1S32C

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32C00
4NFTA 1P3GA 5F99C 1S32B 1N1JB 1P3IB 3AZFA 1P3MA 5B2IA 4CAYB 5CHLB 5E5AC 3AN2A 3X1TD 3AZGC 3X1VB 1KX5B 1P34B 3AZLB 4M6BA 4KHAA 3UT9D 5CPIA 4YS3D 3NQJB 4YM6B 3B0CW 3MNNC 1P3PB 1BH9B 4ZBJB 1P3LB 5DNNA 2BYMB 5BO0B 3LZ1D 1KX4C 3WA9B 1U35D 2FJ7C 5B33D 5F99B 1ID3B 3REHD 3X1SD 4WU9C 5E5AB 3REIC 3AZGB 3LELD 3C1BC 4X23C 4NE3A 1P3GD 1P3MB 3R45B 5B2IB 4KGCC 3AZFD 3AN2D 3VH6W 4J8VC 5B24C 4J8UD 3AZJA 4EO5C 3AV2C 3UTBC 1KX4B 4UUZB 3AFAA 1AOIC 2FJ7B 5BNVA 5CPID 4WU9B 3REIB 3B0DB 3REJD 5DNND 3C1BB 4X23B 4G92C 1P3BB 3AZMC 4KGCB 3AZKC 5B1MC 4Z5TA 3VH5W 2CV5A 2NZDA 4E45A 3MGRD 5B40C 4J8VB 5B24B 3MGSA 1KU5A 1BH8A 3WAAC 3UTBB 2AROA 4E44A 3WTPC 3WKJC 5B1LC 1AOIB 1B67A 3KXBC 1F66C 5BNXB 5GSUA 4R8PA 3B0CT 5B2JA 2RVQC 4Z66C 4G92B 5CPKA 3AZEC 3B6GA 5JRGA 4AWLB 3AFAD 3AZMB 5BNVB 3AZKB 5B1MB 3KUYC 5AV9D 2BYKA 3LJAC 3O62C 5JA4A 4DRAA 5B40B 1M19C 1HQ3D 3A6NA 5GT3C 3WAAB 1P3FA 2HUEB 3KSYA 3WKJB 5AV5A 5B1LB 4LD9A 5GXQA 3KXBB 1F66B 2F8NB 5B0ZA 4Z5TD 4XZQA 2CV5D 1P3KA 1P3BA 1M18A 1R4VA 2NZDD 1BH8B 3MGSD 5B0YD 4Z66B 3AYWC 1TZYC 1N1JA 2AROD 3LZ0C 3AZEB 1S32A 3AZIC 5AY8A 1P3IA 1EQZC 4G91C 2F8NG 4XZQC 5GSUB 4HGAC 3B6FC 4H9QB 3MVDC 5C3IC 5B2JB 3KUYB 1P34A 4WNNB 3AZLA 3LJAB 3O62B 4JJND 1M19B 5CPKD 2L5AA 1B6WA 5GT3B 5JRGD 3B6GD 4WU8C 5DNMD 4KUDC 3NQJA 4YM6A 1P3PA 3VH5T 1BH9A 3AV1C 1P3LA 2BYMA 3UTAC 5AV8A 5BO0A 5BS7A 4XUJC 1ZLAC 5AVCC 4CSRB 3A6ND 5F99A 1TZYB 3LZ0B 3AYWB 1P3FD 4LD9B 5CPJD 4ZUXC 3AZIB 1EQZB 4G91B 4J8XD 4XZQB 5E5AA 1P3KB 5GXQD 5AV8C 4DRBA 5B0ZD 3AZGA 5C3IB 1M18D 3X1TC 4H9RB 5AY8B 3R45A 1S32D 2NQBD 1P3ID 1JFIB 3MNNA 3UT9C 3AV1B 3X1VD 1KX5D 1P34D 3AZNC 3AZLD 3UTAB 2YFWB 2YFVB 1KX4A 4YS3C 3TU4C 4UUZA 1ZLAB 2FJ7A 5AVCB 3LZ1C 4ZUXB 1U35C 4WU9A 4YM6D 3W97D 5B33C 5AV8B 3REIA 1P3LD 3C1BA 4X23A 2JSSA 3WA9D 3X1TB 1KX3C 3LELC 3MGQC 3C1CC 1P3OD 4KGCA 5F99D 1ID3D 3AZHC 2PYOC 1M1AC 5E5AD 4J8VA 5B24A 3AZGD 3UT9B 3KWQC 3AZNB 3AV2A 3UTBA 4J8UC 3TU4B 1P3MD 1AOIA 5B2ID 3NQUA 5FUGB 5BNXA 3MNNB 3WTPE 1KX4D 3AZMA 4NE5A 2FJ7D 3REJC 1KX3B 3LELB 3MGQB 3C1CB 1TAFB 3AZKA 5B1MA 3AZHB 2PYOB 4WZSB 4WU9D 1M1AB 5G49B 5B40A 1ULYA 3REID 2HIOC 3C1BD 3KWQB 1H3OB 2F8NH 3MGRC 3WAAA 3WTPA 1P3AC 3WKJA 4QLCC 3MGPC 4J8UB 5B1LA 3KXBA 1F66A 2F8NA 5CP6C 4J8VD 5B24D 4EO5B 3AV2B 4Z66A 3AZEA 3NQUB 4H9QA 4H9PB 5B31C 3KUYA 4H9SC 3AZJD 5BT1D 2CWEA 4WNNA 3W98C 3LJAA 3O62A 1M19A 2HIOB 4Z2MG 5GT0C 5AV9C 5GT3A 3MGRB 3REKC 3W99C 1P3AB 4QLCB 3MGPB 1HQ3C 3AZKD 5B32A 5CP6B 3RELC 3WTPB 4CSRA 4H9OB 3WAAD 3AYWA 1TZYA 3LZ0A 5AVBC 5B32C 3AZIA 3WKJD 1EQZA 3B6FA 3X1UA 3VH6T 5B0YC 3KXBD 3MVDA 1F66D 5B31B 4J8WC 3W98B 5AV6C 4H9RA 4Z66D 5GT0B 3AZED 3X1UC 3REKB 3W99B 4WU8A 4JJNC 1JFIA 5GSUD 3VH6A 1HQ3B 5B31G 4R8PD 4KUDA 1BFMA 5B2JD 3AV1A 3KUYD 3UTAA 2YFWA 2YFVA 3O62D 3LJAD 4XUJA 3RELB 1M19D 1ZLAA 5AVCA 5AVBB 4ZUXA 5B32B 3W96C 5CPJC 4J8WB 4J8XC 5AV6B 3X1TA 5AV5D 5B32G 4LD9D 1TZYD 3LZ0D 4HGAB 3B6FB 3VH5A 3X1UB 3AZID 3MVDB 4XZQD 1P3BD 1P3KD 2NQBC 3UT9A 3AZNA 4YS3A 3TU4A 5AY8D 4WU8B 3X1VC 5FUGA 4H9NA 4KUDB 3LZ1A 1U35A 3W96B 5B33A 4XUJB 5CPJB 3W97C 1KX3A 3LELA 3MGQA 3C1CA 1TAFA 3WA9C 4ZUXD 3AZHA 1P3PD 2IO5C 2PYOA 1M1AA 5G49A 3REHC 5AV8D 3X1SC 1P3OC 2NQBB 1ID3C 3KWQA 1H3OA 2F8NK 1A7WA 4J8UA 1P3GC 3AZFC 1P3MC 4Z2MH 5B2IC 3AN2C 5KDMB 4YS3B 3AZND 3W97B 4H9NB 3TU4D 3LZ1B 3REJA 2LY8A 1U35B 4H9PA 3B0BA 5B33B 3MNND 2IO5B 1P3OB 3REHB 3X1SB 5CPIC 1F1EA 2HIOA 3MGRA 5DNNC 1P3AA 3B0DC 4QLCA 3MGPA 3C1CD 3MGQD 1KX3D 1P3GB 3AZHD 2PYOD 1M1AD 4X23D 3AZFB 5CP6A 3AN2B 3KWQD 4H9OA 4KGCD 4KHAB 5B31A 4H9SA 3W98A 3AV2D 3UTBD 5CPIB 5AV9A 5BT1C 5GT0A 3AZJC 3REJB 1AOID 5DNNB 3REKA 3W99A 1WWSA 1HQ3A 3AFAC 4AWLC 4WV4B 3RELA 2HIOD 3AZMD 1P3AD 5AVBA 5B1MD 4QLCD 3MGPD 5B0YA 4NE6A 5B40D 2HUEC 4J8WA 4Z5TC 5AV6A 5CP6D 1WWIA 2CV5C 2NZDC 3WTPD 3MGSC 3AZJB 5B1LD 2F8ND 4JJNA 2AROC 3AFAB 5B31D 2RVQD 3W98D 3V9RA 5DNMA 5GSUC 4R8PC 5AV9B 5B2JC 5GT0D 3REKD 3W99D 5CPKC 3B6GC 5JRGC 3W96A 5DNMC 5CPJA 4Z5TB 4J8XA 2CV5B 5GT3D 3RELD 2NZDB 3MGSB 5AVBD 5B32D 5B0YB 3A6NC 2AROB 1P3FC 5AV5C 4LD9C 2NQBA 1HTAA 5GXQC 4J8WD 5B0ZC 4CAYA 5AV6D 1P3KC 1P3BC 4R8PB 1M18C 3AYWD 4JJNB 3X1VA 1KX5A 1EQZD 3B6FD 3X1UD 5CPKB 3MVDD 1S32C 3B6GB 1P3IC 5JRGB 5AY8C 3V9RB 5DNMB 5KDMA 1KX5C 2BYKB 1P34C 3W97A 3AZLC 5JA4B 4WU8D 4KUDD 3WA9A 3A6NB 3AV1D 3W96D 1P3FB 1Q9CA 3UTAD 3REHA 3X1SA 5AV5B 1P3OA 4J8XB 4XUJD 4YM6C 1ID3A 5GXQB 1P3PC 1ZLAD 5B0ZB 4ZBJC 1P3LC 5AVCD 1M18B 5BS7C
