4KGCC

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcC00
3UTAC 5B32D 2NZDD 5B40A 3MGRA 3AYWC 5JRGC 4H9SC 3MVDD 5B1LB 5B33D 3AN2A 5AVCA 1P3IC 3MGSB 5B24A 3KXBA 5GT3C 5CP6D 3LZ0A 4JJNB 3LELD 1P3PA 3W99C 1P3KA 5E5AC 4R8PB 3AV2C 2PYOC 1S32A 5B32B 2NZDB 4UUZA 3AYWD 3MVDB 1P3PB 4J8VB 5CPKA 4DRBA 4ZBJC 1ULYA 2F8NH 5GT3D 5F99C 5CP6B 3LELB 3AZGA 1P3IA 5E5AD 1P3LA 3WA9A 4YM6D 3VH6W 5BNXB 3UTAB 5GT0A 3W97C 1U35A 5JRGB 5AV6C 4WU8C 4J8WC 4KUDC 3AZKC 5B31C 1AOIC 3AZGB 1P3IB 1JFIB 5F99D 5KDMB 1P3FA 5B1MA 5GSUA 3B0CW 2FJ7A 4H9OB 3W99B 3WAAA 3MGPA 2YFWA 5E5AB 3AV2B 2PYOB 1M18C 3AZHC 3REJC 3W97D 5DNNA 5AV6D 4KUDD 1P3AC 3AZKD 5B31D 3AZEA 4XZQC 1AOID 1KX5A 2CV5A 1P3BA 3AV1C 4ZBJB 5F99B 3B0DC 4ZUXC 3MGQA 4J8XD 1ZLAC 5AV9C 3WTPA 3REJD 2BYMA 3X1UC 3W97B 5AV6B 4WU8B 4J8WB 3AZNC 4XUJD 4KUDB 1P3AD 3AZKB 4XZQD 5B31B 3NQJA 5B2JA 1AOIB 1F66A 3AV1D 5B0ZC 2NQBA 4KGCA 5AV5A 5AY8A 4DRAA 4WU9C 4ZUXD 2F8NA 4H9RB 1BH9B 1ZLAD 2HIOC 3LJAD 3C1CA 3AZJC 3AZMA 1M18B 3AZHB 2F8NK 3W96C 3VH6A 3X1UD 3AZND 3RELA 4KGCB 1P3AB 4H9QA 4CAYA 2F8NB 4LD9A 4XZQB 5B0ZD 5AVBA 3AV1B 3WKJA 1A7WA 3REHC 3B0DB 1P3OC 2HIOD 1ZLAB 3AZJD 3W96D 5AV9B 5BNVA 4WU9A 4Z66A 3X1UB 3UT9D 3TU4A 3AZNB 5B33C 4KHAB 5B0ZB 4WU9B 4E45A 3REHD 5B1LA 5AV8C 5CPJC 2HIOB 3C1BD 5CPIC 3MGSA 3AZJB 3X1SC 3W96B 1P34C 4JJNA 1P3GC 1HTAA 3KUYA 4R8PA 3W98D 1KX4C 5B32A 2NZDA 3MVDA 3REHB 1P3OB 5B33A 2YFVB 5AV8D 3KUYB 4X23C 5CPJD 4NE6A 4J8VA 1M19C 5CPID 4YM6C 3X1SD 1P34D 1HQ3C 1P3GD 5CP6A 3LELA 2JSSA 5BNXA 5B33B 1KX4D 3UTAA 1H3OB 5JRGA 3AYWA 4QLCD 4H9SA 1EQZC 1P3KD 5AV8B 4X23D 1JFIA 4WNNA 5CPJB 1M19D 3X1SB 3AZFC 1HQ3D 1P34B 4CSRA 5KDMA 5GT3A 1P3GB 3AYWB 3R45B 3X1VC 4H9OA 3W99A 5FUGB 5E5AA 3AV2A 2PYOA 4Z5TC 5BO0B 1KX4B 4WNNB 3REKC 1EQZD 4M6BA 1P3LD 3WA9D 1BFMA 4CSRB 1ID3C 5GT3B 5C3IC 5GT0D 4X23B 3V9RB 1M19B 4J8XC 4YM6B 3AZFD 1HQ3B 5F99A 3KWQC 3X1VD 4XUJC 4Z5TD 3B0BA 5GXQC 1P3FD 5B1MD 3W97A 5B2IC 3REKD 5AV6A 4WU8A 4J8WA 2FJ7D 3WAAD 4KUDA 3MGPD 1ID3D 1EQZB 3A6NC 3AZKA 5B31A 1AOIA 5DNND 4Z2MH 3LJAC 3B6FC 5DNMC 3KWQD 3MNNC 4H9RA 1P3BD 1TZYC 3AFAC 1BH9A 3X1VB 5GXQD 4Z5TB 3AZLC 3AZHA 1M18A 3REJA 4H9NB 5B2ID 3A6ND 1P3AA 5JA4A 1ID3B 4WV4B 1Q9CA 1P3MC 4XZQA 5C3IB 2BYKB 2AROC 3AV1A 3VH5T 4J8XB 3UTBC 3B6FD 1KX3C 3REJB 5DNMD 2F8NG 3UT9C 1R4VA 4ZUXA 5B2JD 3MNND 1TZYD 3AFAD 1F66D 3O62C 5BS7C 3X1TC 3REIC 4XUJB 1ZLAA 5JA4B 1N1JB 1TAFA 2L5AA 5AV5D 5GXQB 5B0YC 5AV9A 3LJAA 3AZLD 3B6GC 3X1UA 5B2IB 4E44A 3AZNA 1KU5A 3A6NB 1P3MD 4ZUXB 4J8UC 2AROD 4KHAA 5B0ZA 3AZIC 3C1BC 2RVQC 3UTBD 1TAFB 3LJAB 1KX3D 3B6FB 4YS3C 5DNMB 3X1TD 3O62D 3AFAB 3REID 1M1AC 2HIOA 3LZ1C 5B0YD 3AZJA 3B6GD 3W98C 3AZLB 3W96A 