1S32C

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32C00
1EQZB 3X1TA 3WA9B 4LD9A 3AFAB 1M18A 5AY8B 3TU4C 3TU4B 3KUYA 1P3ID 3LZ0A 1S32C 3W97A 1S32B 4YM6D 5AV5D 3LZ1D 2NZDA 3X1SD 1WWSA 3WTPA 3KWQA 1KU5A 1ULYA 1P3IC 1P3LA 4YM6C 1P3FD 5B40D 1M19A 5AV5C 5AV5B 3LZ1C 4Z66B 3MGRB 3X1SC 3X1SB 2HIOD 1HQ3D 3B0CW 5AVBA 1P3PD 2PYOB 3W96D 5KDMB 3UTBD 1P3FC 5B40C 3MVDA 1P3BA 5B33A 3UT9D 2HIOC 5JA4A 4AWLC 4AWLB 3AZED 3NQUA 4QLCD 5CPKD 3W99B 3AV1C 3AV1B 5BNXA 4X23D 5CPIA 3UT9C 1JFIA 5AV8C 3AZEC 5AV8B 4HGAC 3WKJD 5CPKC 3WAAA 2F8NG 5CP6D 5GT3B 4R8PD 1P34D 3MGQB 4J8UA 1P3MA 3WKJC 1Q9CA 3MNNB 5FUGB 5CP6C 1TAFA 1F1EA 4R8PC 4R8PB 1P34C 4EO5B 1ZLAD 3AZND 5B24A 1AOID 3AZFA 2NQBA 4KGCA 4ZUXD 1M1AC 1M1AB 1ZLAC 1ZLAB 5B2JD 5B0ZD 4NE5A 3AZJA 1AOIC 5F99A 5B31A 4ZUXC 3X1TC 5JRGA 3X1TB 1B67A 4LD9C 4LD9B 5GSUA 5B0ZC 1P3GD 3AZIA 3W97D 1M18B 1HTAA 4XUJB 1BFMA 4YS3D 3KUYB 3KWQD 4JJND 3UTAD 2F8ND 1ID3A 3LZ0B 3W97C 3W97B 2NZDB 4G92C 4YS3C 4G92B 3KWQC 4JJNC 3WTPB 3KWQB 1P3LB 5AV9D 1M19C 3MVDD 4J8WA 1M19B 1P3IA 3X1UA 4YM6A 5DNMA 4NFTA 1KX3A 2YFWA 5AVBB 5AV9C 3LZ1A 3RELD 5BNVA 3MVDC 1P3BB 3R45A 3B6FA 5B40A 5B33B 3REJD 5JA4B 3RELC 3NQUB 1HQ3A 3W96A 1P3PA 4WV4B 3NQJA 3UTBA 5BNXB 5CPIB 4H9RA 1N1JA 4WZSB 1JFIB 1P3MD 3UT9A 3WAAB 3AZEA 3W98D 4E45A 1F66D 4QLCA 5CPKA 2F8NK 4J8UB 4X23A 1P3MC 2LY8A 5BT1D 3X1VA 3W98C 1TAFB 3WKJA 1F66C 5CP6A 1P34A 5B24B 1KX5D 5BT1C 5B32D 3AZFB 2NQBB 4KGCC 4KGCB 4KHAA 5B1LD 3LJAD 3AZHD 1KX5C 5B32C 3AZNA 2CWEA 3AZJB 1H3OA 5F99B 5B31B 5JRGC 5JRGB 4NE6A 5GSUC 2BYMA 5GSUB 3LJAC 3AZIB 4WU9D 5B2JA 5BS7A 5B0ZA 4WU8D 1ID3C 1ID3B 4WU9C 4J8WD 3LELA 3X1UD 3C1BD 1P3GA 5GT0D 5DNMD 1KX4A 1KX3D 3AV2D 4YS3A 4J8WC 4JJNA 4J8WB 3REHA 2IO5C 3UTAA 2IO5B 3X1UC 3X1UB 3C1BC 5CPJA 1P3IB 5GT0C 5DNMC 4YM6B 5DNMB 3B6FD 1KX3C 2YFWB 3AV2C 3LZ1B 5BNVB 5BO0A 1R4VA 5AV9A 3KXBD 3B6FC 3R45B 1P3FB 5B40B 3B6FB 2AROD 2HIOB 1HQ3C 1TZYD 1HQ3B 3W96C 1P3PB 1P3AD 3RELA 3UTBC 1P3PC 3NQJB 3A6ND 3UTBB 3W96B 3VH5T 5G49A 4H9RB 1N1JB 5DNND 2AROC 3UT9B 1TZYC 3REJA 3X1VD 1P3AC 3B6GD 3AZEB 5AVCD 4HGAB 4QLCC 4QLCB 5CPKB 4X23C 4X23B 3KSYA 3AYWD 3X1VC 3MGPD 3WKJB 5CP6B 1U35D 1P3KD 3W98A 1F66A 1P34B 3MGPC 4KHAB 4CAYA 1U35C 1P3KC 4H9OA 3AZNC 3AZNB 5GXQA 1H3OB 1KX5A 2JSSA 5B32A 1AOIB 2BYMB 4ZUXB 5B1LA 3C1CD 5B2JC 5B2JB 3LELD 3LJAA 5BS7C 3REID 3B0DC 4CSRA 5B0ZB 3AZLD 3AZHA 1KX4D 4KUDD 3AZMD 3C1CC 5B2IA 3REHD 1P3OA 4E44A 3LELC 3LELB 5CPJD 3REIC 3AZLC 1P3GB 1P3GC 4WU9A 1KX4C 1KX4B 4H9NA 3AZMC 2BYKA 4YS3B 3UTAC 4JJNB 3REHC 3UTAB 2F8NB 4WU8A 5CPJC 4Z2MH 5CPJB 3C1BA 5GT0A 1A7WA 5BO0B 3REKD 5AV9B 3AV2A 2L5AA 3MVDB 5E5AD 3REKC 3RELB 3VH6T 5G49B 3KXBA 5E5AC 3B0BA 3REJC 2F8NA 3REJB 2AROA 1TZYA 3V9RA 1P3AA 3A6NA 2CV5A 5DNNA 5B31G 1P3MB 3B6GA 4G91C 4G91B 3W98B 5AVCA 3AZKA 1F66B 5GXQD 4WNNA 4J8VD 3AYWA 4CAYB 3O62D 4H9OB 5B1MD 3MGPA 1U35A 1P3KA 5GXQC 5GXQB 1KX5B 4J8VC 5B32B 3WTPE 5B1MC 5B1LC 5B1LB 5B2ID 1P3OD 3LJAB 3AZHC 3AZGA 5B0YA 3AZHB 4CSRB 3VH5W 2HUEC 2FJ7D 5B2IC 5B2IB 1P3OC 4WU9B 3C1CA 2FJ7C 3REIA 4KUDA 4H9NB 3AZLA 2BYKB 5AV6D 3AZMA 4WU8C 4WU8B 4H9QA 4Z5TA 1EQZD 2RVQD 1BH8A 3WA9D 3AFAD 3C1BB 3AN2A 5GT0B 5AY8D 1KX3B 3TU4D 3AV2B 1EQZC 2RVQC 3WA9C 3AFAC 1S32D 5AY8C 4XZQA 4XUJA 2F8NH 3REKA 3KXBC 3KXBB 2CV5D 5E5AA 4Z66D 2AROB 3MGRD 1TZYB 3V9RB 2PYOD 1P3AB 3A6NC 3A6NB 3AZKD 2CV5C 5DNNC 2CV5B 5DNNB 5CHLB 4Z66C 3MGRC 2PYOC 3B6GC 3X1VB 3B6GB 4J8XA 5AVCC 5AVCB 3AZKC 3AZKB 3W99D 3AV1D 4UUZA 3AYWC 4WNNB 3AYWB 5AV8D 3MGPB 1BH9A 3W99C 1U35B 1P3KB 5GT3D 3AZGD 5B0YD 3MGQD 4H9SC 3MNND 4J8VA 3O62A 5GT3C 2YFVA 5B1MA 5B0YC 3VH5A 5B0YB 3VH6W 3MGQC 3AZGC 3AZGB 3MGSA 3B0DB 3MNNC 4H9PA 4Z5TD 4EO5C 1M1AD 3C1CB 4KUDC 3REIB 4KUDB 3AZLB 3AN2D 3B0CT 2FJ7A 3AZMB 4ZBJC 4Z5TC 4ZBJB 4H9QB 4Z5TB 3X1TD 1BH8B 3REHB 4LD9D 3AN2C 3AN2B 4NE3A 1M18D 4XZQD 4XUJD 4DRBA 3KUYD 5C3IC 5AV6A 5C3IB 3LZ0D 1EQZA 1M18C 3WA9A 3AFAA 4XZQC 4XZQB 4XUJC 2NZDD 3KUYC 5AY8A 3WTPD 3TU4A 1P3LD 3REKB 3LZ0C 1M19D 5E5AB 1S32A 2NZDC 3WTPC 1P3LC 5AVBD 4J8XD 1WWIA 1P3BD 5B33D 5B32G 5AV5A 5AVBC 4Z66A 3MGRA 4J8XC 3X1SA 4J8XB 2PYOA 1P3BC 5KDMA 4UUZB 5CPID 5B33C 1P3FA 4Z2MG 2HIOA 3WAAD 1BH9B 5CPIC 3W99A 3AV1A 4J8UD 3MGSD 3WAAC 4J8VB 3O62C 4H9SA 5AV8A 3O62B 3VH6A 2YFVB 5B1MB 4J8UC 5GT3A 3MGSC 3MGSB 1B6WA 5B24D 3MGQA 2HUEB 4H9PB 3AZFD 2NQBD 3MNNA 4KGCD 5FUGA 1P3OB 4R8PA 5B24C 4M6BA 3AZJD 2FJ7B 3AZFC 5F99D 5B31D 2NQBC 5JRGD 5GSUD 3AZID 1M1AA 1ZLAA 3AZJC 4DRAA 5F99C 5B31C 5AV6C 1AOIA 5AV6B 1ID3D 4ZUXA 3AZIC