chains in the Genus database with same CATH superfamily
4NFTA 1P3GA 5F99C 1S32B 1N1JB 1P3IB 3AZFA 2ZY2A 1P3MA 5B2IA 4CAYB 5CHLB 5E5AC 3AN2A 3X1TD 3AZGC 3H0LC 3X1VB 1KX5B 1P34B 3AZLB 4M6BA 4KHAA 3UT9D 5CPIA 4YS3D 3NQJB 4YM6B 2J8PA 3B0CW 3MNNC 1P3PB 1BH9B 4ZBJB 1P3LB 5DNNA 2BYMB 5BO0B 3LZ1D 1KX4C 3WA9B 1U35D 2FJ7C 5B33D 5F99B 1ID3B 3REHD 3X1SD 3H0MC 4WU9C 5E5AB 3REIC 3AZGB 3LELD 3C1BC 4X23C 2Y2GA 2ZY5A 4NE3A 1P3GD 1P3MB 3R45B 5B2IB 4KGCC 2Y2JA 3AZFD 3AN2D 3VH6W 4J8VC 5B24C 4J8UD 3AZJA 4EO5C 3AV2C 3UTBC 3EPLA 1KX4B 4UUZB 3AFAA 1AOIC 2FJ7B 5BNVA 5CPID 4WU9B 3REIB 3B0DB 3REJD 5DNND 3C1BB 4X23B 4G92C 1P3BB 3AZMC 4KGCB 3AZKC 5B1MC 3IP4C 2ZY4A 4Z5TA 3VH5W 2CV5A 2NZDA 4E45A 3MGRD 5B40C 2FFFB 4J8VB 5B24B 3MGSA 1KU5A 1BH8A 3WAAC 3A1IA 3UTBB 2AROA 4E44A 3WTPC 3WKJC 5B1LC 1AOIB 1B67A 3KXBC 1F66C 5BNXB 5GSUA 4R8PA 3B0CT 5B2JA 2RVQC 4Z66C 4G92B 5CPKA 3AZEC 3B6GA 5JRGA 4AWLB 3AFAD 3AZMB 5BNVB 3AZKB 5B1MB 3KUYC 5AV9D 2BYKA 3LJAC 3O62C 5JA4A 4DRAA 5B40B 1M19C 1HQ3D 3A6NA 5GT3C 3WAAB 1PZRA 1P3FA 2HUEB 3KSYA 3WKJB 5AV5A 5B1LB 4LD9A 5GXQA 3KXBB 1F66B 2F8NB 5B0ZA 4Z5TD 4XZQA 2CV5D 1P3KA 1P3BA 1M18A 1R4VA 3EPHA 2NZDD 1BH8B 3MGSD 1T3UA 2Y2NA 5B0YD 4Z66B 3AYWC 1TZYC 1N1JA 2AROD 3LZ0C 3AZEB 1S32A 3AZIC 5AY8A 1P3IA 1EQZC 4G91C 2F8NG 4XZQC 5GSUB 2G5HC 4HGAC 4H9QB 3B6FC 3MVDC 5C3IC 5B2JB 3KUYB 1P34A 4WNNB 3AZLA 3LJAB 3O62B 4JJND 1M19B 5CPKD 2L5AA 1B6WA 5GT3B 5JRGD 3B6GD 4WU8C 5DNMD 4KUDC 2Y2KA 3NQJA 4YM6A 1P3PA 3VH5T 1BH9A 3AV1C 1P3LA 2BYMA 3UTAC 5AV8A 5BO0A 5BS7A 4XUJC 1ZLAC 5AVCC 4CSRB 3A6ND 5F99A 1TZYB 3LZ0B 2F2AC 3AYWB 1P3FD 5CPJD 4ZUXC 3AZIB 4LD9B 1EQZB 4G91B 4J8XD 4XZQB 5E5AA 1P3KB 5GXQD 5AV8C 4DRBA 3KFUG 5B0ZD 3AZGA 5C3IB 1M18D 2Y2QA 3X1TC 2Y2PA 4H9RB 5AY8B 3R45A 1S32D 2NQBD 3AL0C 1P3ID 1JFIB 3MNNA 3UT9C 3AV1B 3X1VD 1KX5D 1P34D 3AZNC 3AZLD 3UTAB 2YFWB 2YFVB 1KX4A 4YS3C 3TU4C 4UUZA 1ZLAB 2ZM5A 2FJ7A 5AVCB 3LZ1C 4ZUXB 1U35C 4WU9A 4YM6D 3W97D 5B33C 5AV8B 3REIA 1P3LD 3C1BA 4X23A 2JSSA 3WA9D 3X1TB 1KX3C 3LELC 3MGQC 3C1CC 1P3OD 4KGCA 5F99D 1ID3D 3EG5B 3AZHC 2PYOC 1M1AC 5E5AD 4J8VA 5B24A 3AZGD 3UT9B 3KWQC 3AZNB 3AV2A 3UTBA 4J8UC 3TU4B 1P3MD 1AOIA 5B2ID 3NQUA 3H0RC 5FUGB 4UPKA 5BNXA 2Y2HA 3MNNB 3FDDA 2DF4C 3WTPE 2UWXA 1KX4D 3AZMA 4NE5A 2FJ7D 3REJC 1KX3B 3LELB 3MGQB 3C1CB 1TAFB 3AZKA 5B1MA 3AZHB 2PYOB 4WZSB 4WU9D 1M1AB 2XD1A 5G49B 5B40A 1ULYA 3REID 2HIOC 3C1BD 3KWQB 1H3OB 2F8NH 3MGRC 3WAAA 3WTPA 1P3AC 3WKJA 4QLCC 3MGPC 4J8UB 5B1LA 3KXBA 1F66A 2F8NA 2G5IC 5CP6C 5B24D 4J8VD 4EO5B 3AV2B 4Z66A 2BG1A 3AZEA 2XD5A 3NQUB 4H9QA 4H9PB 5B31C 3KUYA 4H9SC 3AZJD 5BT1D 2CWEA 4WNNA 3W98C 3LJAA 3O62A 1M19A 2HIOB 4Z2MG 5GT0C 5AV9C 5GT3A 3MGRB 3REKC 3W99C 1P3AB 4QLCB 3MGPB 1HQ3C 3AZKD 5B32A 5CP6B 3RELC 3WTPB 4CSRA 4H9OB 3WAAD 3AYWA 1TZYA 1Z2CB 3LZ0A 5AVBC 5B32C 3AZIA 3WKJD 1EQZA 3B6FA 3X1UA 3VH6T 5B0YC 3KXBD 3MVDA 1F66D 5B31B 4J8WC 3W98B 5AV6C 4H9RA 3A1KA 4Z66D 5GT0B 3AZED 3X1UC 3REKB 3W99B 4WU8A 4JJNC 1JFIA 5GSUD 3VH6A 1HQ3B 5B31G 4R8PD 4KUDA 1BFMA 5B2JD 3AV1A 3KUYD 3UTAA 2YFWA 2YFVA 3O62D 3LJAD 4XUJA 3RELB 1M19D 1ZLAA 5AVCA 2JE5A 5AVBB 4ZUXA 5B32B 3W96C 2DQNC 5CPJC 4J8WB 4J8XC 5AV6B 3X1TA 2RIQA 5AV5D 5B32G 4LD9D 1TZYD 3LZ0D 2Y2MA 4HGAB 3VH5A 3X1UB 3AZID 3MVDB 3B6FB 3EPKA 4XZQD 1P3BD 1P3KD 2Y2OA 2NQBC 3UT9A 3AZNA 4YS3A 3TU4A 5AY8D 4WU8B 3X1VC 5FUGA 3EPJA 4H9NA 4KUDB 3LZ1A 1U35A 3W96B 2JCHA 5B33A 4XUJB 5CPJB 3W97C 1KX3A 3LELA 3MGQA 3C1CA 1TAFA 3WA9C 4ZUXD 3AZHA 1P3PD 2IO5C 2PYOA 1M1AA 5G49A 3REHC 5AV8D 3X1SC 3F6TA 1P3OC 2NQBB 1ID3C 3KWQA 4DQYB 1H3OA 2F8NK 1A7WA 4J8UA 4WJ3C 1P3GC 3AZFC 1P3MC 4Z2MH 5B2IC 3AN2C 5KDMB 4YS3B 3AZND 3W97B 4H9NB 3TU4D 3LZ1B 3REJA 2LY8A 1U35B 4H9PA 3B0BA 5B33B 3MNND 2IO5B 1P3OB 3REHB 5CPIC 3X1SB 1F1EA 2HIOA 3MGRA 5DNNC 1P3AA 3B0DC 4QLCA 3MGPA 3C1CD 3MGQD 1KX3D 1P3GB 2Y2IA 3AZHD 2PYOD 1M1AD 4X23D 3AZFB 5CP6A 3AN2B 3KWQD 4H9OA 4KGCD 4KHAB 5B31A 4H9SA 3W98A 3AV2D 3UTBD 5CPIB 5AV9A 5BT1C 5GT0A 3AZJC 3REJB 1AOID 5DNNB 3REKA 3W99A 2VQRA 1WWSA 1HQ3A 3AFAC 4AWLC 4WV4B 3RELA 2HIOD 3AZMD 1P3AD 5AVBA 5B1MD 4QLCD 3MGPD 5B0YA 4NE6A 5B40D 2HUEC 4J8WA 4Z5TC 5AV6A 5CP6D 1WWIA 2Y2LA 2CV5C 2NZDC 3WTPD 3MGSC 2W8SA 3AZJB 5B1LD 2F8ND 4JJNA 2AROC 3AFAB 5B31D 2RVQD 3W98D 3V9RA 5DNMA 5GSUC 4R8PC 5AV9B 3P5JB 5B2JC 5GT0D 3REKD 3W99D 5CPKC 3B6GC 5JRGC 3W96A 5DNMC 5CPJA 4Z5TB 4J8XA 2CV5B 5GT3D 3RELD 2NZDB 3MGSB 5AVBD 5B32D 5B0YB 3A6NC 2AROB 1P3FC 2ZY3A 5AV5C 4LD9C 2NQBA 1HTAA 5GXQC 4J8WD 5B0ZC 4CAYA 5AV6D 1P3KC 1P3BC 4R8PB 1M18C 3AYWD 4JJNB 3X1VA 1KX5A 1EQZD 3B6FD 3X1UD 5CPKB 3MVDD 1S32C 3B6GB 1P3IC 5JRGB 5AY8C 3V9RB 5DNMB 5KDMA 1KX5C 2BYKB 1P34C 3W97A 3AZLC 5JA4B 4WU8D 4KUDD 3WA9A 3A6NB 3AV1D 3W96D 1P3FB 1Q9CA 3UTAD 3REHA 3X1SA 5AV5B 1P3OA 4J8XB 4XUJD 4YM6C 1ID3A 5GXQB 1P3PC 1ZLAD 5B0ZB 1W2EA 4ZBJC 1P3LC 5AVCD 1M18B 5BS7C