3UT9A 2LY8A 1P3MB 4J8UD 3MGRC 5B40C 2AROB 3AZID 2RVQD 1KX3B 4YS3D 3REHA 1P3OA 3UT9B 1F1EA 2YFVA 5AVCC 3AN2C 1M1AD 3O62B 3LZ1D 3X1TB 3REIB 4G92C 1WWSA 3C1BA 1WWIA 5B24C 5B0YB 3B6GB 5B1LD 3KXBC 3LZ0C 1P3PC 4QLCC 1B67A 1P3KC 4NE3A 4J8UB 5B32G 5B40D 3MGRD 1S32C 4NFTA 1H3OA 3C1BB 3AZIB 5G49A 4YS3B 3AN2D 5AVCD 4H9PB 5AV8A 1M1AB 5CPJA 3LZ1B 5CPKC 5B24D 5CPIA 3W98B 3X1SA 4WZSB 1P34A 3KXBD 3LZ0D 1P3GA 3R45A 1P3PD 5G49B 4J8VD 3AZGC 5FUGA 1P3LC 3WA9C 5BO0A 3NQUB 1KX4A 1S32D 5GT0C 5B40B 3MGRB 1U35C 5CPIB 4QLCA 3AN2B 5AVCB 3UTAD 4X23A 3V9RA 5CPKD 5JRGD 4G92B 1M19A 4YM6A 5B24B 1HQ3A 1P3FC 5B1MC 3KXBB 3LZ0B 5GSUC 3AZGD 1P3ID 4QLCB 3WAAC 2FJ7C 3MGPC 1P3KB 1S32B 1U35D 4G91C 4UUZB 5DNNC 3W99D 1EQZA 3AV2D 2PYOD 3AZEC 1KX5C 2CV5C 1P3BC 5CHLB 5CPKB 3AZFA 5GSUD 3X1VA 3MGQC 1P3LB 3WA9B 2IO5C 5BT1C 4Z5TA 3WTPC 5GT0B 4H9NA 1U35B 2CWEA 3VH5W 3REKA 3AZFB 1ID3A 3VH6T 3AZED 5B31G 1KX5D 2CV5D 5B2JC 1F66C 2BYKA 4HGAC 4J8XA 4AWLC 4WU8D 4J8WD 2NQBC 4KGCC 5AV5C 5AY8C 1P3FB 5B1MB 4NE5A 1B6WA 5GSUB 3KWQA 3REKB 2FJ7B 3MGQD 3WAAB 4XUJA 3MGPB 5BT1D 2YFWB 3C1CC 1N1JA 3AZMC 5GXQA 3WTPD 4G91B 5B2IA 5DNNB 3B0CT 4EO5C 3RELC 3KSYA 3A6NA 1M18D 2HUEC 3AZEB 3AZHD 4LD9C 1KX5B 3KWQB 2CV5B 1P3BB 5AVBC 2NQBD 3WKJC 3B6FA 4KGCD 5AY8D 2F8ND 5DNMA 3MNNA 1TZYA 3AFAA 3MGQB 3C1CD 2IO5B 3AZMD 3AZLA 3WTPB 2BYMB 4Z66C 3TU4C 3RELD 1BH8A 4LD9D 1P3MA 5AV9D 3NQJB 5B2JB 3MNNB 1TZYB 4HGAB 1F66B 5AVBD 2AROA 4AWLB 3WKJD 3UTBA 2NQBB 1KX3A 5AV5B 5AY8B 5B1LC 3WTPE 1BH8B 3O62A 5BS7A 3X1TA 3REIA 3C1CB 3MGSC 3AZMB 5B0YA 3B6GA 4WU9D 4Z66D 3TU4D 4JJNC 3KUYC 3UTBB 4EO5B 3RELB 3VH5A 4H9QB 4R8PC 2HUEB 4CAYB 4LD9B 4J8UA 5B32C 2NZDC 5AVBB 3AZIA 3WKJB 4Z2MG 3MVDC 4YS3A 4H9PA 1M1AA 3LZ1A 4J8VC 3MGSD 3W98A 5BNVB 4Z66B 1P3OD 4JJND 3TU4B 5CP6C 3KUYD 3LELC 4R8PD 3NQUA
chains in the Genus database with same CATH superfamily
3UTAC 5B32D 2NZDD 5B40A 3MGRA 2XD1A 3AYWC 5JRGC 4H9SC 3MVDD 5B1LB 5B33D 3AN2A 5AVCA 1P3IC 3MGSB 5B24A 4WJ3C 3KXBA 5GT3C 5CP6D 2UWXA 3LZ0A 4JJNB 3LELD 1P3PA 3W99C 1P3KA 5E5AC 4R8PB 3AV2C 3H0RC 2PYOC 1S32A 5B32B 2NZDB 4UUZA 3AYWD 3MVDB 1P3PB 3H0MC 4J8VB 5CPKA 4DRBA 4ZBJC 1ULYA 2F8NH 5GT3D 5F99C 5CP6B 2Y2PA 3LELB 3AZGA 1P3IA 5E5AD 1P3LA 3WA9A 4YM6D 3VH6W 5BNXB 3UTAB 5GT0A 3W97C 1U35A 5JRGB 5AV6C 4WU8C 4J8WC 4KUDC 2ZY5A 3AZKC 5B31C 1AOIC 3AZGB 1P3IB 1JFIB 5F99D 5KDMB 1P3FA 5B1MA 3P5JB 5GSUA 3B0CW 2FJ7A 4H9OB 3W99B 3WAAA 3MGPA 2YFWA 5E5AB 3AV2B 2PYOB 1M18C 3AZHC 3REJC 3W97D 5DNNA 5AV6D 4KUDD 1P3AC 3AZKD 5B31D 3AZEA 4XZQC 1AOID 1KX5A 2CV5A 1P3BA 2Y2NA 3AV1C 4ZBJB 5F99B 3B0DC 4DQYB 4ZUXC 2FFFB 2F2AC 3MGQA 4J8XD 1ZLAC 5AV9C 3WTPA 3REJD 2BYMA 3X1UC 3W97B 