chains in the Genus database with same CATH superfamily
1EQZB 3X1TA 3WA9B 4LD9A 3AFAB 1M18A 5AY8B 3TU4C 3TU4B 2ZY4A 3KUYA 2BG1A 1P3ID 3LZ0A 1S32C 3W97A 1S32B 4YM6D 5AV5D 3LZ1D 2NZDA 3X1SD 3H0MC 1WWSA 3WTPA 3KWQA 1KU5A 1ULYA 1P3IC 1P3LA 4YM6C 1P3FD 5B40D 1M19A 5AV5C 5AV5B 3LZ1C 4Z66B 1W2EA 3MGRB 3X1SB 3X1SC 2HIOD 2DQNC 1HQ3D 3B0CW 5AVBA 1P3PD 2PYOB 3W96D 3KFUG 5KDMB 3UTBD 1P3FC 5B40C 3MVDA 1P3BA 2JCHA 5B33A 3P5JB 3UT9D 2HIOC 5JA4A 4AWLC 4AWLB 3AZED 3NQUA 4QLCD 5CPKD 3W99B 3AV1C 1PZRA 3AV1B 5BNXA 4X23D 5CPIA 3UT9C 2XD1A 1JFIA 5AV8C 3AZEC 5AV8B 4HGAC 3WKJD 5CPKC 3WAAA 2F8NG 5CP6D 5GT3B 4R8PD 1P34D 3MGQB 2Y2MA 4J8UA 3A1IA 1P3MA 3WKJC 1Q9CA 3MNNB 5FUGB 5CP6C 1TAFA 1F1EA 4R8PC 4R8PB 1P34C 4EO5B 1ZLAD 3AZND 5B24A 1AOID 3AZFA 2NQBA 4KGCA 4ZUXD 1M1AC 1M1AB 1ZLAC 2Y2JA 1ZLAB 5B2JD 5B0ZD 2VQRA 4NE5A 3AZJA 1AOIC 5F99A 5B31A 4ZUXC 3X1TC 5JRGA 3X1TB 1B67A 4LD9C 4LD9B 5GSUA 5B0ZC 1P3GD 3AZIA 3W97D 1M18B 1HTAA 4XUJB 1BFMA 4YS3D 3KUYB 3KWQD 4JJND 3UTAD 2F8ND 1ID3A 3LZ0B 3W97C 3W97B 2NZDB 4G92C 4YS3C 4G92B 3KWQC 4JJNC 3WTPB 3KWQB 1P3LB 5AV9D 2J8PA 3EG5B 1M19C 3MVDD 4J8WA 1M19B 1P3IA 3X1UA 4YM6A 5DNMA 4NFTA 1KX3A 2YFWA 5AVBB 5AV9C 2Y2QA 3LZ1A 3RELD 5BNVA 3MVDC 1P3BB 3R45A 3B6FA 5B40A 5B33B 3REJD 5JA4B 3RELC 2Y2KA 3NQUB 1HQ3A 3W96A 1P3PA 4WV4B 3NQJA 3UTBA 2UWXA 5BNXB 5CPIB 4H9RA 1N1JA 4WZSB 1JFIB 1P3MD 3UT9A 3WAAB 3AZEA 3W98D 4E45A 1F66D 4QLCA 5CPKA 2F8NK 4J8UB 2JE5A 4X23A 1P3MC 2LY8A 5BT1D 3X1VA 3A1KA 3W98C 1TAFB 3WKJA 1F66C 5CP6A 1P34A 5B24B 1KX5D 5BT1C 5B32D 3AZFB 2NQBB 4KGCC 4KGCB 4KHAA 5B1LD 3LJAD 3AZHD 1KX5C 5B32C 3AZNA 2CWEA 3AZJB 1H3OA 4WJ3C 5F99B 5B31B 5JRGC 5JRGB 4NE6A 5GSUC 2BYMA 5GSUB 3LJAC 3AZIB 4WU9D 5B2JA 5BS7A 5B0ZA 4WU8D 1ID3C 1ID3B 4WU9C 4J8WD 3LELA 3X1UD 3C1BD 1P3GA 5GT0D 5DNMD 1KX4A 1KX3D 3AV2D 3F6TA 3EPKA 4YS3A 4J8WC 4JJNA 4J8WB 3REHA 2IO5C 3UTAA 2IO5B 3X1UC 2G5HC 3X1UB 3C1BC 5CPJA 5GT0C 5DNMC 4YM6B 5DNMB 3B6FD 1KX3C 2YFWB 3AV2C 3LZ1B 5BNVB 5BO0A 1R4VA 5AV9A 3KXBD 3B6FC 3R45B 1P3FB 5B40B 3B6FB 2W8SA 2Y2HA 2Y2LA 2AROD 2HIOB 1HQ3C 1TZYD 1HQ3B 3W96C 1P3PB 1P3AD 3RELA 3UTBC 1P3PC 3NQJB 3A6ND 3UTBB 3W96B 3VH5T 3EPJA 5G49A 4H9RB 1N1JB 5DNND 2AROC 3UT9B 1TZYC 3REJA 3X1VD 1P3AC 3B6GD 3AZEB 5AVCD 4HGAB 4QLCC 4QLCB 5CPKB 3AL0C 4X23C 3H0LC 4X23B 3KSYA 3AYWD 3X1VC 3MGPD 3WKJB 5CP6B 1U35D 1P3KD 3W98A 1F66A 1P34B 3MGPC 4KHAB 4CAYA 1U35C 1P3KC 4H9OA 3AZNC 3AZNB 5GXQA 1H3OB 1KX5A 2JSSA 5B32A 1AOIB 2BYMB 4ZUXB 5B1LA 3C1CD 5B2JC 5B2JB 3LELD 3LJAA 5BS7C 3REID 3B0DC 4CSRA 5B0ZB 3AZLD 3AZHA 1KX4D 4KUDD 3AZMD 3C1CC 5B2IA 3REHD 1P3OA 4E44A 3LELC 3LELB 5CPJD 3REIC 3AZLC 1P3GB 1P3GC 4WU9A 1KX4C 1KX4B 4H9NA 3AZMC 2BYKA 4YS3B 3UTAC 4JJNB 3REHC 3UTAB 2F8NB 4WU8A 5CPJC 4Z2MH 5CPJB 3C1BA 5GT0A 1A7WA 5BO0B 3REKD 5AV9B 3AV2A 1Z2CB 2L5AA 3FDDA 3MVDB 5E5AD 3REKC 3RELB 3VH6T 5G49B 3KXBA 5E5AC 3B0BA 3REJC 2F8NA 3REJB 2AROA 1TZYA 3V9RA 1P3AA 3A6NA 2Y2NA 2CV5A 5DNNA 5B31G 1P3MB 3B6GA 4G91C 4G91B 3W98B 5AVCA 3AZKA 1F66B 5GXQD 1P3IB 4WNNA 4J8VD 3AYWA 4CAYB 3O62D 4H9OB 2ZY3A 5B1MD 3MGPA 1U35A 1P3KA 5GXQC 5GXQB 1KX5B 1T3UA 4J8VC 5B32B 3WTPE 5B1MC 5B1LC 5B1LB 5B2ID 1P3OD 3LJAB 3AZHC 3AZGA 5B0YA 3AZHB 4CSRB 3VH5W 2HUEC 2FJ7D 2FFFB 5B2IC 5B2IB 1P3OC 2G5IC 3C1CA 4WU9B 2FJ7C 3REIA 4KUDA 4H9NB 3AZLA 2Y2GA 2BYKB 5AV6D 3AZMA 4WU8C 4WU8B 4H9QA 4Z5TA 1EQZD 2RVQD 1BH8A 3WA9D 3AFAD 3C1BB 3AN2A 5GT0B 5AY8D 1KX3B 3TU4D 3AV2B 1EQZC 2RVQC 3WA9C 2XD5A 3AFAC 1S32D 5AY8C 4XZQA 4XUJA 2F8NH 3REKA 3KXBC 3KXBB 2CV5D 5E5AA 4Z66D 2AROB 3MGRD 3EPLA 1TZYB 3V9RB 2PYOD 1P3AB 3A6NC 3A6NB 3AZKD 2CV5C 5DNNC 2CV5B 5DNNB 5CHLB 4Z66C 3MGRC 2PYOC 3B6GC 3X1VB 3B6GB 4J8XA 5AVCC 5AVCB 3EPHA 3AZKC 3AZKB 3W99D 3AV1D 4UUZA 3AYWC 4WNNB 3AYWB 5AV8D 3MGPB 1BH9A 3W99C 1U35B 1P3KB 5GT3D 3AZGD 5B0YD 3H0RC 3MGQD 2Y2IA 4H9SC 2Y2PA 3MNND 4J8VA 3O62A 5GT3C 2YFVA 5B1MA 5B0YC 3VH5A 2RIQA 3VH6W 5B0YB 3MGQC 2ZM5A 3AZGC 3AZGB 3MGSA 3B0DB 3MNNC 4H9PA 4Z5TD 4EO5C 1M1AD 3C1CB 4KUDC 3REIB 4KUDB 3AZLB 3AN2D 2F2AC 3B0CT 2FJ7A 3AZMB 4ZBJC 4Z5TC 4ZBJB 4H9QB 2DF4C 4Z5TB 3X1TD 1BH8B 3REHB 4LD9D 3AN2C 3AN2B 4NE3A 1M18D 4XZQD 4XUJD 4DRBA 2Y2OA 3KUYD 5C3IC 5AV6A 5C3IB 3LZ0D 3IP4C 1EQZA 1M18C 3WA9A 3AFAA 4XZQC 4XZQB 4XUJC 2NZDD 3KUYC 5AY8A 3WTPD 3TU4A 1P3LD 3REKB 3LZ0C 1M19D 5E5AB 1S32A 2NZDC 3WTPC 1P3LC 5AVBD 4J8XD 4DQYB 1WWIA 1P3BD 5B33D 5B32G 5AV5A 5AVBC 4Z66A 3MGRA 4J8XC 3X1SA 4J8XB 2PYOA 1P3BC 5KDMA 4UUZB 5CPID 5B33C 1P3FA 4Z2MG 2HIOA 3WAAD 1BH9B 5CPIC 3W99A 3AV1A 4J8UD 3MGSD 3WAAC 4J8VB 3O62C 4H9SA 5AV8A 3O62B 3VH6A 2YFVB 5B1MB 4J8UC 5GT3A 3MGSC 3MGSB 1B6WA 5B24D 3MGQA 2HUEB 4H9PB 3AZFD 2NQBD 3MNNA 4KGCD 5FUGA 1P3OB 4R8PA 5B24C 4UPKA 4M6BA 3AZJD 2FJ7B 3AZFC 5F99D 5B31D 2NQBC 2ZY2A 5JRGD 5GSUD 3AZID 1M1AA 1ZLAA 3AZJC 4DRAA 5F99C 5B31C 2ZY5A 5AV6C 1AOIA 5AV6B 1ID3D 4ZUXA 3AZIC