chains in the Genus database with same CATH topology
4NFTA 1P3GA 5F99C 1S32B 1N1JB 1P3IB 3AZFA 2ZY2A 1P3MA 5B2IA 4CAYB 5CHLB 5E5AC 3AN2A 3X1TD 3AZGC 3H0LC 3X1VB 1KX5B 1P34B 3AZLB 4M6BA 4KHAA 3UT9D 5CPIA 4YS3D 3NQJB 4YM6B 2J8PA 3B0CW 3MNNC 1P3PB 1BH9B 4ZBJB 1P3LB 5DNNA 2BYMB 5BO0B 3LZ1D 1KX4C 3WA9B 1U35D 2FJ7C 5B33D 5F99B 1ID3B 3REHD 3X1SD 3H0MC 4WU9C 5E5AB 3REIC 3AZGB 3LELD 3C1BC 4X23C 2Y2GA 2ZY5A 4NE3A 1P3GD 1P3MB 3R45B 5B2IB 4KGCC 2Y2JA 3AZFD 3AN2D 3VH6W 4J8VC 5B24C 4J8UD 3AZJA 4EO5C 3AV2C 3UTBC 3EPLA 1KX4B 4UUZB 3AFAA 1AOIC 2FJ7B 5BNVA 5CPID 4WU9B 3REIB 3B0DB 3REJD 5DNND 3C1BB 4X23B 4G92C 1P3BB 3AZMC 4KGCB 3AZKC 5B1MC 3IP4C 2ZY4A 4Z5TA 3VH5W 2CV5A 2NZDA 4E45A 3MGRD 5B40C 2FFFB 4J8VB 5B24B 3MGSA 1KU5A 1BH8A 3WAAC 3A1IA 3UTBB 2AROA 4E44A 3WTPC 3WKJC 5B1LC 1AOIB 1B67A 3KXBC 1F66C 5BNXB 5GSUA 4R8PA 3B0CT 5B2JA 2RVQC 4Z66C 4G92B 5CPKA 3AZEC 3B6GA 5JRGA 4AWLB 3AFAD 3AZMB 5BNVB 3AZKB 5B1MB 3KUYC 5AV9D 2BYKA 3LJAC 3O62C 5JA4A 4DRAA 5B40B 1M19C 1HQ3D 3A6NA 5GT3C 3WAAB 1PZRA 1P3FA 2HUEB 3KSYA 3WKJB 5AV5A 5B1LB 4LD9A 5GXQA 3KXBB 1F66B 2F8NB 5B0ZA 4Z5TD 4XZQA 2CV5D 1P3KA 1P3BA 1M18A 1R4VA 3EPHA 2NZDD 1BH8B 3MGSD 1T3UA 2Y2NA 5B0YD 4Z66B 3AYWC 1TZYC 1N1JA 2AROD 3LZ0C 3AZEB 1S32A 3AZIC 5AY8A 1P3IA 1EQZC 4G91C 2F8NG 4XZQC 5GSUB 2G5HC 4HGAC 4H9QB 3B6FC 3MVDC 5C3IC 5B2JB 3KUYB 1P34A 4WNNB 3AZLA 3LJAB 3O62B 4JJND 1M19B 5CPKD 2L5AA 1B6WA 5GT3B 5JRGD 3B6GD 4WU8C 5DNMD 4KUDC 2Y2KA 3NQJA 4YM6A 1P3PA 3VH5T 1BH9A 3AV1C 1P3LA 2BYMA 3UTAC 5AV8A 5BO0A 5BS7A 4XUJC 1ZLAC 5AVCC 4CSRB 3A6ND 5F99A 1TZYB 3LZ0B 2F2AC 3AYWB 1P3FD 5CPJD 4ZUXC 3AZIB 4LD9B 1EQZB 4G91B 4J8XD 4XZQB 5E5AA 1P3KB 5GXQD 5AV8C 4DRBA 3KFUG 5B0ZD 3AZGA 5C3IB 1M18D 2Y2QA 3X1TC 2Y2PA 4H9RB 5AY8B 3R45A 1S32D 2NQBD 3AL0C 1P3ID 1JFIB 3MNNA 3UT9C 3AV1B 3X1VD 1KX5D 1P34D 3AZNC 3AZLD 3UTAB 2YFWB 2YFVB 1KX4A 4YS3C 3TU4C 4UUZA 1ZLAB 2ZM5A 2FJ7A 5AVCB 3LZ1C 4ZUXB 1U35C 4WU9A 4YM6D 3W97D 5B33C 5AV8B 3REIA 1P3LD 3C1BA 4X23A 2JSSA 3WA9D 3X1TB 1KX3C 3LELC 3MGQC 3C1CC 1P3OD 4KGCA 5F99D 1ID3D 3EG5B 3AZHC 2PYOC 1M1AC 5E5AD 4J8VA 5B24A 3AZGD 3UT9B 3KWQC 3AZNB 3AV2A 3UTBA 4J8UC 3TU4B 1P3MD 1AOIA 5B2ID 3NQUA 3H0RC 5FUGB 4UPKA 5BNXA 2Y2HA 3MNNB 3FDDA 2DF4C 3WTPE 2UWXA 1KX4D 3AZMA 4NE5A 2FJ7D 3REJC 1KX3B 3LELB 3MGQB 3C1CB 1TAFB 3AZKA 5B1MA 3AZHB 2PYOB 4WZSB 4WU9D 1M1AB 2XD1A 5G49B 5B40A 1ULYA 3REID 2HIOC 3C1BD 3KWQB 1H3OB 2F8NH 3MGRC 3WAAA 3WTPA 1P3AC 3WKJA 4QLCC 3MGPC 4J8UB 5B1LA 3KXBA 1F66A 2F8NA 2G5IC 5CP6C 5B24D 4J8VD 4EO5B 3AV2B 4Z66A 2BG1A 3AZEA 2XD5A 3NQUB 4H9QA 4H9PB 5B31C 3KUYA 4H9SC 3AZJD 5BT1D 2CWEA 4WNNA 3W98C 3LJAA 3O62A 1M19A 2HIOB 4Z2MG 5GT0C 5AV9C 5GT3A 3MGRB 3REKC 3W99C 1P3AB 4QLCB 3MGPB 1HQ3C 3AZKD 5B32A 5CP6B 3RELC 3WTPB 4CSRA 4H9OB 3WAAD 3AYWA 1TZYA 1Z2CB 3LZ0A 5AVBC 5B32C 3AZIA 3WKJD 1EQZA 3B6FA 3X1UA 3VH6T 5B0YC 3KXBD 3MVDA 1F66D 5B31B 4J8WC 3W98B 5AV6C 4H9RA 3A1KA 4Z66D 5GT0B 3AZED 3X1UC 3REKB 3W99B 4WU8A 4JJNC 1JFIA 5GSUD 3VH6A 1HQ3B 5B31G 4R8PD 4KUDA 1BFMA 5B2JD 3AV1A 3KUYD 3UTAA 2YFWA 2YFVA 3O62D 3LJAD 4XUJA 3RELB 1M19D 1ZLAA 5AVCA 2JE5A 5AVBB 4ZUXA 5B32B 3W96C 2DQNC 5CPJC 4J8WB 4J8XC 5AV6B 3X1TA 2RIQA 5AV5D 5B32G 4LD9D 1TZYD 3LZ0D 2Y2MA 4HGAB 3VH5A 3X1UB 3AZID 3MVDB 3B6FB 3EPKA 4XZQD 1P3BD 1P3KD 2Y2OA 2NQBC 3UT9A 3AZNA 4YS3A 3TU4A 5AY8D 4WU8B 3X1VC 5FUGA 3EPJA 4H9NA 4KUDB 3LZ1A 1U35A 3W96B 2JCHA 5B33A 4XUJB 5CPJB 3W97C 1KX3A 3LELA 3MGQA 3C1CA 1TAFA 3WA9C 4ZUXD 3AZHA 1P3PD 2IO5C 2PYOA 1M1AA 5G49A 3REHC 5AV8D 3X1SC 3F6TA 1P3OC 2NQBB 1ID3C 3KWQA 4DQYB 1H3OA 2F8NK 1A7WA 4J8UA 4WJ3C 1P3GC 3AZFC 1P3MC 4Z2MH 5B2IC 3AN2C 5KDMB 4YS3B 3AZND 3W97B 4H9NB 3TU4D 3LZ1B 3REJA 2LY8A 1U35B 4H9PA 3B0BA 5B33B 3MNND 2IO5B 1P3OB 3REHB 5CPIC 3X1SB 1F1EA 2HIOA 3MGRA 5DNNC 1P3AA 3B0DC 4QLCA 3MGPA 3C1CD 3MGQD 1KX3D 1P3GB 2Y2IA 3AZHD 2PYOD 1M1AD 4X23D 3AZFB 5CP6A 3AN2B 3KWQD 4H9OA 4KGCD 4KHAB 5B31A 4H9SA 3W98A 3AV2D 