5AV6B 4WU8B 4J8WB 3AZNC 4XUJD 4KUDB 1P3AD 3A1IA 3AZKB 4XZQD 5B31B 3NQJA 5B2JA 1AOIB 1F66A 3AV1D 5B0ZC 2NQBA 4KGCA 5AV5A 5AY8A 4DRAA 4WU9C 4ZUXD 2F8NA 4H9RB 1BH9B 1ZLAD 2HIOC 3LJAD 3C1CA 3AZJC 3AZMA 1M18B 3AZHB 2F8NK 3W96C 3VH6A 3X1UD 3AZND 3RELA 4KGCB 1P3AB 4H9QA 4CAYA 3EG5B 2F8NB 4LD9A 4XZQB 5B0ZD 5AVBA 3AV1B 3WKJA 1A7WA 3REHC 3B0DB 1P3OC 2HIOD 1ZLAB 3AZJD 3AL0C 3W96D 5AV9B 5BNVA 4WU9A 4Z66A 3X1UB 3UT9D 3TU4A 3AZNB 5B33C 4KHAB 5B0ZB 4WU9B 2DF4C 4E45A 3REHD 5B1LA 3EPLA 2Y2IA 5AV8C 3KFUG 1Z2CB 5CPJC 2HIOB 3C1BD 5CPIC 3MGSA 3AZJB 3X1SC 3W96B 1P34C 4JJNA 1P3GC 1HTAA 3KUYA 4R8PA 3W98D 1KX4C 5B32A 2NZDA 3MVDA 3REHB 1P3OB 5B33A 2YFVB 5AV8D 2Y2KA 3KUYB 4X23C 5CPJD 4NE6A 3IP4C 4J8VA 1M19C 5CPID 4YM6C 3X1SD 1P34D 1HQ3C 1P3GD 5CP6A 3LELA 2JSSA 5BNXA 5B33B 1KX4D 3UTAA 1H3OB 5JRGA 3AYWA 4QLCD 4H9SA 1EQZC 1P3KD 5AV8B 4X23D 1JFIA 4WNNA 5CPJB 1M19D 3EPHA 3X1SB 3AZFC 1HQ3D 1P34B 4CSRA 2JE5A 5KDMA 5GT3A 1P3GB 3AYWB 3R45B 2RIQA 3X1VC 4H9OA 2ZM5A 3W99A 5FUGB 5E5AA 3AV2A 2PYOA 4Z5TC 5BO0B 1KX4B 4WNNB 3REKC 1EQZD 4M6BA 1P3LD 3WA9D 1BFMA 4CSRB 1ID3C 5GT3B 5C3IC 5GT0D 4X23B 2JCHA 3V9RB 1M19B 2W8SA 4J8XC 4YM6B 2Y2OA 3AZFD 1HQ3B 5F99A 3KWQC 3X1VD 4XUJC 4Z5TD 3B0BA 5GXQC 2BG1A 1P3FD 5B1MD 3W97A 5B2IC 3REKD 5AV6A 4WU8A 4J8WA 2FJ7D 3WAAD 4KUDA 3MGPD 1ID3D 1EQZB 3A6NC 3AZKA 5B31A 2Y2QA 1AOIA 5DNND 4Z2MH 3LJAC 3B6FC 5DNMC 3KWQD 2ZY4A 4H9RA 3MNNC 1TZYC 3AFAC 1BH9A 3X1VB 1P3BD 5GXQD 4Z5TB 3AZLC 3AZHA 1M18A 3REJA 4H9NB 5B2ID 3A6ND 1P3AA 5JA4A 1ID3B 4WV4B 1Q9CA 1P3MC 4XZQA 5C3IB 2BYKB 2AROC 3AV1A 3VH5T 4J8XB 3UTBC 3B6FD 1KX3C 3REJB 5DNMD 2F8NG 3UT9C 1R4VA 4ZUXA 5B2JD 3MNND 1TZYD 3AFAD 1F66D 3O62C 5BS7C 3X1TC 3REIC 4XUJB 1ZLAA 5JA4B 1N1JB 1TAFA 2L5AA 5AV5D 5GXQB 5B0YC 5AV9A 3LJAA 3AZLD 3B6GC 3X1UA 3EPKA 5B2IB 4E44A 3AZNA 1KU5A 3A6NB 1P3MD 4ZUXB 4J8UC 2AROD 4KHAA 5B0ZA 3AZIC 3C1BC 2RVQC 3UTBD 1TAFB 3LJAB 1KX3D 3B6FB 4YS3C 5DNMB 2Y2MA 3X1TD 3O62D 3AFAB 3REID 1M1AC 2HIOA 3LZ1C 5B0YD 3AZJA 3B6GD 3W98C 3AZLB 3W96A 3UT9A 2LY8A 1P3MB 4J8UD 3H0LC 3MGRC 5B40C 2AROB 3AZID 2RVQD 2Y2HA 1KX3B 4YS3D 3REHA 1P3OA 3UT9B 1F1EA 2YFVA 5AVCC 3AN2C 1M1AD 3O62B 3LZ1D 3X1TB 3REIB 4G92C 1WWSA 3C1BA 1WWIA 5B24C 5B0YB 3B6GB 5B1LD 3KXBC 3LZ0C 1P3PC 4QLCC 1B67A 1P3KC 1W2EA 4NE3A 4J8UB 5B32G 5B40D 3MGRD 1S32C 4NFTA 3FDDA 1H3OA 3C1BB 3AZIB 3EPJA 5G49A 4YS3B 3AN2D 5AVCD 4H9PB 5AV8A 1M1AB 5CPJA 3LZ1B 5CPKC 5B24D 5CPIA 3W98B 3X1SA 4WZSB 1P34A 3KXBD 3LZ0D 1P3GA 3R45A 1P3PD 5G49B 4J8VD 3AZGC 5FUGA 1P3LC 3WA9C 5BO0A 3NQUB 1KX4A 1S32D 5GT0C 5B40B 3MGRB 1U35C 5CPIB 4QLCA 3AN2B 5AVCB 3UTAD 4X23A 3V9RA 5CPKD 5JRGD 4G92B 1M19A 4YM6A 5B24B 1HQ3A 1P3FC 