chains in the Genus database with same CATH topology
1EQZB 3X1TA 3WA9B 4LD9A 3AFAB 1M18A 5AY8B 3TU4C 3TU4B 2ZY4A 3KUYA 2BG1A 1P3ID 3LZ0A 1S32C 3W97A 1S32B 4YM6D 5AV5D 3LZ1D 2NZDA 3X1SD 3H0MC 1WWSA 3WTPA 3KWQA 1KU5A 1ULYA 1P3IC 1P3LA 4YM6C 1P3FD 5B40D 1M19A 5AV5C 5AV5B 3LZ1C 4Z66B 1W2EA 3MGRB 3X1SB 3X1SC 2HIOD 2DQNC 1HQ3D 3B0CW 5AVBA 1P3PD 2PYOB 3W96D 3KFUG 5KDMB 3UTBD 1P3FC 5B40C 3MVDA 1P3BA 2JCHA 5B33A 3P5JB 3UT9D 2HIOC 5JA4A 4AWLC 4AWLB 3AZED 3NQUA 4QLCD 5CPKD 3W99B 3AV1C 1PZRA 3AV1B 5BNXA 4X23D 5CPIA 3UT9C 2XD1A 1JFIA 5AV8C 3AZEC 5AV8B 4HGAC 3WKJD 5CPKC 3WAAA 2F8NG 5CP6D 5GT3B 4R8PD 1P34D 3MGQB 2Y2MA 4J8UA 3A1IA 1P3MA 3WKJC 1Q9CA 3MNNB 5FUGB 5CP6C 1TAFA 1F1EA 4R8PC 4R8PB 1P34C 4EO5B 1ZLAD 3AZND 5B24A 1AOID 3AZFA 2NQBA 4KGCA 4ZUXD 1M1AC 1M1AB 1ZLAC 2Y2JA 1ZLAB 5B2JD 5B0ZD 2VQRA 4NE5A 3AZJA 1AOIC 5F99A 5B31A 4ZUXC 3X1TC 5JRGA 3X1TB 1B67A 4LD9C 4LD9B 5GSUA 5B0ZC 1P3GD 3AZIA 3W97D 1M18B 1HTAA 4XUJB 1BFMA 4YS3D 3KUYB 3KWQD 4JJND 3UTAD 2F8ND 1ID3A 3LZ0B 3W97C 3W97B 2NZDB 4G92C 4YS3C 4G92B 3KWQC 4JJNC 3WTPB 3KWQB 1P3LB 5AV9D 2J8PA 3EG5B 1M19C 3MVDD 4J8WA 1M19B 1P3IA 3X1UA 4YM6A 5DNMA 4NFTA 1KX3A 2YFWA 5AVBB 5AV9C 2Y2QA 3LZ1A 3RELD 5BNVA 3MVDC 1P3BB 3R45A 3B6FA 5B40A 5B33B 3REJD 5JA4B 3RELC 2Y2KA 3NQUB 1HQ3A 3W96A 1P3PA 4WV4B 3NQJA 3UTBA 2UWXA 5BNXB 5CPIB 4H9RA 1N1JA 4WZSB 1JFIB 1P3MD 3UT9A 3WAAB 3AZEA 3W98D 4E45A 1F66D 4QLCA 5CPKA 2F8NK 4J8UB 2JE5A 4X23A 1P3MC 2LY8A 5BT1D 3X1VA 3A1KA 3W98C 1TAFB 3WKJA 1F66C 5CP6A 1P34A 5B24B 1KX5D 5BT1C 5B32D 3AZFB 2NQBB 4KGCC 4KGCB 4KHAA 5B1LD 3LJAD 3AZHD 1KX5C 5B32C 3AZNA 2CWEA 3AZJB 1H3OA 4WJ3C 5F99B 5B31B 5JRGC 5JRGB 4NE6A 5GSUC 2BYMA 5GSUB 3LJAC 3AZIB 4WU9D 5B2JA 5BS7A 5B0ZA 4WU8D 1ID3C 1ID3B 4WU9C 4J8WD 3LELA 3X1UD 3C1BD 1P3GA 5GT0D 5DNMD 1KX4A 1KX3D 3AV2D 3F6TA 3EPKA 4YS3A 4J8WC 4JJNA 4J8WB 3REHA 2IO5C 3UTAA 2IO5B 3X1UC 2G5HC 3X1UB 3C1BC 5CPJA 5GT0C 5DNMC 4YM6B 5DNMB 3B6FD 1KX3C 2YFWB 3AV2C 3LZ1B 5BNVB 5BO0A 1R4VA 5AV9A 3KXBD 3B6FC 3R45B 1P3FB 5B40B 3B6FB 2W8SA 2Y2HA 2Y2LA 2AROD 2HIOB 1HQ3C 1TZYD 1HQ3B 3W96C 1P3PB 1P3AD 3RELA 3UTBC 1P3PC 3NQJB 3A6ND 3UTBB 3W96B 3VH5T 3EPJA 5G49A 4H9RB 1N1JB 5DNND 2AROC 3UT9B 1TZYC 3REJA 3X1VD 1P3AC 3B6GD 3AZEB 5AVCD 4HGAB 4QLCC 4QLCB 5CPKB 3AL0C 4X23C 3H0LC 4X23B 3KSYA 3AYWD 3X1VC 3MGPD 3WKJB 5CP6B 1U35D 1P3KD 3W98A 1F66A 1P34B 3MGPC 4KHAB 4CAYA 1U35C 1P3KC 4H9OA 3AZNC 3AZNB 5GXQA 1H3OB 1KX5A 2JSSA 5B32A 1AOIB 2BYMB 4ZUXB 5B1LA 3C1CD 5B2JC 5B2JB 3LELD 3LJAA 5BS7C 3REID 3B0DC 4CSRA 5B0ZB 3AZLD 3AZHA 1KX4D 4KUDD 3AZMD 3C1CC 5B2IA 3REHD 1P3OA 4E44A 3LELC 3LELB 5CPJD 3REIC 3AZLC 1P3GB 1P3GC 4WU9A 1KX4C 1KX4B 4H9NA 3AZMC 2BYKA 4YS3B 3UTAC 4JJNB 3REHC 3UTAB 2F8NB 4WU8A 5CPJC 4Z2MH 5CPJB 3C1BA 5GT0A 1A7WA 5BO0B 3REKD 5AV9B 3AV2A 1Z2CB 2L5AA 3FDDA 3MVDB 5E5AD 3REKC 3RELB 3VH6T 5G49B 3KXBA 5E5AC 3B0BA 3REJC 2F8NA 3REJB 2AROA 1TZYA 3V9RA 1P3AA 3A6NA 2Y2NA 2CV5A 5DNNA 5B31G 1P3MB 3B6GA 4G91C 4G91B 3W98B 5AVCA 3AZKA 1F66B 5GXQD 1P3IB 4WNNA 4J8VD 3AYWA 4CAYB 3O62D 4H9OB 2ZY3A 5B1MD 3MGPA 1U35A 1P3KA 5GXQC 5GXQB 1KX5B 1T3UA 4J8VC 5B32B 3WTPE 5B1MC 5B1LC 5B1LB 5B2ID 1P3OD 3LJAB 3AZHC 3AZGA 5B0YA 3AZHB 4CSRB 3VH5W 2HUEC 2FJ7D 2FFFB 5B2IC 5B2IB 1P3OC 2G5IC 3C1CA 4WU9B 2FJ7C 3REIA 4KUDA 4H9NB 3AZLA 2Y2GA 2BYKB 5AV6D 3AZMA 4WU8C 4WU8B 4H9QA 4Z5TA 1EQZD 2RVQD 1BH8A 3WA9D 3AFAD 3C1BB 3AN2A 5GT0B 5AY8D 1KX3B 3TU4D 3AV2B 1EQZC 2RVQC 3WA9C 2XD5A 3AFAC 1S32D 5AY8C 4XZQA 4XUJA 2F8NH 3REKA 3KXBC 3KXBB 2CV5D 5E5AA 4Z66D 2AROB 3MGRD 3EPLA 1TZYB 3V9RB 2PYOD 1P3AB 3A6NC 3A6NB 3AZKD 2CV5C 5DNNC 2CV5B 5DNNB 5CHLB 4Z66C 3MGRC 2PYOC 3B6GC 3X1VB 3B6GB 4J8XA 5AVCC 5AVCB 3EPHA 3AZKC 3AZKB 3W99D 3AV1D 4UUZA 3AYWC 4WNNB 3AYWB 5AV8D 3MGPB 1BH9A 3W99C 1U35B 1P3KB 5GT3D 3AZGD 5B0YD 3H0RC 3MGQD 2Y2IA 4H9SC 2Y2PA 3MNND 4J8VA 3O62A 5GT3C 2YFVA 5B1MA 5B0YC 3VH5A 2RIQA 3VH6W 5B0YB 3MGQC 2ZM5A 3AZGC 3AZGB 3MGSA 