3UTBD 5CPIB 5AV9A 5BT1C 5GT0A 3AZJC 3REJB 1AOID 5DNNB 3REKA 3W99A 2VQRA 1WWSA 1HQ3A 3AFAC 4AWLC 4WV4B 3RELA 2HIOD 3AZMD 1P3AD 5AVBA 5B1MD 4QLCD 3MGPD 5B0YA 4NE6A 5B40D 2HUEC 4J8WA 4Z5TC 5AV6A 5CP6D 1WWIA 2Y2LA 2CV5C 2NZDC 3WTPD 3MGSC 2W8SA 3AZJB 5B1LD 2F8ND 4JJNA 2AROC 3AFAB 5B31D 2RVQD 3W98D 3V9RA 5DNMA 5GSUC 4R8PC 5AV9B 3P5JB 5B2JC 5GT0D 3REKD 3W99D 5CPKC 3B6GC 5JRGC 3W96A 5DNMC 5CPJA 4Z5TB 4J8XA 2CV5B 5GT3D 3RELD 2NZDB 3MGSB 5AVBD 5B32D 5B0YB 3A6NC 2AROB 1P3FC 2ZY3A 5AV5C 4LD9C 2NQBA 1HTAA 5GXQC 4J8WD 5B0ZC 4CAYA 5AV6D 1P3KC 1P3BC 4R8PB 1M18C 3AYWD 4JJNB 3X1VA 1KX5A 1EQZD 3B6FD 3X1UD 5CPKB 3MVDD 1S32C 3B6GB 1P3IC 5JRGB 5AY8C 3V9RB 5DNMB 5KDMA 1KX5C 2BYKB 1P34C 3W97A 3AZLC 5JA4B 4WU8D 4KUDD 3WA9A 3A6NB 3AV1D 3W96D 1P3FB 1Q9CA 3UTAD 3REHA 3X1SA 5AV5B 1P3OA 4J8XB 4XUJD 4YM6C 1ID3A 5GXQB 1P3PC 1ZLAD 5B0ZB 1W2EA 4ZBJC 1P3LC 5AVCD 1M18B 5BS7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFT A;  1P3G A;  5F99 C;  1S32 B;  1N1J B;  1P3I B;  3AZF A;  1P3M A;  5B2I A;  4CAY B;  5CHL B;  5E5A C;  3AN2 A;  3X1T D;  3AZG C;  3X1V B;  1KX5 B;  1P34 B;  3AZL B;  4M6B A;  4KHA A;  3UT9 D;  5CPI A;  4YS3 D;  3NQJ B;  4YM6 B;  3B0C W;  3MNN C;  1P3P B;  1BH9 B;  4ZBJ B;  1P3L B;  5DNN A;  2BYM B;  5BO0 B;  3LZ1 D;  1KX4 C;  3WA9 B;  1U35 D;  2FJ7 C;  5B33 D;  5F99 B;  1ID3 B;  3REH D;  3X1S D;  4WU9 C;  5E5A B;  3REI C;  3AZG B;  3LEL D;  3C1B C;  4X23 C;  4NE3 A;  1P3G D;  1P3M B;  3R45 B;  5B2I B;  4KGC C;  3AZF D;  3AN2 D;  3VH6 W;  4J8V C;  5B24 C;  4J8U D;  3AZJ A;  4EO5 C;  3AV2 C;  3UTB C;  1KX4 B;  4UUZ B;  3AFA A;  1AOI C;  2FJ7 B;  5BNV A;  5CPI D;  4WU9 B;  3REI B;  3B0D B;  3REJ D;  5DNN D;  3C1B B;  4X23 B;  4G92 C;  1P3B B;  3AZM C;  4KGC B;  3AZK C;  5B1M C;  4Z5T A;  3VH5 W;  2CV5 A;  2NZD A;  4E45 A;  3MGR D;  5B40 C;  4J8V B;  5B24 B;  3MGS A;  1KU5 A;  1BH8 A;  3WAA C;  3UTB B;  2ARO A;  4E44 A;  3WTP C;  3WKJ C;  5B1L C;  1AOI B;  1B67 A;  3KXB C;  1F66 C;  5BNX B;  5GSU A;  4R8P A;  3B0C T;  5B2J A;  2RVQ C;  4Z66 C;  4G92 B;  5CPK A;  3AZE C;  3B6G A;  5JRG A;  4AWL B;  3AFA D;  3AZM B;  5BNV B;  3AZK B;  5B1M B;  3KUY C;  5AV9 D;  2BYK A;  3LJA C;  3O62 C;  5JA4 A;  4DRA A;  5B40 B;  1M19 C;  1HQ3 D;  3A6N A;  5GT3 C;  3WAA B;  1P3F A;  2HUE B;  3KSY A;  3WKJ B;  5AV5 A;  5B1L B;  4LD9 A;  5GXQ A;  3KXB B;  1F66 B;  2F8N B;  5B0Z A;  4Z5T D;  4XZQ A;  2CV5 D;  1P3K A;  1P3B A;  1M18 A;  1R4V A;  2NZD D;  1BH8 B;  3MGS D;  5B0Y D;  4Z66 B;  3AYW C;  1TZY C;  1N1J A;  2ARO D;  3LZ0 C;  3AZE B;  1S32 A;  3AZI C;  5AY8 A;  1P3I A;  1EQZ C;  4G91 C;  2F8N G;  4XZQ C;  5GSU B;  4HGA C;  3B6F C;  4H9Q B;  3MVD C;  5C3I C;  5B2J B;  3KUY B;  1P34 A;  4WNN B;  3AZL A;  3LJA B;  3O62 B;  4JJN D;  1M19 B;  5CPK D;  2L5A A;  1B6W A;  5GT3 B;  5JRG D;  3B6G D;  4WU8 C;  5DNM D;  4KUD C;  3NQJ A;  4YM6 A;  1P3P A;  3VH5 T;  1BH9 A;  3AV1 C;  1P3L A;  2BYM A;  3UTA C;  5AV8 A;  5BO0 A;  5BS7 A;  4XUJ C;  1ZLA C;  5AVC C;  4CSR B;  3A6N D;  5F99 A;  1TZY B;  3LZ0 B;  3AYW B;  1P3F D;  4LD9 B;  5CPJ D;  4ZUX C;  3AZI B;  1EQZ B;  4G91 B;  4J8X D;  4XZQ B;  5E5A A;  1P3K B;  5GXQ D;  5AV8 C;  4DRB A;  5B0Z D;  3AZG A;  5C3I B;  1M18 D;  3X1T C;  4H9R B;  5AY8 B;  3R45 A;  1S32 D;  2NQB D;  1P3I D;  1JFI B;  3MNN A;  3UT9 C;  3AV1 B;  3X1V D;  1KX5 D;  1P34 D;  3AZN C;  3AZL D;  3UTA B;  2YFW B;  2YFV B;  1KX4 A;  4YS3 C;  3TU4 C;  4UUZ A;  1ZLA B;  2FJ7 A;  5AVC B;  3LZ1 C;  4ZUX B;  1U35 C;  4WU9 A;  4YM6 D;  3W97 D;  5B33 C;  5AV8 B;  3REI A;  1P3L D;  3C1B A;  4X23 A;  2JSS A;  3WA9 D;  3X1T B;  1KX3 C;  3LEL C;  3MGQ C;  3C1C C;  1P3O D;  4KGC A;  5F99 D;  1ID3 D;  3AZH C;  2PYO C;  1M1A C;  5E5A D;  4J8V A;  5B24 A;  3AZG D;  3UT9 B;  3KWQ C;  3AZN B;  3AV2 A;  3UTB A;  4J8U C;  3TU4 B;  1P3M D;  1AOI A;  5B2I D;  3NQU A;  5FUG B;  5BNX A;  3MNN B;  3WTP E;  1KX4 D;  3AZM A;  4NE5 A;  2FJ7 D;  3REJ C;  1KX3 B;  3LEL B;  3MGQ B;  3C1C B;  1TAF B;  3AZK A;  5B1M A;  3AZH B;  2PYO B;  4WZS B;  4WU9 D;  1M1A B;  5G49 B;  5B40 A;  1ULY A;  3REI D;  2HIO C;  3C1B D;  3KWQ B;  1H3O B;  2F8N H;  3MGR C;  3WAA A;  3WTP A;  1P3A C;  3WKJ A;  4QLC C;  3MGP C;  4J8U B;  5B1L A;  3KXB A;  1F66 A;  2F8N A;  5CP6 C;  4J8V D;  5B24 D;  4EO5 B;  3AV2 B;  4Z66 A;  3AZE A;  3NQU B;  4H9Q A;  4H9P B;  5B31 