5B1MC 3KXBB 3LZ0B 5GSUC 3AZGD 1P3ID 4QLCB 3WAAC 2FJ7C 3MGPC 1P3KB 1S32B 2DQNC 1U35D 4G91C 4UUZB 5DNNC 3W99D 1EQZA 2ZY2A 2Y2LA 3AV2D 2PYOD 3AZEC 1KX5C 2CV5C 1P3BC 5CHLB 5CPKB 3AZFA 5GSUD 3X1VA 3MGQC 1P3LB 2XD5A 2IO5C 3WA9B 5BT1C 4Z5TA 3WTPC 5GT0B 2Y2GA 4H9NA 1U35B 2CWEA 3VH5W 3REKA 3AZFB 1ID3A 3VH6T 3AZED 5B31G 1KX5D 2CV5D 5B2JC 1F66C 2BYKA 4HGAC 4J8XA 4AWLC 4WU8D 4J8WD 2NQBC 4KGCC 5AV5C 5AY8C 1P3FB 5B1MB 4NE5A 1B6WA 5GSUB 3KWQA 3REKB 2FJ7B 3MGQD 3WAAB 4XUJA 3MGPB 5BT1D 1T3UA 2YFWB 1N1JA 3C1CC 3AZMC 5GXQA 3WTPD 4G91B 5B2IA 5DNNB 3B0CT 4EO5C 3RELC 3KSYA 3A6NA 1M18D 2G5HC 2HUEC 3AZEB 3AZHD 4LD9C 1KX5B 3KWQB 2CV5B 1P3BB 5AVBC 2NQBD 3WKJC 3B6FA 4KGCD 5AY8D 1PZRA 2F8ND 5DNMA 3MNNA 1TZYA 3AFAA 3MGQB 3C1CD 2IO5B 3AZMD 3AZLA 3WTPB 2BYMB 4Z66C 3TU4C 3RELD 1BH8A 2G5IC 4LD9D 1P3MA 5AV9D 3NQJB 5B2JB 3MNNB 1TZYB 4HGAB 4UPKA 5AVBD 2AROA 1F66B 4AWLB 3WKJD 3UTBA 2NQBB 1KX3A 2J8PA 5AV5B 5AY8B 3A1KA 5B1LC 2VQRA 3WTPE 1BH8B 3O62A 2ZY3A 5BS7A 3REIA 3X1TA 3C1CB 3MGSC 3AZMB 5B0YA 3B6GA 4WU9D 4Z66D 3TU4D 4JJNC 3KUYC 3UTBB 4EO5B 3RELB 3VH5A 4H9QB 4R8PC 2HUEB 4CAYB 4LD9B 4J8UA 5B32C 2NZDC 5AVBB 3AZIA 3WKJB 4Z2MG 3MVDC 4YS3A 4H9PA 1M1AA 3LZ1A 4J8VC 2Y2JA 3MGSD 3W98A 5BNVB 4Z66B 1P3OD 4JJND 3TU4B 5CP6C 3F6TA 3KUYD 3LELC 4R8PD 3NQUA
chains in the Genus database with same CATH topology
3UTAC 5B32D 2NZDD 5B40A 3MGRA 2XD1A 3AYWC 5JRGC 4H9SC 3MVDD 5B1LB 5B33D 3AN2A 5AVCA 1P3IC 3MGSB 5B24A 4WJ3C 3KXBA 5GT3C 5CP6D 2UWXA 3LZ0A 4JJNB 3LELD 1P3PA 3W99C 1P3KA 5E5AC 4R8PB 3AV2C 3H0RC 2PYOC 1S32A 5B32B 2NZDB 4UUZA 3AYWD 3MVDB 1P3PB 3H0MC 4J8VB 5CPKA 4DRBA 4ZBJC 1ULYA 2F8NH 5GT3D 5F99C 5CP6B 2Y2PA 3LELB 3AZGA 1P3IA 5E5AD 1P3LA 3WA9A 4YM6D 3VH6W 5BNXB 3UTAB 5GT0A 3W97C 1U35A 5JRGB 5AV6C 4WU8C 4J8WC 4KUDC 2ZY5A 3AZKC 5B31C 1AOIC 3AZGB 1P3IB 1JFIB 5F99D 5KDMB 1P3FA 5B1MA 3P5JB 5GSUA 3B0CW 2FJ7A 4H9OB 3W99B 3WAAA 3MGPA 2YFWA 5E5AB 3AV2B 2PYOB 1M18C 3AZHC 3REJC 3W97D 5DNNA 5AV6D 4KUDD 1P3AC 3AZKD 5B31D 3AZEA 4XZQC 1AOID 1KX5A 2CV5A 1P3BA 2Y2NA 3AV1C 4ZBJB 5F99B 3B0DC 4DQYB 4ZUXC 2FFFB 2F2AC 3MGQA 4J8XD 1ZLAC 5AV9C 3WTPA 3REJD 2BYMA 3X1UC 3W97B 5AV6B 4WU8B 4J8WB 3AZNC 4XUJD 4KUDB 1P3AD 3A1IA 3AZKB 4XZQD 5B31B 3NQJA 5B2JA 1AOIB 1F66A 3AV1D 5B0ZC 2NQBA 4KGCA 5AV5A 5AY8A 4DRAA 4WU9C 4ZUXD 2F8NA 4H9RB 1BH9B 1ZLAD 2HIOC 3LJAD 3C1CA 3AZJC 3AZMA 1M18B 3AZHB 2F8NK 3W96C 3VH6A 3X1UD 3AZND 3RELA 4KGCB 1P3AB 4H9QA 4CAYA 3EG5B 2F8NB 4LD9A 4XZQB 5B0ZD 5AVBA 3AV1B 3WKJA 1A7WA 3REHC 3B0DB 1P3OC 2HIOD 1ZLAB 3AZJD 3AL0C 3W96D 5AV9B 5BNVA 4WU9A 4Z66A 3X1UB 3UT9D 3TU4A 3AZNB 5B33C 4KHAB 5B0ZB 4WU9B 2DF4C 4E45A 3REHD 5B1LA 3EPLA 2Y2IA 5AV8C 3KFUG 