3B0DB 3MNNC 4H9PA 4Z5TD 4EO5C 1M1AD 3C1CB 4KUDC 3REIB 4KUDB 3AZLB 3AN2D 2F2AC 3B0CT 2FJ7A 3AZMB 4ZBJC 4Z5TC 4ZBJB 4H9QB 2DF4C 4Z5TB 3X1TD 1BH8B 3REHB 4LD9D 3AN2C 3AN2B 4NE3A 1M18D 4XZQD 4XUJD 4DRBA 2Y2OA 3KUYD 5C3IC 5AV6A 5C3IB 3LZ0D 3IP4C 1EQZA 1M18C 3WA9A 3AFAA 4XZQC 4XZQB 4XUJC 2NZDD 3KUYC 5AY8A 3WTPD 3TU4A 1P3LD 3REKB 3LZ0C 1M19D 5E5AB 1S32A 2NZDC 3WTPC 1P3LC 5AVBD 4J8XD 4DQYB 1WWIA 1P3BD 5B33D 5B32G 5AV5A 5AVBC 4Z66A 3MGRA 4J8XC 3X1SA 4J8XB 2PYOA 1P3BC 5KDMA 4UUZB 5CPID 5B33C 1P3FA 4Z2MG 2HIOA 3WAAD 1BH9B 5CPIC 3W99A 3AV1A 4J8UD 3MGSD 3WAAC 4J8VB 3O62C 4H9SA 5AV8A 3O62B 3VH6A 2YFVB 5B1MB 4J8UC 5GT3A 3MGSC 3MGSB 1B6WA 5B24D 3MGQA 2HUEB 4H9PB 3AZFD 2NQBD 3MNNA 4KGCD 5FUGA 1P3OB 4R8PA 5B24C 4UPKA 4M6BA 3AZJD 2FJ7B 3AZFC 5F99D 5B31D 2NQBC 2ZY2A 5JRGD 5GSUD 3AZID 1M1AA 1ZLAA 3AZJC 4DRAA 5F99C 5B31C 2ZY5A 5AV6C 1AOIA 5AV6B 1ID3D 4ZUXA 3AZIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ B;  3X1T A;  3WA9 B;  4LD9 A;  3AFA B;  1M18 A;  5AY8 B;  3TU4 C;  3TU4 B;  3KUY A;  1P3I D;  3LZ0 A;  1S32 C;  3W97 A;  1S32 B;  4YM6 D;  5AV5 D;  3LZ1 D;  2NZD A;  3X1S D;  1WWS A;  3WTP A;  3KWQ A;  1KU5 A;  1ULY A;  1P3I C;  1P3L A;  4YM6 C;  1P3F D;  5B40 D;  1M19 A;  5AV5 C;  5AV5 B;  3LZ1 C;  4Z66 B;  3MGR B;  3X1S C;  3X1S B;  2HIO D;  1HQ3 D;  3B0C W;  5AVB A;  1P3P D;  2PYO B;  3W96 D;  5KDM B;  3UTB D;  1P3F C;  5B40 C;  3MVD A;  1P3B A;  5B33 A;  3UT9 D;  2HIO C;  5JA4 A;  4AWL C;  4AWL B;  3AZE D;  3NQU A;  4QLC D;  5CPK D;  3W99 B;  3AV1 C;  3AV1 B;  5BNX A;  4X23 D;  5CPI A;  3UT9 C;  1JFI A;  5AV8 C;  3AZE C;  5AV8 B;  4HGA C;  3WKJ D;  5CPK C;  3WAA A;  2F8N G;  5CP6 D;  5GT3 B;  4R8P D;  1P34 D;  3MGQ B;  4J8U A;  1P3M A;  3WKJ C;  1Q9C A;  3MNN B;  5FUG B;  5CP6 C;  1TAF A;  1F1E A;  4R8P C;  4R8P B;  1P34 C;  4EO5 B;  1ZLA D;  3AZN D;  5B24 A;  1AOI D;  3AZF A;  2NQB A;  4KGC A;  4ZUX D;  1M1A C;  1M1A B;  1ZLA C;  1ZLA B;  5B2J D;  5B0Z D;  4NE5 A;  3AZJ A;  1AOI C;  5F99 A;  5B31 A;  4ZUX C;  3X1T C;  5JRG A;  3X1T B;  1B67 A;  4LD9 C;  4LD9 B;  5GSU A;  5B0Z C;  1P3G D;  3AZI A;  3W97 D;  1M18 B;  1HTA A;  4XUJ B;  1BFM A;  4YS3 D;  3KUY B;  3KWQ D;  4JJN D;  3UTA D;  2F8N D;  1ID3 A;  3LZ0 B;  3W97 C;  3W97 B;  2NZD B;  4G92 C;  4YS3 C;  4G92 B;  3KWQ C;  4JJN C;  3WTP B;  3KWQ B;  1P3L B;  5AV9 D;  1M19 C;  3MVD D;  4J8W A;  1M19 B;  1P3I A;  3X1U A;  4YM6 A;  5DNM A;  4NFT A;  1KX3 A;  2YFW A;  5AVB B;  5AV9 C;  3LZ1 A;  3REL D;  5BNV A;  3MVD C;  1P3B B;  3R45 A;  3B6F A;  5B40 A;  5B33 B;  3REJ D;  5JA4 B;  3REL C;  3NQU B;  1HQ3 A;  3W96 A;  1P3P A;  4WV4 B;  3NQJ A;  3UTB A;  5BNX B;  5CPI B;  4H9R A;  1N1J A;  4WZS B;  1JFI B;  1P3M D;  3UT9 A;  3WAA B;  3AZE A;  3W98 D;  4E45 A;  1F66 D;  4QLC A;  5CPK A;  2F8N K;  4J8U B;  4X23 A;  1P3M C;  2LY8 A;  5BT1 D;  3X1V A;  3W98 C;  1TAF B;  3WKJ A;  1F66 C;  5CP6 A;  1P34 A;  5B24 B;  1KX5 D;  5BT1 C;  5B32 D;  3AZF B;  2NQB B;  4KGC C;  4KGC B;  4KHA A;  5B1L D;  3LJA D;  3AZH D;  1KX5 C;  5B32 C;  3AZN A;  2CWE A;  3AZJ B;  1H3O A;  5F99 B;  5B31 B;  5JRG C;  5JRG B;  4NE6 A;  5GSU C;  2BYM A;  5GSU B;  3LJA C;  3AZI B;  4WU9 D;  5B2J A;  5BS7 A;  5B0Z A;  4WU8 D;  1ID3 C;  1ID3 B;  4WU9 C;  4J8W D;  3LEL A;  3X1U D;  3C1B D;  1P3G A;  5GT0 D;  5DNM D;  1KX4 A;  1KX3 D;  3AV2 D;  4YS3 A;  4J8W C;  4JJN A;  4J8W B;  3REH A;  2IO5 C;  3UTA A;  2IO5 B;  3X1U C;  3X1U B;  3C1B C;  5CPJ A;  1P3I B;  5GT0 C;  5DNM C;  4YM6 B;  5DNM B;  3B6F D;  1KX3 C;  2YFW B;  3AV2 C;  3LZ1 B;  5BNV B;  5BO0 A;  1R4V A;  5AV9 A;  3KXB D;  3B6F C;  3R45 B;  1P3F B;  5B40 B;  3B6F B;  2ARO D;  2HIO B;  1HQ3 C;  1TZY D;  1HQ3 B;  3W96 C;  1P3P B;  1P3A D;  3REL A;  3UTB C;  1P3P C;  3NQJ B;  3A6N D;  3UTB B;  3W96 B;  3VH5 T;  5G49 A;  4H9R B;  1N1J B;  5DNN D;  2ARO C;  3UT9 B;  1TZY C;  3REJ A;  3X1V D;  1P3A C;  3B6G D;  3AZE B;  5AVC D;  4HGA B;  4QLC C;  4QLC B;  5CPK B;  4X23 C;  4X23 B;  3KSY A;  3AYW D;  3X1V C;  3MGP D;  3WKJ B;  5CP6 B;  1U35 D;  1P3K D;  3W98 A;  1F66 A;  1P34 B;  3MGP C;  4KHA B;  4CAY A;  1U35 C;  1P3K C;  4H9O A;  3AZN C;  3AZN B;  5GXQ A;  1H3O B;  1KX5 A;  2JSS A;  5B32 A;  1AOI B;  2BYM B;  4ZUX B;  5B1L A;  3C1C D;  5B2J C;  5B2J B;  3LEL D;  3LJA A;  5BS7 C;  3REI D;  3B0D C;  4CSR A;  5B0Z B;  3AZL D;  3AZH