C;  3KUY A;  4H9S C;  3AZJ D;  5BT1 D;  2CWE A;  4WNN A;  3W98 C;  3LJA A;  3O62 A;  1M19 A;  2HIO B;  4Z2M G;  5GT0 C;  5AV9 C;  5GT3 A;  3MGR B;  3REK C;  3W99 C;  1P3A B;  4QLC B;  3MGP B;  1HQ3 C;  3AZK D;  5B32 A;  5CP6 B;  3REL C;  3WTP B;  4CSR A;  4H9O B;  3WAA D;  3AYW A;  1TZY A;  3LZ0 A;  5AVB C;  5B32 C;  3AZI A;  3WKJ D;  1EQZ A;  3B6F A;  3X1U A;  3VH6 T;  5B0Y C;  3KXB D;  3MVD A;  1F66 D;  5B31 B;  4J8W C;  3W98 B;  5AV6 C;  4H9R A;  4Z66 D;  5GT0 B;  3AZE D;  3X1U C;  3REK B;  3W99 B;  4WU8 A;  4JJN C;  1JFI A;  5GSU D;  3VH6 A;  1HQ3 B;  5B31 G;  4R8P D;  4KUD A;  1BFM A;  5B2J D;  3AV1 A;  3KUY D;  3UTA A;  2YFW A;  2YFV A;  3O62 D;  3LJA D;  4XUJ A;  3REL B;  1M19 D;  1ZLA A;  5AVC A;  5AVB B;  4ZUX A;  5B32 B;  3W96 C;  5CPJ C;  4J8W B;  4J8X C;  5AV6 B;  3X1T A;  5AV5 D;  5B32 G;  4LD9 D;  1TZY D;  3LZ0 D;  4HGA B;  3B6F B;  3VH5 A;  3X1U B;  3AZI D;  3MVD B;  4XZQ D;  1P3B D;  1P3K D;  2NQB C;  3UT9 A;  3AZN A;  4YS3 A;  3TU4 A;  5AY8 D;  4WU8 B;  3X1V C;  5FUG A;  4H9N A;  4KUD B;  3LZ1 A;  1U35 A;  3W96 B;  5B33 A;  4XUJ B;  5CPJ B;  3W97 C;  1KX3 A;  3LEL A;  3MGQ A;  3C1C A;  1TAF A;  3WA9 C;  4ZUX D;  3AZH A;  1P3P D;  2IO5 C;  2PYO A;  1M1A A;  5G49 A;  3REH C;  5AV8 D;  3X1S C;  1P3O C;  2NQB B;  1ID3 C;  3KWQ A;  1H3O A;  2F8N K;  1A7W A;  4J8U A;  1P3G C;  3AZF C;  1P3M C;  4Z2M H;  5B2I C;  3AN2 C;  5KDM B;  4YS3 B;  3AZN D;  3W97 B;  4H9N B;  3TU4 D;  3LZ1 B;  3REJ A;  2LY8 A;  1U35 B;  4H9P A;  3B0B A;  5B33 B;  3MNN D;  2IO5 B;  1P3O B;  3REH B;  3X1S B;  5CPI C;  1F1E A;  2HIO A;  3MGR A;  5DNN C;  1P3A A;  3B0D C;  4QLC A;  3MGP A;  3C1C D;  3MGQ D;  1KX3 D;  1P3G B;  3AZH D;  2PYO D;  1M1A D;  4X23 D;  3AZF B;  5CP6 A;  3AN2 B;  3KWQ D;  4H9O A;  4KGC D;  4KHA B;  5B31 A;  4H9S A;  3W98 A;  3AV2 D;  3UTB D;  5CPI B;  5AV9 A;  5BT1 C;  5GT0 A;  3AZJ C;  3REJ B;  1AOI D;  5DNN B;  3REK A;  3W99 A;  1WWS A;  1HQ3 A;  3AFA C;  4AWL C;  4WV4 B;  3REL A;  2HIO D;  3AZM D;  1P3A D;  5AVB A;  5B1M D;  4QLC D;  3MGP D;  5B0Y A;  4NE6 A;  5B40 D;  2HUE C;  4J8W A;  4Z5T C;  5AV6 A;  5CP6 D;  1WWI A;  2CV5 C;  2NZD C;  3WTP D;  3MGS C;  3AZJ B;  5B1L D;  2F8N D;  4JJN A;  2ARO C;  3AFA B;  5B31 D;  2RVQ D;  3W98 D;  3V9R A;  5DNM A;  5GSU C;  4R8P C;  5AV9 B;  5B2J C;  5GT0 D;  3REK D;  3W99 D;  5CPK C;  3B6G C;  5JRG C;  3W96 A;  5DNM C;  5CPJ A;  4Z5T B;  4J8X A;  2CV5 B;  5GT3 D;  3REL D;  2NZD B;  3MGS B;  5AVB D;  5B32 D;  5B0Y B;  3A6N C;  2ARO B;  1P3F C;  5AV5 C;  4LD9 C;  2NQB A;  1HTA A;  5GXQ C;  4J8W D;  5B0Z C;  4CAY A;  5AV6 D;  1P3K C;  1P3B C;  4R8P B;  1M18 C;  3AYW D;  4JJN B;  3X1V A;  1KX5 A;  1EQZ D;  3B6F D;  3X1U D;  5CPK B;  3MVD D;  1S32 C;  3B6G B;  1P3I C;  5JRG B;  5AY8 C;  3V9R B;  5DNM B;  5KDM A;  1KX5 C;  2BYK B;  1P34 C;  3W97 A;  3AZL C;  5JA4 B;  4WU8 D;  4KUD D;  3WA9 A;  3A6N B;  3AV1 D;  3W96 D;  1P3F B;  1Q9C A;  3UTA D;  3REH A;  3X1S A;  5AV5 B;  1P3O A;  4J8X B;  4XUJ D;  4YM6 C;  1ID3 A;  5GXQ B;  1P3P C;  1ZLA D;  5B0Z B;  4ZBJ C;  1P3L C;  5AVC D;  1M18 B;  5BS7 C; 
#chains in the Genus database with same CATH topology
 4NFT A;  1P3G A;  5F99 C;  1S32 B;  1N1J B;  1P3I B;  3AZF A;  2ZY2 A;  1P3M A;  5B2I A;  4CAY B;  5CHL B;  5E5A C;  3AN2 A;  3X1T D;  3AZG C;  3H0L C;  3X1V B;  1KX5 B;  1P34 B;  3AZL B;  4M6B A;  4KHA A;  3UT9 D;  5CPI A;  4YS3 D;  3NQJ B;  4YM6 B;  2J8P A;  3B0C W;  3MNN C;  1P3P B;  1BH9 B;  4ZBJ B;  1P3L B;  5DNN A;  2BYM B;  5BO0 B;  3LZ1 D;  1KX4 C;  3WA9 B;  1U35 D;  2FJ7 C;  5B33 D;  5F99 B;  1ID3 B;  3REH D;  3X1S D;  3H0M C;  4WU9 C;  5E5A B;  3REI C;  3AZG B;  3LEL D;  3C1B C;  4X23 C;  2Y2G A;  2ZY5 A;  4NE3 A;  1P3G D;  1P3M B;  3R45 B;  5B2I B;  4KGC C;  2Y2J A;  3AZF D;  3AN2 D;  3VH6 W;  4J8V C;  5B24 C;  4J8U D;  3AZJ A;  4EO5 C;  3AV2 C;  3UTB C;  3EPL A;  1KX4 B;  4UUZ B;  3AFA A;  1AOI C;  2FJ7 B;  5BNV A;  5CPI D;  4WU9 B;  3REI B;  3B0D B;  3REJ D;  5DNN D;  3C1B B;  4X23 B;  4G92 C;  1P3B B;  3AZM C;  4KGC B;  3AZK C;  5B1M C;  3IP4 C;  2ZY4 A;  4Z5T A;  3VH5 W;  2CV5 A;  2NZD A;  4E45 A;  3MGR D;  5B40 C;  2FFF B;  4J8V B;  5B24 B;  3MGS A;  1KU5 A;  1BH8 A;  3WAA C;  3A1I A;  3UTB B;  2ARO A;  4E44 A;  3WTP C;  3WKJ C;  5B1L C;  1AOI B;  1B67 A;  3KXB C;  1F66 C;  5BNX B;  