1Z2CB 5CPJC 2HIOB 3C1BD 5CPIC 3MGSA 3AZJB 3X1SC 3W96B 1P34C 4JJNA 1P3GC 1HTAA 3KUYA 4R8PA 3W98D 1KX4C 5B32A 2NZDA 3MVDA 3REHB 1P3OB 5B33A 2YFVB 5AV8D 2Y2KA 3KUYB 4X23C 5CPJD 4NE6A 3IP4C 4J8VA 1M19C 5CPID 4YM6C 3X1SD 1P34D 1HQ3C 1P3GD 5CP6A 3LELA 2JSSA 5BNXA 5B33B 1KX4D 3UTAA 1H3OB 5JRGA 3AYWA 4QLCD 4H9SA 1EQZC 1P3KD 5AV8B 4X23D 1JFIA 4WNNA 5CPJB 1M19D 3EPHA 3X1SB 3AZFC 1HQ3D 1P34B 4CSRA 2JE5A 5KDMA 5GT3A 1P3GB 3AYWB 3R45B 2RIQA 3X1VC 4H9OA 2ZM5A 3W99A 5FUGB 5E5AA 3AV2A 2PYOA 4Z5TC 5BO0B 1KX4B 4WNNB 3REKC 1EQZD 4M6BA 1P3LD 3WA9D 1BFMA 4CSRB 1ID3C 5GT3B 5C3IC 5GT0D 4X23B 2JCHA 3V9RB 1M19B 2W8SA 4J8XC 4YM6B 2Y2OA 3AZFD 1HQ3B 5F99A 3KWQC 3X1VD 4XUJC 4Z5TD 3B0BA 5GXQC 2BG1A 1P3FD 5B1MD 3W97A 5B2IC 3REKD 5AV6A 4WU8A 4J8WA 2FJ7D 3WAAD 4KUDA 3MGPD 1ID3D 1EQZB 3A6NC 3AZKA 5B31A 2Y2QA 1AOIA 5DNND 4Z2MH 3LJAC 3B6FC 5DNMC 3KWQD 2ZY4A 4H9RA 3MNNC 1TZYC 3AFAC 1BH9A 3X1VB 1P3BD 5GXQD 4Z5TB 3AZLC 3AZHA 1M18A 3REJA 4H9NB 5B2ID 3A6ND 1P3AA 5JA4A 1ID3B 4WV4B 1Q9CA 1P3MC 4XZQA 5C3IB 2BYKB 2AROC 3AV1A 3VH5T 4J8XB 3UTBC 3B6FD 1KX3C 3REJB 5DNMD 2F8NG 3UT9C 1R4VA 4ZUXA 5B2JD 3MNND 1TZYD 3AFAD 1F66D 3O62C 5BS7C 3X1TC 3REIC 4XUJB 1ZLAA 5JA4B 1N1JB 1TAFA 2L5AA 5AV5D 5GXQB 5B0YC 5AV9A 3LJAA 3AZLD 3B6GC 3X1UA 3EPKA 5B2IB 4E44A 3AZNA 1KU5A 3A6NB 1P3MD 4ZUXB 4J8UC 2AROD 4KHAA 5B0ZA 3AZIC 3C1BC 2RVQC 3UTBD 1TAFB 3LJAB 1KX3D 3B6FB 4YS3C 5DNMB 2Y2MA 3X1TD 3O62D 3AFAB 3REID 1M1AC 2HIOA 3LZ1C 5B0YD 3AZJA 3B6GD 3W98C 3AZLB 3W96A 3UT9A 2LY8A 1P3MB 4J8UD 3H0LC 3MGRC 5B40C 2AROB 3AZID 2RVQD 2Y2HA 1KX3B 4YS3D 3REHA 1P3OA 3UT9B 1F1EA 2YFVA 5AVCC 3AN2C 1M1AD 3O62B 3LZ1D 3X1TB 3REIB 4G92C 1WWSA 3C1BA 1WWIA 5B24C 5B0YB 3B6GB 5B1LD 3KXBC 3LZ0C 1P3PC 4QLCC 1B67A 1P3KC 1W2EA 4NE3A 4J8UB 5B32G 5B40D 3MGRD 1S32C 4NFTA 3FDDA 1H3OA 3C1BB 3AZIB 3EPJA 5G49A 4YS3B 3AN2D 5AVCD 4H9PB 5AV8A 1M1AB 5CPJA 3LZ1B 5CPKC 5B24D 5CPIA 3W98B 3X1SA 4WZSB 1P34A 3KXBD 3LZ0D 1P3GA 3R45A 1P3PD 5G49B 4J8VD 3AZGC 5FUGA 1P3LC 3WA9C 5BO0A 3NQUB 1KX4A 1S32D 5GT0C 5B40B 3MGRB 1U35C 5CPIB 4QLCA 3AN2B 5AVCB 3UTAD 4X23A 3V9RA 5CPKD 5JRGD 4G92B 1M19A 4YM6A 5B24B 1HQ3A 1P3FC 5B1MC 3KXBB 3LZ0B 5GSUC 3AZGD 1P3ID 4QLCB 3WAAC 2FJ7C 3MGPC 1P3KB 1S32B 2DQNC 1U35D 4G91C 4UUZB 5DNNC 3W99D 1EQZA 2ZY2A 2Y2LA 3AV2D 2PYOD 3AZEC 1KX5C 2CV5C 1P3BC 5CHLB 5CPKB 3AZFA 5GSUD 3X1VA 3MGQC 1P3LB 2XD5A 2IO5C 3WA9B 5BT1C 4Z5TA 3WTPC 5GT0B 2Y2GA 4H9NA 1U35B 2CWEA 3VH5W 3REKA 3AZFB 1ID3A 3VH6T 3AZED 5B31G 1KX5D 2CV5D 5B2JC 1F66C 2BYKA 4HGAC 4J8XA 4AWLC 4WU8D 4J8WD 2NQBC 4KGCC 5AV5C 5AY8C 1P3FB 5B1MB 4NE5A 1B6WA 5GSUB 3KWQA 3REKB 2FJ7B 3MGQD 3WAAB 4XUJA 3MGPB 5BT1D 1T3UA 2YFWB 1N1JA 3C1CC 