A;  1KX4 D;  4KUD D;  3AZM D;  3C1C C;  5B2I A;  3REH D;  1P3O A;  4E44 A;  3LEL C;  3LEL B;  5CPJ D;  3REI C;  3AZL C;  1P3G B;  1P3G C;  4WU9 A;  1KX4 C;  1KX4 B;  4H9N A;  3AZM C;  2BYK A;  4YS3 B;  3UTA C;  4JJN B;  3REH C;  3UTA B;  2F8N B;  4WU8 A;  5CPJ C;  4Z2M H;  5CPJ B;  3C1B A;  5GT0 A;  1A7W A;  5BO0 B;  3REK D;  5AV9 B;  3AV2 A;  2L5A A;  3MVD B;  5E5A D;  3REK C;  3REL B;  3VH6 T;  5G49 B;  3KXB A;  5E5A C;  3B0B A;  3REJ C;  2F8N A;  3REJ B;  2ARO A;  1TZY A;  3V9R A;  1P3A A;  3A6N A;  2CV5 A;  5DNN A;  5B31 G;  1P3M B;  3B6G A;  4G91 C;  4G91 B;  3W98 B;  5AVC A;  3AZK A;  1F66 B;  5GXQ D;  4WNN A;  4J8V D;  3AYW A;  4CAY B;  3O62 D;  4H9O B;  5B1M D;  3MGP A;  1U35 A;  1P3K A;  5GXQ C;  5GXQ B;  1KX5 B;  4J8V C;  5B32 B;  3WTP E;  5B1M C;  5B1L C;  5B1L B;  5B2I D;  1P3O D;  3LJA B;  3AZH C;  3AZG A;  5B0Y A;  3AZH B;  4CSR B;  3VH5 W;  2HUE C;  2FJ7 D;  5B2I C;  5B2I B;  1P3O C;  4WU9 B;  3C1C A;  2FJ7 C;  3REI A;  4KUD A;  4H9N B;  3AZL A;  2BYK B;  5AV6 D;  3AZM A;  4WU8 C;  4WU8 B;  4H9Q A;  4Z5T A;  1EQZ D;  2RVQ D;  1BH8 A;  3WA9 D;  3AFA D;  3C1B B;  3AN2 A;  5GT0 B;  5AY8 D;  1KX3 B;  3TU4 D;  3AV2 B;  1EQZ C;  2RVQ C;  3WA9 C;  3AFA C;  1S32 D;  5AY8 C;  4XZQ A;  4XUJ A;  2F8N H;  3REK A;  3KXB C;  3KXB B;  2CV5 D;  5E5A A;  4Z66 D;  2ARO B;  3MGR D;  1TZY B;  3V9R B;  2PYO D;  1P3A B;  3A6N C;  3A6N B;  3AZK D;  2CV5 C;  5DNN C;  2CV5 B;  5DNN B;  5CHL B;  4Z66 C;  3MGR C;  2PYO C;  3B6G C;  3X1V B;  3B6G B;  4J8X A;  5AVC C;  5AVC B;  3AZK C;  3AZK B;  3W99 D;  3AV1 D;  4UUZ A;  3AYW C;  4WNN B;  3AYW B;  5AV8 D;  3MGP B;  1BH9 A;  3W99 C;  1U35 B;  1P3K B;  5GT3 D;  3AZG D;  5B0Y D;  3MGQ D;  4H9S C;  3MNN D;  4J8V A;  3O62 A;  5GT3 C;  2YFV A;  5B1M A;  5B0Y C;  3VH5 A;  5B0Y B;  3VH6 W;  3MGQ C;  3AZG C;  3AZG B;  3MGS A;  3B0D B;  3MNN C;  4H9P A;  4Z5T D;  4EO5 C;  1M1A D;  3C1C B;  4KUD C;  3REI B;  4KUD B;  3AZL B;  3AN2 D;  3B0C T;  2FJ7 A;  3AZM B;  4ZBJ C;  4Z5T C;  4ZBJ B;  4H9Q B;  4Z5T B;  3X1T D;  1BH8 B;  3REH B;  4LD9 D;  3AN2 C;  3AN2 B;  4NE3 A;  1M18 D;  4XZQ D;  4XUJ D;  4DRB A;  3KUY D;  5C3I C;  5AV6 A;  5C3I B;  3LZ0 D;  1EQZ A;  1M18 C;  3WA9 A;  3AFA A;  4XZQ C;  4XZQ B;  4XUJ C;  2NZD D;  3KUY C;  5AY8 A;  3WTP D;  3TU4 A;  1P3L D;  3REK B;  3LZ0 C;  1M19 D;  5E5A B;  1S32 A;  2NZD C;  3WTP C;  1P3L C;  5AVB D;  4J8X D;  1WWI A;  1P3B D;  5B33 D;  5B32 G;  5AV5 A;  5AVB C;  4Z66 A;  3MGR A;  4J8X C;  3X1S A;  4J8X B;  2PYO A;  1P3B C;  5KDM A;  4UUZ B;  5CPI D;  5B33 C;  1P3F A;  4Z2M G;  2HIO A;  3WAA D;  1BH9 B;  5CPI C;  3W99 A;  3AV1 A;  4J8U D;  3MGS D;  3WAA C;  4J8V B;  3O62 C;  4H9S A;  5AV8 A;  3O62 B;  3VH6 A;  2YFV B;  5B1M B;  4J8U C;  5GT3 A;  3MGS C;  3MGS B;  1B6W A;  5B24 D;  3MGQ A;  2HUE B;  4H9P B;  3AZF D;  2NQB D;  3MNN A;  4KGC D;  5FUG A;  1P3O B;  4R8P A;  5B24 C;  4M6B A;  3AZJ D;  2FJ7 B;  3AZF C;  5F99 D;  5B31 D;  2NQB C;  5JRG D;  5GSU D;  3AZI D;  1M1A A;  1ZLA A;  3AZJ C;  4DRA A;  5F99 C;  5B31 C;  5AV6 C;  1AOI A;  5AV6 B;  1ID3 D;  4ZUX A;  3AZI C; 
#chains in the Genus database with same CATH topology
 1EQZ B;  3X1T A;  3WA9 B;  4LD9 A;  3AFA B;  1M18 A;  5AY8 B;  3TU4 C;  3TU4 B;  2ZY4 A;  3KUY A;  2BG1 A;  1P3I D;  3LZ0 A;  1S32 C;  3W97 A;  1S32 B;  4YM6 D;  5AV5 D;  3LZ1 D;  2NZD A;  3X1S D;  3H0M C;  1WWS A;  3WTP A;  3KWQ A;  1KU5 A;  1ULY A;  1P3I C;  1P3L A;  4YM6 C;  1P3F D;  5B40 D;  1M19 A;  5AV5 C;  5AV5 B;  3LZ1 C;  4Z66 B;  1W2E A;  3MGR B;  3X1S B;  3X1S C;  2HIO D;  2DQN C;  1HQ3 D;  3B0C W;  5AVB A;  1P3P D;  2PYO B;  3W96 D;  3KFU G;  5KDM B;  3UTB D;  1P3F C;  5B40 C;  3MVD A;  1P3B A;  2JCH A;  5B33 A;  3P5J B;  3UT9 D;  2HIO C;  5JA4 A;  4AWL C;  4AWL B;  3AZE D;  3NQU A;  4QLC D;  5CPK D;  3W99 B;  3AV1 C;  1PZR A;  3AV1 B;  5BNX A;  4X23 D;  5CPI A;  3UT9 C;  2XD1 A;  1JFI A;  5AV8 C;  3AZE C;  5AV8 B;  4HGA C;  3WKJ D;  5CPK C;  3WAA A;  2F8N G;  5CP6 D;  5GT3 B;  4R8P D;  1P34 D;  3MGQ B;  2Y2M A;  4J8U A;  3A1I A;  1P3M A;  3WKJ C;  1Q9C A;  3MNN B;  5FUG B;  5CP6 C;  1TAF A;  1F1E A;  4R8P C;  4R8P B;  1P34 C;  4EO5 B;  1ZLA D;  3AZN D;  5B24 A;  1AOI D;  3AZF A;  2NQB A;  4KGC A;  4ZUX D;  1M1A C;  1M1A B;  1ZLA C;  2Y2J A;  1ZLA B;  5B2J D;  5B0Z D;  2VQR A;  4NE5 A;  3AZJ A;  1AOI C;  5F99 A;  5B31 A;  4ZUX C;  3X1T C;  5JRG A;  3X1T B;  1B67 A;  4LD9 C;  4LD9 B;  5GSU A;  5B0Z C;  1P3G D;  3AZI A;  3W97 D;  1M18 B;  1HTA A;  4XUJ B;  1BFM A;  4YS3 D;  3KUY B;  3KWQ D;  4JJN D;  3UTA D;  2F8N D;  1ID3 A;  3LZ0 B;  3W97 C;  3W97 B;  2NZD B;  4G92 C;  4YS3 C;  4G92 B;  3KWQ C;  4JJN C;  3WTP B;  3KWQ B;  1P3L B;  5AV9 D;  2J8P A;  3EG5 B;  1M19 C;  3MVD D;  4J8W A;  1M19 B;  1P3I A;  3X1U A;  4YM6 A;  5DNM A;  4NFT A;  1KX3 A;  2YFW A;  5AVB B;  5AV9 C;  2Y2Q A;  3LZ1 A;  3REL D;  5BNV A;  3MVD C;  1P3B B;  3R45 A;  3B6F A;  5B40 A;  5B33 B;  3REJ D;  5JA4 B;  3REL C;  2Y2K A;  3NQU B;  1HQ3 A;  3W96 A;  1P3P A;  4WV4 B;  3NQJ A;  3UTB A;  2UWX A;  5BNX B;  5CPI B;  4H9R A;  1N1J A;  4WZS B;  1JFI B;  1P3M D;  3UT9 A;  3WAA B;  3AZE A;  3W98 D;  4E45 A;  1F66 D;  4QLC A;  5CPK A;  2F8N K;  4J8U B;  2JE5 A;  4X23 A;  1P3M C;  2LY8 A;  5BT1 D;  3X1V A;  3A1K A;  3W98 C;  1TAF B;  3WKJ A;  1F66 C;  5CP6 A;  1P34 A;  5B24 B;  1KX5 D;  5BT1 C;  5B32 D;  3AZF B;  2NQB B;  4KGC C;  4KGC B;  4KHA A;  5B1L D;  3LJA D;  3AZH D;  1KX5 C;  5B32 C;  3AZN A;  2CWE A;  3AZJ B;  1H3O A;  4WJ3 C;  5F99 B;  5B31 B;  5JRG C;  5JRG B;  4NE6 A;  5GSU C;  2BYM A;  5GSU B;  3LJA C;  3AZI B;  4WU9 D;  5B2J A;  5BS7 A;  5B0Z A;  4WU8 D;  1ID3 C;  1ID3 B;  4WU9 C;  4J8W D;  3LEL A;  3X1U D;  3C1B D;  1P3G A;  5GT0 D;  5DNM D;  1KX4 A;  1KX3 D;  3AV2 D;  3F6T A;  3EPK A;  4YS3 A;  4J8W C;  4JJN A;  4J8W B;  3REH A;  2IO5 C;  3UTA A;  2IO5 B;  3X1U C;  2G5H C;  3X1U B;  3C1B C;  5CPJ A;  5GT0 C;  5DNM C;  4YM6 B;  5DNM B;  3B6F D;  1KX3 C;  2YFW B;  3AV2 C;  3LZ1 B;  5BNV B;  5BO0 A;  1R4V A;  5AV9 A;  3KXB D;  3B6F C;  3R45 B;  1P3F B;  5B40 B;  3B6F B;  2W8S A;  2Y2H A;  2Y2L A;  2ARO D;  2HIO B;  1HQ3 C;  1TZY D;  1HQ3 B;  3W96 C;  1P3P B;  1P3A D;  3REL A;  3UTB C;  1P3P C;  3NQJ B;  3A6N D;  3UTB B;  3W96 B;  3VH5 T;  3EPJ A;  5G49 A;  4H9R B;  1N1J B;  5DNN D;  2ARO C;  3UT9 B;  1TZY C;  3REJ A;  3X1V D;  1P3A C;  3B6G D;  3AZE B;  5AVC D;  4HGA B;  4QLC C;  4QLC B;  5CPK B;  3AL0 C;  4X23 C;  3H0L C;  4X23 B;  3KSY A;  3AYW D;  3X1V C;  3MGP D;  3WKJ B;  5CP6 B;  1U35 D;  1P3K D;  3W98 A;  1F66 A;  1P34 B;  3MGP C;  4KHA B;  4CAY A;  1U35 C;  1P3K C;  4H9O A;  3AZN C;  3AZN B;  5GXQ A;  1H3O B;  1KX5 A;  2JSS A;  5B32 A;  1AOI B;  2BYM B;  4ZUX B;  5B1L A;  3C1C D;  5B2J C;  5B2J B;  3LEL D;  3LJA A;  5BS7 C;  3REI D;  3B0D C;  4CSR A;  5B0Z B;  3AZL D;  3AZH A;  1KX4 D;  4KUD D;  3AZM D;  3C1C C;  5B2I A;  3REH D;  1P3O A;  4E44 A;  3LEL C;  3LEL B;  5CPJ D;  3REI C;  3AZL C;  1P3G B;  1P3G C;  4WU9 A;  1KX4 C;  1KX4 B;  4H9N A;  3AZM C;  2BYK A;  4YS3 B;  3UTA C;  4JJN B;  3REH C;  3UTA B;  2F8N B;  4WU8 A;  5CPJ C;  4Z2M H;  5CPJ B;  3C1B A;  5GT0 A;  1A7W A;  5BO0 B;  3REK D;  5AV9 B;  3AV2 A;  1Z2C B;  2L5A A;  3FDD A;  3MVD B;  5E5A D;  3REK C;  3REL B;  3VH6 T;  5G49 B;  3KXB A;  5E5A C;  3B0B A;  3REJ C;  2F8N A;  3REJ B;  2ARO A;  1TZY A;  3V9R A;  1P3A A;  3A6N A;  2Y2N A;  2CV5 A;  5DNN A;  5B31 G;  1P3M B;  3B6G A;  4G91 C;  4G91 B;  3W98 B;  5AVC A;  3AZK A;  1F66 B;  5GXQ D;  1P3I B;  4WNN A;  4J8V D;  3AYW A;  4CAY B;  3O62 D;  4H9O B;  2ZY3 A;  5B1M D;  3MGP A;  1U35 A;  1P3K A;  5GXQ C;  5GXQ B;  1KX5 B;  1T3U A;  4J8V C;  5B32 B;  3WTP E;  5B1M C;  5B1L C;  5B1L B;  5B2I D;  1P3O D;  3LJA B;  3AZH C;  3AZG A;  5B0Y A;  3AZH B;  4CSR B;  3VH5 W;  2HUE C;  2FJ7 D;  2FFF B;  5B2I C;  5B2I B;  1P3O C;  2G5I C;  3C1C A;  4WU9 B;  2FJ7 C;  3REI A;  4KUD A;  4H9N B;  3AZL A;  2Y2G A;  2BYK B;  5AV6 D;  3AZM A;  4WU8 C;  4WU8 B;  4H9Q A;  4Z5T A;  1EQZ D;  2RVQ D;  1BH8 A;  3WA9 D;  3AFA D;  3C1B B;  3AN2 A;  5GT0 B;  5AY8 D;  1KX3 B;  3TU4 D;  3AV2 B;  1EQZ C;  2RVQ C;  3WA9 C;  2XD5 A;  3AFA C;  1S32 D;  5AY8 C;  4XZQ A;  4XUJ A;  2F8N H;  3REK A;  3KXB C;  3KXB B;  2CV5 D;  5E5A A;  4Z66 D;  2ARO B;  3MGR D;  3EPL A;  1TZY B;  3V9R B;  2PYO D;  1P3A B;  3A6N C;  3A6N B;  3AZK D;  2CV5 C;  5DNN C;  2CV5 B;  5DNN B;  5CHL B;  4Z66 C;  3MGR C;  2PYO C;  3B6G C;  3X1V B;  3B6G B;  4J8X A;  5AVC C;  5AVC B;  3EPH A;  3AZK C;  3AZK B;  3W99 D;  3AV1 D;  4UUZ A;  3AYW C;  4WNN B;  3AYW B;  5AV8 D;  3MGP B;  1BH9 A;  3W99 C;  1U35 B;  1P3K B;  5GT3 D;  3AZG D;  5B0Y