5GSU A;  4R8P A;  3B0C T;  5B2J A;  2RVQ C;  4Z66 C;  4G92 B;  5CPK A;  3AZE C;  3B6G A;  5JRG A;  4AWL B;  3AFA D;  3AZM B;  5BNV B;  3AZK B;  5B1M B;  3KUY C;  5AV9 D;  2BYK A;  3LJA C;  3O62 C;  5JA4 A;  4DRA A;  5B40 B;  1M19 C;  1HQ3 D;  3A6N A;  5GT3 C;  3WAA B;  1PZR A;  1P3F A;  2HUE B;  3KSY A;  3WKJ B;  5AV5 A;  5B1L B;  4LD9 A;  5GXQ A;  3KXB B;  1F66 B;  2F8N B;  5B0Z A;  4Z5T D;  4XZQ A;  2CV5 D;  1P3K A;  1P3B A;  1M18 A;  1R4V A;  3EPH A;  2NZD D;  1BH8 B;  3MGS D;  1T3U A;  2Y2N A;  5B0Y D;  4Z66 B;  3AYW C;  1TZY C;  1N1J A;  2ARO D;  3LZ0 C;  3AZE B;  1S32 A;  3AZI C;  5AY8 A;  1P3I A;  1EQZ C;  4G91 C;  2F8N G;  4XZQ C;  5GSU B;  2G5H C;  4HGA C;  4H9Q B;  3B6F C;  3MVD C;  5C3I C;  5B2J B;  3KUY B;  1P34 A;  4WNN B;  3AZL A;  3LJA B;  3O62 B;  4JJN D;  1M19 B;  5CPK D;  2L5A A;  1B6W A;  5GT3 B;  5JRG D;  3B6G D;  4WU8 C;  5DNM D;  4KUD C;  2Y2K A;  3NQJ A;  4YM6 A;  1P3P A;  3VH5 T;  1BH9 A;  3AV1 C;  1P3L A;  2BYM A;  3UTA C;  5AV8 A;  5BO0 A;  5BS7 A;  4XUJ C;  1ZLA C;  5AVC C;  4CSR B;  3A6N D;  5F99 A;  1TZY B;  3LZ0 B;  2F2A C;  3AYW B;  1P3F D;  5CPJ D;  4ZUX C;  3AZI B;  4LD9 B;  1EQZ B;  4G91 B;  4J8X D;  4XZQ B;  5E5A A;  1P3K B;  5GXQ D;  5AV8 C;  4DRB A;  3KFU G;  5B0Z D;  3AZG A;  5C3I B;  1M18 D;  2Y2Q A;  3X1T C;  2Y2P A;  4H9R B;  5AY8 B;  3R45 A;  1S32 D;  2NQB D;  3AL0 C;  1P3I D;  1JFI B;  3MNN A;  3UT9 C;  3AV1 B;  3X1V D;  1KX5 D;  1P34 D;  3AZN C;  3AZL D;  3UTA B;  2YFW B;  2YFV B;  1KX4 A;  4YS3 C;  3TU4 C;  4UUZ A;  1ZLA B;  2ZM5 A;  2FJ7 A;  5AVC B;  3LZ1 C;  4ZUX B;  1U35 C;  4WU9 A;  4YM6 D;  3W97 D;  5B33 C;  5AV8 B;  3REI A;  1P3L D;  3C1B A;  4X23 A;  2JSS A;  3WA9 D;  3X1T B;  1KX3 C;  3LEL C;  3MGQ C;  3C1C C;  1P3O D;  4KGC A;  5F99 D;  1ID3 D;  3EG5 B;  3AZH C;  2PYO C;  1M1A C;  5E5A D;  4J8V A;  5B24 A;  3AZG D;  3UT9 B;  3KWQ C;  3AZN B;  3AV2 A;  3UTB A;  4J8U C;  3TU4 B;  1P3M D;  1AOI A;  5B2I D;  3NQU A;  3H0R C;  5FUG B;  4UPK A;  5BNX A;  2Y2H A;  3MNN B;  3FDD A;  2DF4 C;  3WTP E;  2UWX A;  1KX4 D;  3AZM A;  4NE5 A;  2FJ7 D;  3REJ C;  1KX3 B;  3LEL B;  3MGQ B;  3C1C B;  1TAF B;  3AZK A;  5B1M A;  3AZH B;  2PYO B;  4WZS B;  4WU9 D;  1M1A B;  2XD1 A;  5G49 B;  5B40 A;  1ULY A;  3REI D;  2HIO C;  3C1B D;  3KWQ B;  1H3O B;  2F8N H;  3MGR C;  3WAA A;  3WTP A;  1P3A C;  3WKJ A;  4QLC C;  3MGP C;  4J8U B;  5B1L A;  3KXB A;  1F66 A;  2F8N A;  2G5I C;  5CP6 C;  5B24 D;  4J8V D;  4EO5 B;  3AV2 B;  4Z66 A;  2BG1 A;  3AZE A;  2XD5 A;  3NQU B;  4H9Q A;  4H9P B;  5B31 C;  3KUY A;  4H9S C;  3AZJ D;  5BT1 D;  2CWE A;  4WNN A;  3W98 C;  3LJA A;  3O62 A;  1M19 A;  2HIO B;  4Z2M G;  5GT0 C;  5AV9 C;  5GT3 A;  3MGR B;  3REK C;  3W99 C;  1P3A B;  4QLC B;  3MGP B;  1HQ3 C;  3AZK D;  5B32 A;  5CP6 B;  3REL C;  3WTP B;  4CSR A;  4H9O B;  3WAA D;  3AYW A;  1TZY A;  1Z2C B;  3LZ0 A;  5AVB C;  5B32 C;  3AZI A;  3WKJ D;  1EQZ A;  3B6F A;  3X1U A;  3VH6 T;  5B0Y C;  3KXB D;  3MVD A;  1F66 D;  5B31 B;  4J8W C;  3W98 B;  5AV6 C;  4H9R A;  3A1K A;  4Z66 D;  5GT0 B;  3AZE D;  3X1U C;  3REK B;  3W99 B;  4WU8 A;  4JJN C;  1JFI A;  5GSU D;  3VH6 A;  1HQ3 B;  5B31 G;  4R8P D;  4KUD A;  1BFM A;  5B2J D;  3AV1 A;  3KUY D;  3UTA A;  2YFW A;  2YFV A;  3O62 D;  3LJA D;  4XUJ A;  3REL B;  1M19 D;  1ZLA A;  5AVC A;  2JE5 A;  5AVB B;  4ZUX A;  5B32 B;  3W96 C;  2DQN C;  5CPJ C;  4J8W B;  4J8X C;  5AV6 B;  3X1T A;  2RIQ A;  5AV5 D;  5B32 G;  4LD9 D;  1TZY D;  3LZ0 D;  2Y2M A;  4HGA B;  3VH5 A;  3X1U B;  3AZI D;  3MVD B;  3B6F B;  3EPK A;  4XZQ D;  1P3B D;  1P3K D;  2Y2O A;  2NQB C;  3UT9 A;  3AZN A;  4YS3 A;  3TU4 A;  5AY8 D;  4WU8 B;  3X1V C;  5FUG A;  3EPJ A;  4H9N A;  4KUD B;  3LZ1 A;  1U35 A;  3W96 B;  2JCH A;  5B33 A;  4XUJ B;  5CPJ B;  3W97 C;  1KX3 A;  3LEL A;  3MGQ A;  3C1C A;  1TAF A;  3WA9 C;  4ZUX D;  3AZH A;  1P3P D;  2IO5 C;  2PYO A;  1M1A A;  5G49 A;  3REH C;  5AV8 D;  3X1S C;  3F6T A;  1P3O C;  2NQB B;  1ID3 C;  3KWQ A;  4DQY B;  1H3O A;  2F8N K;  1A7W A;  4J8U A;  4WJ3 C;  1P3G C;  3AZF C;  1P3M C;  4Z2M H;  5B2I C;  3AN2 C;  5KDM B;  4YS3 B;  3AZN D;  3W97 B;  4H9N B;  3TU4 D;  3LZ1 B;  3REJ A;  2LY8 A;  1U35 B;  4H9P A;  3B0B A;  5B33 B;  3MNN D;  2IO5 B;  1P3O B;  3REH B;  5CPI C;  3X1S B;  1F1E A;  2HIO A;  3MGR A;  5DNN C;  1P3A A;  3B0D C;  4QLC