3AZMC 5GXQA 3WTPD 4G91B 5B2IA 5DNNB 3B0CT 4EO5C 3RELC 3KSYA 3A6NA 1M18D 2G5HC 2HUEC 3AZEB 3AZHD 4LD9C 1KX5B 3KWQB 2CV5B 1P3BB 5AVBC 2NQBD 3WKJC 3B6FA 4KGCD 5AY8D 1PZRA 2F8ND 5DNMA 3MNNA 1TZYA 3AFAA 3MGQB 3C1CD 2IO5B 3AZMD 3AZLA 3WTPB 2BYMB 4Z66C 3TU4C 3RELD 1BH8A 2G5IC 4LD9D 1P3MA 5AV9D 3NQJB 5B2JB 3MNNB 1TZYB 4HGAB 4UPKA 5AVBD 2AROA 1F66B 4AWLB 3WKJD 3UTBA 2NQBB 1KX3A 2J8PA 5AV5B 5AY8B 3A1KA 5B1LC 2VQRA 3WTPE 1BH8B 3O62A 2ZY3A 5BS7A 3REIA 3X1TA 3C1CB 3MGSC 3AZMB 5B0YA 3B6GA 4WU9D 4Z66D 3TU4D 4JJNC 3KUYC 3UTBB 4EO5B 3RELB 3VH5A 4H9QB 4R8PC 2HUEB 4CAYB 4LD9B 4J8UA 5B32C 2NZDC 5AVBB 3AZIA 3WKJB 4Z2MG 3MVDC 4YS3A 4H9PA 1M1AA 3LZ1A 4J8VC 2Y2JA 3MGSD 3W98A 5BNVB 4Z66B 1P3OD 4JJND 3TU4B 5CP6C 3F6TA 3KUYD 3LELC 4R8PD 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA C;  5B32 D;  2NZD D;  5B40 A;  3MGR A;  3AYW C;  5JRG C;  4H9S C;  3MVD D;  5B1L B;  5B33 D;  3AN2 A;  5AVC A;  1P3I C;  3MGS B;  5B24 A;  3KXB A;  5GT3 C;  5CP6 D;  3LZ0 A;  4JJN B;  3LEL D;  1P3P A;  3W99 C;  1P3K A;  5E5A C;  4R8P B;  3AV2 C;  2PYO C;  1S32 A;  5B32 B;  2NZD B;  4UUZ A;  3AYW D;  3MVD B;  1P3P B;  4J8V B;  5CPK A;  4DRB A;  4ZBJ C;  1ULY A;  2F8N H;  5GT3 D;  5F99 C;  5CP6 B;  3LEL B;  3AZG A;  1P3I A;  5E5A D;  1P3L A;  3WA9 A;  4YM6 D;  3VH6 W;  5BNX B;  3UTA B;  5GT0 A;  3W97 C;  1U35 A;  5JRG B;  5AV6 C;  4WU8 C;  4J8W C;  4KUD C;  3AZK C;  5B31 C;  1AOI C;  3AZG B;  1P3I B;  1JFI B;  5F99 D;  5KDM B;  1P3F A;  5B1M A;  5GSU A;  3B0C W;  2FJ7 A;  4H9O B;  3W99 B;  3WAA A;  3MGP A;  2YFW A;  5E5A B;  3AV2 B;  2PYO B;  1M18 C;  3AZH C;  3REJ C;  3W97 D;  5DNN A;  5AV6 D;  4KUD D;  1P3A C;  3AZK D;  5B31 D;  3AZE A;  4XZQ C;  1AOI D;  1KX5 A;  2CV5 A;  1P3B A;  3AV1 C;  4ZBJ B;  5F99 B;  3B0D C;  4ZUX C;  3MGQ A;  4J8X D;  1ZLA C;  5AV9 C;  3WTP A;  3REJ D;  2BYM A;  3X1U C;  3W97 B;  5AV6 B;  4WU8 B;  4J8W B;  3AZN C;  4XUJ D;  4KUD B;  1P3A D;  3AZK B;  4XZQ D;  5B31 B;  3NQJ A;  5B2J A;  1AOI B;  1F66 A;  3AV1 D;  5B0Z C;  2NQB A;  4KGC A;  5AV5 A;  5AY8 A;  4DRA A;  4WU9 C;  4ZUX D;  2F8N A;  4H9R B;  1BH9 B;  1ZLA D;  2HIO C;  3LJA D;  3C1C A;  3AZJ C;  3AZM A;  1M18 B;  3AZH B;  2F8N K;  3W96 C;  3VH6 A;  3X1U D;  3AZN D;  3REL A;  4KGC B;  1P3A B;  4H9Q A;  4CAY A;  2F8N B;  4LD9 A;  4XZQ B;  5B0Z D;  5AVB A;  3AV1 B;  3WKJ A;  1A7W A;  3REH C;  3B0D B;  1P3O C;  2HIO D;  1ZLA B;  3AZJ D;  3W96 D;  5AV9 B;  5BNV A;  4WU9 A;  4Z66 A;  3X1U B;  3UT9 D;  3TU4 A;  3AZN B;  5B33 C;  4KHA B;  5B0Z B;  4WU9 B;  4E45 A;  3REH D;  5B1L A;  5AV8 C;  5CPJ C;  2HIO B;  3C1B D;  5CPI C;  3MGS A;  3AZJ B;  3X1S C;  3W96 B;  1P34 C;  4JJN A;  1P3G C;  1HTA A;  3KUY A;  4R8P A;  3W98 D;  1KX4 C;  5B32 A;  2NZD A;  3MVD A;  3REH B;  1P3O B;  5B33 A;  2YFV B;  5AV8 D;  3KUY B;  4X23 C;  5CPJ D;  4NE6 A;  4J8V A;  1M19 C;  5CPI D;  4YM6 C;  3X1S D;  1P34 D;  1HQ3 C;  1P3G D;  5CP6 A;  3LEL A;  2JSS A;  5BNX A;  5B33 B;  1KX4 D;  3UTA A;  1H3O B;  5JRG A;  3AYW A;  4QLC D;  4H9S A;  1EQZ C;  1P3K D;  5AV8 B;  4X23 D;  1JFI A;  4WNN A;  5CPJ B;  1M19 D;  3X1S B;  3AZF C;  1HQ3 D;  1P34 B;  4CSR A;  5KDM A;  5GT3 A;  1P3G B;  3AYW B;  3R45 B;  3X1V C;  4H9O A;  3W99 A;  5FUG B;  5E5A A;  3AV2 A;  2PYO A;  4Z5T C;  5BO0 B;  1KX4 B;  4WNN B;  3REK C;  1EQZ D;  4M6B A;  1P3L D;  3WA9 D;  1BFM A;  4CSR B;  1ID3 C;  5GT3 B;  5C3I C;  5GT0 D;  4X23 B;  3V9R B;  1M19 B;  4J8X C;  4YM6 B;  3AZF D;  1HQ3 B;  5F99 A;  3KWQ C;  3X1V D;  4XUJ C;  4Z5T D;  3B0B A;  5GXQ C;  1P3F D;  5B1M D;  3W97 A;  5B2I C;  3REK D;  5AV6 A;  4WU8 A;  4J8W A;  2FJ7 D;  3WAA D;  4KUD A;  3MGP D;  1ID3 D;  1EQZ B;  3A6N C;  3AZK A;  5B31 A;  1AOI A;  5DNN D;  4Z2M H;  3LJA C;  3B6F C;  5DNM C;  3KWQ D;  3MNN C;  4H9R A;  1P3B D;  1TZY C;  3AFA C;  1BH9 A;  3X1V B;  5GXQ D;  4Z5T B;  3AZL C;  3AZH A;  1M18 A;  3REJ A;  4H9N B;  5B2I D;  3A6N D;  1P3A A;  5JA4 A;  1ID3 B;  4WV4 B;  1Q9C A;  1P3M C;  4XZQ A;  5C3I B;  2BYK B;  2ARO C;  3AV1 A;  3VH5 T;  4J8X B;  3UTB C;  3B6F D;  1KX3 C;  3REJ B;  5DNM D;  2F8N G;  3UT9 C;  1R4V A;  4ZUX A;  5B2J D;  3MNN D;  1TZY D;  3AFA D;  1F66 D;  3O62 C;  5BS7 C;  3X1T C;  3REI C;  4XUJ B;  1ZLA A;  5JA4 B;  1N1J B;  1TAF A;  2L5A A;  5AV5 D;  5GXQ B;  5B0Y C;  5AV9 A;  3LJA A;  3AZL D;  3B6G C;  3X1U A;  5B2I B;  4E44 A;  3AZN A;  1KU5 A;  3A6N B;  1P3M D;  4ZUX B;  4J8U C;  2ARO D;  4KHA A;  5B0Z A;  3AZI C;  3C1B C;  2RVQ C;  3UTB D;  1TAF B;  3LJA B;  1KX3 D;  3B6F B;  4YS3 C;  5DNM B;  3X1T D;  3O62 D;  3AFA B;  3REI D;  1M1A C;  2HIO A;  3LZ1 C;  5B0Y D;  3AZJ A;  3B6G D;  3W98 C;  3AZL B;  3W96 A;  3UT9 A;  2LY8 A;  1P3M B;  4J8U D;  3MGR C;  5B40 C;  2ARO B;  3AZI D;  2RVQ D;  1KX3 B;  4YS3 D;  3REH A;  1P3O A;  3UT9 B;  1F1E A;  2YFV A;  5AVC C;  3AN2 C;  1M1A D;  3O62 B;  3LZ1 D;  3X1T B;  3REI B;  4G92 C;  1WWS A;  3C1B A;  1WWI A;  5B24 C;  5B0Y B;  3B6G B;  5B1L D;  3KXB C;  3LZ0 C;  1P3P C;  4QLC C;  1B67 A;  1P3K C;  4NE3 A;  4J8U B;  5B32 G;  5B40 D;  3MGR D;  1S32 C;  4NFT A;  1H3O A;  3C1B B;  3AZI B;  5G49 A;  4YS3 B;  3AN2 D;  5AVC D;  4H9P B;  5AV8 A;  1M1A B;  5CPJ A;  3LZ1 B;  5CPK C;  5B24 D;  5CPI A;  3W98 B;  3X1S A;  4WZS B;  1P34 A;  3KXB D;  3LZ0 D;  