D;  3H0R C;  3MGQ D;  2Y2I A;  4H9S C;  2Y2P A;  3MNN D;  4J8V A;  3O62 A;  5GT3 C;  2YFV A;  5B1M A;  5B0Y C;  3VH5 A;  2RIQ A;  3VH6 W;  5B0Y B;  3MGQ C;  2ZM5 A;  3AZG C;  3AZG B;  3MGS A;  3B0D B;  3MNN C;  4H9P A;  4Z5T D;  4EO5 C;  1M1A D;  3C1C B;  4KUD C;  3REI B;  4KUD B;  3AZL B;  3AN2 D;  2F2A C;  3B0C T;  2FJ7 A;  3AZM B;  4ZBJ C;  4Z5T C;  4ZBJ B;  4H9Q B;  2DF4 C;  4Z5T B;  3X1T D;  1BH8 B;  3REH B;  4LD9 D;  3AN2 C;  3AN2 B;  4NE3 A;  1M18 D;  4XZQ D;  4XUJ D;  4DRB A;  2Y2O A;  3KUY D;  5C3I C;  5AV6 A;  5C3I B;  3LZ0 D;  3IP4 C;  1EQZ A;  1M18 C;  3WA9 A;  3AFA A;  4XZQ C;  4XZQ B;  4XUJ C;  2NZD D;  3KUY C;  5AY8 A;  3WTP D;  3TU4 A;  1P3L D;  3REK B;  3LZ0 C;  1M19 D;  5E5A B;  1S32 A;  2NZD C;  3WTP C;  1P3L C;  5AVB D;  4J8X D;  4DQY B;  1WWI A;  1P3B D;  5B33 D;  5B32 G;  5AV5 A;  5AVB C;  4Z66 A;  3MGR A;  4J8X C;  3X1S A;  4J8X B;  2PYO A;  1P3B C;  5KDM A;  4UUZ B;  5CPI D;  5B33 C;  1P3F A;  4Z2M G;  2HIO A;  3WAA D;  1BH9 B;  5CPI C;  3W99 A;  3AV1 A;  4J8U D;  3MGS D;  3WAA C;  4J8V B;  3O62 C;  4H9S A;  5AV8 A;  3O62 B;  3VH6 A;  2YFV B;  5B1M B;  4J8U C;  5GT3 A;  3MGS C;  3MGS B;  1B6W A;  5B24 D;  3MGQ A;  2HUE B;  4H9P B;  3AZF D;  2NQB D;  3MNN A;  4KGC D;  5FUG A;  1P3O B;  4R8P A;  5B24 C;  4UPK A;  4M6B A;  3AZJ D;  2FJ7 B;  3AZF C;  5F99 D;  5B31 D;  2NQB C;  2ZY2 A;  5JRG D;  5GSU D;  3AZI D;  1M1A A;  1ZLA A;  3AZJ C;  4DRA A;  5F99 C;  5B31 C;  2ZY5 A;  5AV6 C;  1AOI A;  5AV6 B;  1ID3 D;  4ZUX A;  3AZI C; 
#chains in the Genus database with same CATH homology
 1EQZ B;  3X1T A;  3WA9 B;  4LD9 A;  3AFA B;  1M18 A;  5AY8 B;  3TU4 C;  3TU4 B;  2ZY4 A;  3KUY A;  2BG1 A;  1P3I D;  3LZ0 A;  1S32 C;  3W97 A;  1S32 B;  4YM6 D;  5AV5 D;  3LZ1 D;  2NZD A;  3X1S D;  3H0M C;  1WWS A;  3WTP A;  3KWQ A;  1KU5 A;  1ULY A;  1P3I C;  1P3L A;  4YM6 C;  1P3F D;  5B40 D;  1M19 A;  5AV5 C;  5AV5 B;  3LZ1 C;  4Z66 B;  1W2E A;  3MGR B;  3X1S B;  3X1S C;  2HIO D;  2DQN C;  1HQ3 D;  3B0C W;  5AVB A;  1P3P D;  2PYO B;  3W96 D;  3KFU G;  5KDM B;  3UTB D;  1P3F C;  5B40 C;  3MVD A;  1P3B A;  2JCH A;  5B33 A;  3P5J B;  3UT9 D;  2HIO C;  5JA4 A;  4AWL C;  4AWL B;  3AZE D;  3NQU A;  4QLC D;  5CPK D;  3W99 B;  3AV1 C;  1PZR A;  3AV1 B;  5BNX A;  4X23 D;  5CPI A;  3UT9 C;  2XD1 A;  1JFI A;  5AV8 C;  3AZE C;  5AV8 B;  4HGA C;  3WKJ D;  5CPK C;  3WAA A;  2F8N G;  5CP6 D;  5GT3 B;  4R8P D;  1P34 D;  3MGQ B;  2Y2M A;  4J8U A;  3A1I A;  1P3M A;  3WKJ C;  1Q9C A;  3MNN B;  5FUG B;  5CP6 C;  1TAF A;  1F1E A;  4R8P C;  4R8P B;  1P34 C;  4EO5 B;  1ZLA D;  3AZN D;  5B24 A;  1AOI D;  3AZF A;  2NQB A;  4KGC A;  4ZUX D;  1M1A C;  1M1A B;  1ZLA C;  2Y2J A;  1ZLA B;  5B2J D;  5B0Z D;  2VQR A;  4NE5 A;  3AZJ A;  1AOI C;  5F99 A;  5B31 A;  4ZUX C;  3X1T C;  5JRG A;  3X1T B;  1B67 A;  4LD9 C;  4LD9 B;  5GSU A;  5B0Z C;  1P3G D;  3AZI A;  3W97 D;  1M18 B;  1HTA A;  4XUJ B;  1BFM A;  4YS3 D;  3KUY B;  3KWQ D;  4JJN D;  3UTA D;  2F8N D;  1ID3 A;  3LZ0 B;  3W97 C;  3W97 B;  2NZD B;  4G92 C;  4YS3 C;  4G92 B;  3KWQ C;  4JJN C;  3WTP B;  3KWQ B;  1P3L B;  5AV9 D;  2J8P A;  3EG5 B;  1M19 C;  3MVD D;  4J8W A;  1M19 B;  1P3I A;  3X1U A;  4YM6 A;  5DNM A;  4NFT A;  1KX3 A;  2YFW A;  5AVB B;  5AV9 C;  2Y2Q A;  3LZ1 A;  3REL D;  5BNV A;  3MVD C;  1P3B B;  3R45 A;  3B6F A;  5B40 A;  5B33 B;  3REJ D;  5JA4 B;  3REL C;  2Y2K A;  3NQU B;  1HQ3 A;  3W96 A;  1P3P A;  4WV4 B;  3NQJ A;  3UTB A;  2UWX A;  5BNX B;  5CPI B;  4H9R A;  1N1J A;  4WZS B;  1JFI B;  1P3M D;  3UT9 A;  3WAA B;  3AZE A;  3W98 D;  4E45 A;  1F66 D;  4QLC A;  5CPK A;  2F8N K;  4J8U B;  2JE5 A;  4X23 A;  1P3M C;  2LY8 A;  5BT1 D;  3X1V A;  3A1K A;  3W98 C;  1TAF B;  3WKJ A;  1F66 C;  5CP6 A;  1P34 A;  5B24 B;  1KX5 D;  5BT1 C;  5B32 D;  3AZF B;  2NQB B;  4KGC C;  4KGC B;  4KHA A;  5B1L D;  3LJA D;  3AZH D;  1KX5 C;  5B32 C;  3AZN A;  2CWE A;  3AZJ B;  1H3O A;  4WJ3 C;  5F99 B;  5B31 B;  5JRG C;  5JRG B;  4NE6 A;  5GSU C;  2BYM A;  5GSU B;  3LJA C;  3AZI B;  4WU9 D;  5B2J A;  5BS7 A;  5B0Z A;  4WU8 D;  1ID3 C;  1ID3 B;  4WU9 C;  4J8W D;  3LEL A;  3X1U D;  3C1B D;  1P3G A;  5GT0 D;  5DNM D;  1KX4 A;  1KX3 D;  3AV2 D;  3F6T A;  3EPK A;  4YS3 A;  4J8W C;  4JJN A;  4J8W B;  3REH A;  2IO5 C;  3UTA A;  2IO5 B;  3X1U C;  2G5H C;  3X1U B;  3C1B C;  5CPJ A;  