A;  3MGP A;  3C1C D;  3MGQ D;  1KX3 D;  1P3G B;  2Y2I A;  3AZH D;  2PYO D;  1M1A D;  4X23 D;  3AZF B;  5CP6 A;  3AN2 B;  3KWQ D;  4H9O A;  4KGC D;  4KHA B;  5B31 A;  4H9S A;  3W98 A;  3AV2 D;  3UTB D;  5CPI B;  5AV9 A;  5BT1 C;  5GT0 A;  3AZJ C;  3REJ B;  1AOI D;  5DNN B;  3REK A;  3W99 A;  2VQR A;  1WWS A;  1HQ3 A;  3AFA C;  4AWL C;  4WV4 B;  3REL A;  2HIO D;  3AZM D;  1P3A D;  5AVB A;  5B1M D;  4QLC D;  3MGP D;  5B0Y A;  4NE6 A;  5B40 D;  2HUE C;  4J8W A;  4Z5T C;  5AV6 A;  5CP6 D;  1WWI A;  2Y2L A;  2CV5 C;  2NZD C;  3WTP D;  3MGS C;  2W8S A;  3AZJ B;  5B1L D;  2F8N D;  4JJN A;  2ARO C;  3AFA B;  5B31 D;  2RVQ D;  3W98 D;  3V9R A;  5DNM A;  5GSU C;  4R8P C;  5AV9 B;  3P5J B;  5B2J C;  5GT0 D;  3REK D;  3W99 D;  5CPK C;  3B6G C;  5JRG C;  3W96 A;  5DNM C;  5CPJ A;  4Z5T B;  4J8X A;  2CV5 B;  5GT3 D;  3REL D;  2NZD B;  3MGS B;  5AVB D;  5B32 D;  5B0Y B;  3A6N C;  2ARO B;  1P3F C;  2ZY3 A;  5AV5 C;  4LD9 C;  2NQB A;  1HTA A;  5GXQ C;  4J8W D;  5B0Z C;  4CAY A;  5AV6 D;  1P3K C;  1P3B C;  4R8P B;  1M18 C;  3AYW D;  4JJN B;  3X1V A;  1KX5 A;  1EQZ D;  3B6F D;  3X1U D;  5CPK B;  3MVD D;  1S32 C;  3B6G B;  1P3I C;  5JRG B;  5AY8 C;  3V9R B;  5DNM B;  5KDM A;  1KX5 C;  2BYK B;  1P34 C;  3W97 A;  3AZL C;  5JA4 B;  4WU8 D;  4KUD D;  3WA9 A;  3A6N B;  3AV1 D;  3W96 D;  1P3F B;  1Q9C A;  3UTA D;  3REH A;  3X1S A;  5AV5 B;  1P3O A;  4J8X B;  4XUJ D;  4YM6 C;  1ID3 A;  5GXQ B;  1P3P C;  1ZLA D;  5B0Z B;  1W2E A;  4ZBJ C;  1P3L C;  5AVC D;  1M18 B;  5BS7 C; 
#chains in the Genus database with same CATH homology
 4NFT A;  1P3G A;  5F99 C;  1S32 B;  1N1J B;  1P3I B;  3AZF A;  2ZY2 A;  1P3M A;  5B2I A;  4CAY B;  5CHL B;  5E5A C;  3AN2 A;  3X1T D;  3AZG C;  3H0L C;  3X1V B;  1KX5 B;  1P34 B;  3AZL B;  4M6B A;  4KHA A;  3UT9 D;  5CPI A;  4YS3 D;  3NQJ B;  4YM6 B;  2J8P A;  3B0C W;  3MNN C;  1P3P B;  1BH9 B;  4ZBJ B;  1P3L B;  5DNN A;  2BYM B;  5BO0 B;  3LZ1 D;  1KX4 C;  3WA9 B;  1U35 D;  2FJ7 C;  5B33 D;  5F99 B;  1ID3 B;  3REH D;  3X1S D;  3H0M C;  4WU9 C;  5E5A B;  3REI C;  3AZG B;  3LEL D;  3C1B C;  4X23 C;  2Y2G A;  2ZY5 A;  4NE3 A;  1P3G D;  1P3M B;  3R45 B;  5B2I B;  4KGC C;  2Y2J A;  3AZF D;  3AN2 D;  3VH6 W;  4J8V C;  5B24 C;  4J8U D;  3AZJ A;  4EO5 C;  3AV2 C;  3UTB C;  3EPL A;  1KX4 B;  4UUZ B;  3AFA A;  1AOI C;  2FJ7 B;  5BNV A;  5CPI D;  4WU9 B;  3REI B;  3B0D B;  3REJ D;  5DNN D;  3C1B B;  4X23 B;  4G92 C;  1P3B B;  3AZM C;  4KGC B;  3AZK C;  5B1M C;  3IP4 C;  2ZY4 A;  4Z5T A;  3VH5 W;  2CV5 A;  2NZD A;  4E45 A;  3MGR D;  5B40 C;  2FFF B;  4J8V B;  5B24 B;  3MGS A;  1KU5 A;  1BH8 A;  3WAA C;  3A1I A;  3UTB B;  2ARO A;  4E44 A;  3WTP C;  3WKJ C;  5B1L C;  1AOI B;  1B67 A;  3KXB C;  1F66 C;  5BNX B;  5GSU A;  4R8P A;  3B0C T;  5B2J A;  2RVQ C;  4Z66 C;  4G92 B;  5CPK A;  3AZE C;  3B6G A;  5JRG A;  4AWL B;  3AFA D;  3AZM B;  5BNV B;  3AZK B;  5B1M B;  3KUY C;  5AV9 D;  2BYK A;  3LJA C;  3O62 C;  5JA4 A;  4DRA A;  5B40 B;  1M19 C;  1HQ3 D;  3A6N A;  5GT3 C;  3WAA B;  1PZR A;  1P3F A;  2HUE B;  3KSY A;  3WKJ B;  5AV5 A;  5B1L B;  4LD9 A;  5GXQ A;  3KXB B;  1F66 B;  2F8N B;  5B0Z A;  4Z5T D;  4XZQ A;  2CV5 D;  1P3K A;  1P3B A;  1M18 A;  1R4V A;  3EPH A;  2NZD D;  1BH8 B;  3MGS D;  1T3U A;  2Y2N A;  5B0Y D;  4Z66 B;  3AYW C;  1TZY C;  1N1J A;  2ARO D;  3LZ0 C;  3AZE B;  1S32 A;  3AZI C;  5AY8 A;  1P3I A;  1EQZ C;  4G91 C;  2F8N G;  4XZQ C;  5GSU B;  2G5H C;  4HGA C;  4H9Q B;  3B6F C;  3MVD C;  5C3I C;  5B2J B;  3KUY B;  1P34 A;  4WNN B;  3AZL A;  3LJA B;  3O62 B;  4JJN D;  1M19 B;  5CPK D;  2L5A A;  1B6W A;  5GT3 B;  5JRG D;  3B6G D;  4WU8 C;  5DNM D;  4KUD C;  2Y2K A;  3NQJ A;  4YM6 A;  1P3P A;  3VH5 T;  1BH9 A;  3AV1 C;  1P3L A;  2BYM A;  3UTA C;  5AV8 A;  5BO0 A;  5BS7 A;  4XUJ C;  1ZLA C;  5AVC C;  4CSR B;  3A6N D;  5F99 A;  1TZY B;  3LZ0 B;  2F2A C;  3AYW B;  1P3F D;  5CPJ D;  4ZUX C;  3AZI B;  4LD9 B;  1EQZ B;  4G91 B;  4J8X D;  4XZQ B;  5E5A A;  1P3K B;  5GXQ D;  5AV8 C;  4DRB A;  3KFU G;  5B0Z D;  3AZG A;  5C3I B;  1M18 D;  2Y2Q A;  3X1T C;  2Y2P A;  4H9R B;  5AY8 B;  3R45 A;  1S32 D;  2NQB D;  3AL0 C;  1P3I D;  1JFI B;  3MNN A;  3UT9 C;  3AV1 B;  3X1V D;  1KX5 D;  1P34 D;  3AZN C;  3AZL D;  3UTA B;  2YFW B;  2YFV B;  1KX4 A;  4YS3 C;  3TU4 C;  4UUZ A;  1ZLA B;  2ZM5 A;  2FJ7 A;  5AVC B;  