 B;  1P3P A;  5B0Y A;  1TAF B;  3B6F A;  5AV6 D;  5E5A B;  1WWI A;  4LD9 C;  3KWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...