5GT0 C;  5DNM C;  4YM6 B;  5DNM B;  3B6F D;  1KX3 C;  2YFW B;  3AV2 C;  3LZ1 B;  5BNV B;  5BO0 A;  1R4V A;  5AV9 A;  3KXB D;  3B6F C;  3R45 B;  1P3F B;  5B40 B;  3B6F B;  2W8S A;  2Y2H A;  2Y2L A;  2ARO D;  2HIO B;  1HQ3 C;  1TZY D;  1HQ3 B;  3W96 C;  1P3P B;  1P3A D;  3REL A;  3UTB C;  1P3P C;  3NQJ B;  3A6N D;  3UTB B;  3W96 B;  3VH5 T;  3EPJ A;  5G49 A;  4H9R B;  1N1J B;  5DNN D;  2ARO C;  3UT9 B;  1TZY C;  3REJ A;  3X1V D;  1P3A C;  3B6G D;  3AZE B;  5AVC D;  4HGA B;  4QLC C;  4QLC B;  5CPK B;  3AL0 C;  4X23 C;  3H0L C;  4X23 B;  3KSY A;  3AYW D;  3X1V C;  3MGP D;  3WKJ B;  5CP6 B;  1U35 D;  1P3K D;  3W98 A;  1F66 A;  1P34 B;  3MGP C;  4KHA B;  4CAY A;  1U35 C;  1P3K C;  4H9O A;  3AZN C;  3AZN B;  5GXQ A;  1H3O B;  1KX5 A;  2JSS A;  5B32 A;  1AOI B;  2BYM B;  4ZUX B;  5B1L A;  3C1C D;  5B2J C;  5B2J B;  3LEL D;  3LJA A;  5BS7 C;  3REI D;  3B0D C;  4CSR A;  5B0Z B;  3AZL D;  3AZH A;  1KX4 D;  4KUD D;  3AZM D;  3C1C C;  5B2I A;  3REH D;  1P3O A;  4E44 A;  3LEL C;  3LEL B;  5CPJ D;  3REI C;  3AZL C;  1P3G B;  1P3G C;  4WU9 A;  1KX4 C;  1KX4 B;  4H9N A;  3AZM C;  2BYK A;  4YS3 B;  3UTA C;  4JJN B;  3REH C;  3UTA B;  2F8N B;  4WU8 A;  5CPJ C;  4Z2M H;  5CPJ B;  3C1B A;  5GT0 A;  1A7W A;  5BO0 B;  3REK D;  5AV9 B;  3AV2 A;  1Z2C B;  2L5A A;  3FDD A;  3MVD B;  5E5A D;  3REK C;  3REL B;  3VH6 T;  5G49 B;  3KXB A;  5E5A C;  3B0B A;  3REJ C;  2F8N A;  3REJ B;  2ARO A;  1TZY A;  3V9R A;  1P3A A;  3A6N A;  2Y2N A;  2CV5 A;  5DNN A;  5B31 G;  1P3M B;  3B6G A;  4G91 C;  4G91 B;  3W98 B;  5AVC A;  3AZK A;  1F66 B;  5GXQ D;  1P3I B;  4WNN A;  4J8V D;  3AYW A;  4CAY B;  3O62 D;  4H9O B;  2ZY3 A;  5B1M D;  3MGP A;  1U35 A;  1P3K A;  5GXQ C;  5GXQ B;  1KX5 B;  1T3U A;  4J8V C;  5B32 B;  3WTP E;  5B1M C;  5B1L C;  5B1L B;  5B2I D;  1P3O D;  3LJA B;  3AZH C;  3AZG A;  5B0Y A;  3AZH B;  4CSR B;  3VH5 W;  2HUE C;  2FJ7 D;  2FFF B;  5B2I C;  5B2I B;  1P3O C;  2G5I C;  3C1C A;  4WU9 B;  2FJ7 C;  3REI A;  4KUD A;  4H9N B;  3AZL A;  2Y2G A;  2BYK B;  5AV6 D;  3AZM A;  4WU8 C;  4WU8 B;  4H9Q A;  4Z5T A;  1EQZ D;  2RVQ D;  1BH8 A;  3WA9 D;  3AFA D;  3C1B B;  3AN2 A;  5GT0 B;  5AY8 D;  1KX3 B;  3TU4 D;  3AV2 B;  1EQZ C;  2RVQ C;  3WA9 C;  2XD5 A;  3AFA C;  1S32 D;  5AY8 C;  4XZQ A;  4XUJ A;  2F8N H;  3REK A;  3KXB C;  3KXB B;  2CV5 D;  5E5A A;  4Z66 D;  2ARO B;  3MGR D;  3EPL A;  1TZY B;  3V9R B;  2PYO D;  1P3A B;  3A6N C;  3A6N B;  3AZK D;  2CV5 C;  5DNN C;  2CV5 B;  5DNN B;  5CHL B;  4Z66 C;  3MGR C;  2PYO C;  3B6G C;  3X1V B;  3B6G B;  4J8X A;  5AVC C;  5AVC B;  3EPH A;  3AZK C;  3AZK B;  3W99 D;  3AV1 D;  4UUZ A;  3AYW C;  4WNN B;  3AYW B;  5AV8 D;  3MGP B;  1BH9 A;  3W99 C;  1U35 B;  1P3K B;  5GT3 D;  3AZG D;  5B0Y D;  3H0R C;  3MGQ D;  2Y2I A;  4H9S C;  2Y2P A;  3MNN D;  4J8V A;  3O62 A;  5GT3 C;  2YFV A;  5B1M A;  5B0Y C;  3VH5 A;  2RIQ A;  3VH6 W;  5B0Y B;  3MGQ C;  2ZM5 A;  3AZG C;  3AZG B;  3MGS A;  3B0D B;  3MNN C;  4H9P A;  4Z5T D;  4EO5 C;  1M1A D;  3C1C B;  4KUD C;  3REI B;  4KUD B;  3AZL B;  3AN2 D;  2F2A C;  3B0C T;  2FJ7 A;  3AZM B;  4ZBJ C;  4Z5T C;  4ZBJ B;  4H9Q B;  2DF4 C;  4Z5T B;  3X1T D;  1BH8 B;  3REH B;  4LD9 D;  3AN2 C;  3AN2 B;  4NE3 A;  1M18 D;  4XZQ D;  4XUJ D;  4DRB A;  2Y2O A;  3KUY D;  5C3I C;  5AV6 A;  5C3I B;  3LZ0 D;  3IP4 C;  1EQZ A;  1M18 C;  3WA9 A;  3AFA A;  4XZQ C;  4XZQ B;  4XUJ C;  2NZD D;  3KUY C;  5AY8 A;  3WTP D;  3TU4 A;  1P3L D;  3REK B;  3LZ0 C;  1M19 D;  5E5A B;  1S32 A;  2NZD C;  3WTP C;  1P3L C;  5AVB D;  4J8X D;  4DQY B;  1WWI A;  1P3B D;  5B33 D;  5B32 G;  5AV5 A;  5AVB C;  4Z66 A;  3MGR A;  4J8X C;  3X1S A;  4J8X B;  2PYO A;  1P3B C;  5KDM A;  4UUZ B;  5CPI D;  5B33 C;  1P3F A;  4Z2M G;  2HIO A;  3WAA D;  1BH9 B;  5CPI C;  3W99 A;  3AV1 A;  4J8U D;  3MGS D;  3WAA C;  4J8V B;  3O62 C;  4H9S A;  5AV8 A;  3O62 B;  3VH6 A;  2YFV B;  5B1M B;  4J8U C;  5GT3 A;  3MGS C;  3MGS B;  1B6W A;  5B24 D;  3MGQ A;  2HUE B;  4H9P B;  3AZF D;  2NQB D;  3MNN A;  4KGC D;  5FUG A;  1P3O B;  4R8P A;  5B24 C;  4UPK A;  4M6B A;  3AZJ D;  2FJ7 B;  3AZF C;  5F99 D;  5B31 D;  2NQB C;  2ZY2 A;  5JRG D;  5GSU D;  3AZI D;  1M1A A;  1ZLA A;  3AZJ C;  4DRA A;  5F99 C;  5B31 C;  2ZY5 A;  5AV6 C;  1AOI A;  5AV6 B;  1ID3 D;  4ZUX A;  3AZI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...