3LZ1 C;  4ZUX B;  1U35 C;  4WU9 A;  4YM6 D;  3W97 D;  5B33 C;  5AV8 B;  3REI A;  1P3L D;  3C1B A;  4X23 A;  2JSS A;  3WA9 D;  3X1T B;  1KX3 C;  3LEL C;  3MGQ C;  3C1C C;  1P3O D;  4KGC A;  5F99 D;  1ID3 D;  3EG5 B;  3AZH C;  2PYO C;  1M1A C;  5E5A D;  4J8V A;  5B24 A;  3AZG D;  3UT9 B;  3KWQ C;  3AZN B;  3AV2 A;  3UTB A;  4J8U C;  3TU4 B;  1P3M D;  1AOI A;  5B2I D;  3NQU A;  3H0R C;  5FUG B;  4UPK A;  5BNX A;  2Y2H A;  3MNN B;  3FDD A;  2DF4 C;  3WTP E;  2UWX A;  1KX4 D;  3AZM A;  4NE5 A;  2FJ7 D;  3REJ C;  1KX3 B;  3LEL B;  3MGQ B;  3C1C B;  1TAF B;  3AZK A;  5B1M A;  3AZH B;  2PYO B;  4WZS B;  4WU9 D;  1M1A B;  2XD1 A;  5G49 B;  5B40 A;  1ULY A;  3REI D;  2HIO C;  3C1B D;  3KWQ B;  1H3O B;  2F8N H;  3MGR C;  3WAA A;  3WTP A;  1P3A C;  3WKJ A;  4QLC C;  3MGP C;  4J8U B;  5B1L A;  3KXB A;  1F66 A;  2F8N A;  2G5I C;  5CP6 C;  5B24 D;  4J8V D;  4EO5 B;  3AV2 B;  4Z66 A;  2BG1 A;  3AZE A;  2XD5 A;  3NQU B;  4H9Q A;  4H9P B;  5B31 C;  3KUY A;  4H9S C;  3AZJ D;  5BT1 D;  2CWE A;  4WNN A;  3W98 C;  3LJA A;  3O62 A;  1M19 A;  2HIO B;  4Z2M G;  5GT0 C;  5AV9 C;  5GT3 A;  3MGR B;  3REK C;  3W99 C;  1P3A B;  4QLC B;  3MGP B;  1HQ3 C;  3AZK D;  5B32 A;  5CP6 B;  3REL C;  3WTP B;  4CSR A;  4H9O B;  3WAA D;  3AYW A;  1TZY A;  1Z2C B;  3LZ0 A;  5AVB C;  5B32 C;  3AZI A;  3WKJ D;  1EQZ A;  3B6F A;  3X1U A;  3VH6 T;  5B0Y C;  3KXB D;  3MVD A;  1F66 D;  5B31 B;  4J8W C;  3W98 B;  5AV6 C;  4H9R A;  3A1K A;  4Z66 D;  5GT0 B;  3AZE D;  3X1U C;  3REK B;  3W99 B;  4WU8 A;  4JJN C;  1JFI A;  5GSU D;  3VH6 A;  1HQ3 B;  5B31 G;  4R8P D;  4KUD A;  1BFM A;  5B2J D;  3AV1 A;  3KUY D;  3UTA A;  2YFW A;  2YFV A;  3O62 D;  3LJA D;  4XUJ A;  3REL B;  1M19 D;  1ZLA A;  5AVC A;  2JE5 A;  5AVB B;  4ZUX A;  5B32 B;  3W96 C;  2DQN C;  5CPJ C;  4J8W B;  4J8X C;  5AV6 B;  3X1T A;  2RIQ A;  5AV5 D;  5B32 G;  4LD9 D;  1TZY D;  3LZ0 D;  2Y2M A;  4HGA B;  3VH5 A;  3X1U B;  3AZI D;  3MVD B;  3B6F B;  3EPK A;  4XZQ D;  1P3B D;  1P3K D;  2Y2O A;  2NQB C;  3UT9 A;  3AZN A;  4YS3 A;  3TU4 A;  5AY8 D;  4WU8 B;  3X1V C;  5FUG A;  3EPJ A;  4H9N A;  4KUD B;  3LZ1 A;  1U35 A;  3W96 B;  2JCH A;  5B33 A;  4XUJ B;  5CPJ B;  3W97 C;  1KX3 A;  3LEL A;  3MGQ A;  3C1C A;  1TAF A;  3WA9 C;  4ZUX D;  3AZH A;  1P3P D;  2IO5 C;  2PYO A;  1M1A A;  5G49 A;  3REH C;  5AV8 D;  3X1S C;  3F6T A;  1P3O C;  2NQB B;  1ID3 C;  3KWQ A;  4DQY B;  1H3O A;  2F8N K;  1A7W A;  4J8U A;  4WJ3 C;  1P3G C;  3AZF C;  1P3M C;  4Z2M H;  5B2I C;  3AN2 C;  5KDM B;  4YS3 B;  3AZN D;  3W97 B;  4H9N B;  3TU4 D;  3LZ1 B;  3REJ A;  2LY8 A;  1U35 B;  4H9P A;  3B0B A;  5B33 B;  3MNN D;  2IO5 B;  1P3O B;  3REH B;  5CPI C;  3X1S B;  1F1E A;  2HIO A;  3MGR A;  5DNN C;  1P3A A;  3B0D C;  4QLC A;  3MGP A;  3C1C D;  3MGQ D;  1KX3 D;  1P3G B;  2Y2I A;  3AZH D;  2PYO D;  1M1A D;  4X23 D;  3AZF B;  5CP6 A;  3AN2 B;  3KWQ D;  4H9O A;  4KGC D;  4KHA B;  5B31 A;  4H9S A;  3W98 A;  3AV2 D;  3UTB D;  5CPI B;  5AV9 A;  5BT1 C;  5GT0 A;  3AZJ C;  3REJ B;  1AOI D;  5DNN B;  3REK A;  3W99 A;  2VQR A;  1WWS A;  1HQ3 A;  3AFA C;  4AWL C;  4WV4 B;  3REL A;  2HIO D;  3AZM D;  1P3A D;  5AVB A;  5B1M D;  4QLC D;  3MGP D;  5B0Y A;  4NE6 A;  5B40 D;  2HUE C;  4J8W A;  4Z5T C;  5AV6 A;  5CP6 D;  1WWI A;  2Y2L A;  2CV5 C;  2NZD C;  3WTP D;  3MGS C;  2W8S A;  3AZJ B;  5B1L D;  2F8N D;  4JJN A;  2ARO C;  3AFA B;  5B31 D;  2RVQ D;  3W98 D;  3V9R A;  5DNM A;  5GSU C;  4R8P C;  5AV9 B;  3P5J B;  5B2J C;  5GT0 D;  3REK D;  3W99 D;  5CPK C;  3B6G C;  5JRG C;  3W96 A;  5DNM C;  5CPJ A;  4Z5T B;  4J8X A;  2CV5 B;  5GT3 D;  3REL D;  2NZD B;  3MGS B;  5AVB D;  5B32 D;  5B0Y B;  3A6N C;  2ARO B;  1P3F C;  2ZY3 A;  5AV5 C;  4LD9 C;  2NQB A;  1HTA A;  5GXQ C;  4J8W D;  5B0Z C;  4CAY A;  5AV6 D;  1P3K C;  1P3B C;  4R8P B;  1M18 C;  3AYW D;  4JJN B;  3X1V A;  1KX5 A;  1EQZ D;  3B6F D;  3X1U D;  5CPK B;  3MVD D;  1S32 C;  3B6G B;  1P3I C;  5JRG B;  5AY8 C;  3V9R B;  5DNM B;  5KDM A;  1KX5 C;  2BYK B;  1P34 C;  3W97 A;  3AZL C;  5JA4 B;  4WU8 D;  4KUD D;  3WA9 A;  3A6N B;  3AV1 D;  3W96 D;  1P3F B;  1Q9C A;  3UTA D;  3REH A;  3X1S A;  5AV5 B;  1P3O A;  4J8X B;  4XUJ D;  4YM6 C;  1ID3 A;  5GXQ B;  1P3P C;  1ZLA D;  5B0Z B;  1W2E A;  4ZBJ C;  1P3L C;  5AVC D;  1M18 B;  5BS7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...