1P3G A;  3R45 A;  1P3P D;  5G49 B;  4J8V D;  3AZG C;  5FUG A;  1P3L C;  3WA9 C;  5BO0 A;  3NQU B;  1KX4 A;  1S32 D;  5GT0 C;  5B40 B;  3MGR B;  1U35 C;  5CPI B;  4QLC A;  3AN2 B;  5AVC B;  3UTA D;  4X23 A;  3V9R A;  5CPK D;  5JRG D;  4G92 B;  1M19 A;  4YM6 A;  5B24 B;  1HQ3 A;  1P3F C;  5B1M C;  3KXB B;  3LZ0 B;  5GSU C;  3AZG D;  1P3I D;  4QLC B;  3WAA C;  2FJ7 C;  3MGP C;  1P3K B;  1S32 B;  1U35 D;  4G91 C;  4UUZ B;  5DNN C;  3W99 D;  1EQZ A;  3AV2 D;  2PYO D;  3AZE C;  1KX5 C;  2CV5 C;  1P3B C;  5CHL B;  5CPK B;  3AZF A;  5GSU D;  3X1V A;  3MGQ C;  1P3L B;  3WA9 B;  2IO5 C;  5BT1 C;  4Z5T A;  3WTP C;  5GT0 B;  4H9N A;  1U35 B;  2CWE A;  3VH5 W;  3REK A;  3AZF B;  1ID3 A;  3VH6 T;  3AZE D;  5B31 G;  1KX5 D;  2CV5 D;  5B2J C;  1F66 C;  2BYK A;  4HGA C;  4J8X A;  4AWL C;  4WU8 D;  4J8W D;  2NQB C;  4KGC C;  5AV5 C;  5AY8 C;  1P3F B;  5B1M B;  4NE5 A;  1B6W A;  5GSU B;  3KWQ A;  3REK B;  2FJ7 B;  3MGQ D;  3WAA B;  4XUJ A;  3MGP B;  5BT1 D;  2YFW B;  3C1C C;  1N1J A;  3AZM C;  5GXQ A;  3WTP D;  4G91 B;  5B2I A;  5DNN B;  3B0C T;  4EO5 C;  3REL C;  3KSY A;  3A6N A;  1M18 D;  2HUE C;  3AZE B;  3AZH D;  4LD9 C;  1KX5 B;  3KWQ B;  2CV5 B;  1P3B B;  5AVB C;  2NQB D;  3WKJ C;  3B6F A;  4KGC D;  5AY8 D;  2F8N D;  5DNM A;  3MNN A;  1TZY A;  3AFA A;  3MGQ B;  3C1C D;  2IO5 B;  3AZM D;  3AZL A;  3WTP B;  2BYM B;  4Z66 C;  3TU4 C;  3REL D;  1BH8 A;  4LD9 D;  1P3M A;  5AV9 D;  3NQJ B;  5B2J B;  3MNN B;  1TZY B;  4HGA B;  1F66 B;  5AVB D;  2ARO A;  4AWL B;  3WKJ D;  3UTB A;  2NQB B;  1KX3 A;  5AV5 B;  5AY8 B;  5B1L C;  3WTP E;  1BH8 B;  3O62 A;  5BS7 A;  3X1T A;  3REI A;  3C1C B;  3MGS C;  3AZM B;  5B0Y A;  3B6G A;  4WU9 D;  4Z66 D;  3TU4 D;  4JJN C;  3KUY C;  3UTB B;  4EO5 B;  3REL B;  3VH5 A;  4H9Q B;  4R8P C;  2HUE B;  4CAY B;  4LD9 B;  4J8U A;  5B32 C;  2NZD C;  5AVB B;  3AZI A;  3WKJ B;  4Z2M G;  3MVD C;  4YS3 A;  4H9P A;  1M1A A;  3LZ1 A;  4J8V C;  3MGS D;  3W98 A;  5BNV B;  4Z66 B;  1P3O D;  4JJN D;  3TU4 B;  5CP6 C;  3KUY D;  3LEL C;  4R8P D;  3NQU A; 
#chains in the Genus database with same CATH topology
 3UTA C;  5B32 D;  2NZD D;  5B40 A;  3MGR A;  2XD1 A;  3AYW C;  5JRG C;  4H9S C;  3MVD D;  5B1L B;  5B33 D;  3AN2 A;  5AVC A;  1P3I C;  3MGS B;  5B24 A;  4WJ3 C;  3KXB A;  5GT3 C;  5CP6 D;  2UWX A;  3LZ0 A;  4JJN B;  3LEL D;  1P3P A;  3W99 C;  1P3K A;  5E5A C;  4R8P B;  3AV2 C;  3H0R C;  2PYO C;  1S32 A;  5B32 B;  2NZD B;  4UUZ A;  3AYW D;  3MVD B;  1P3P B;  3H0M C;  4J8V B;  5CPK A;  4DRB A;  4ZBJ C;  1ULY A;  2F8N H;  5GT3 D;  5F99 C;  5CP6 B;  2Y2P A;  3LEL B;  3AZG A;  1P3I A;  5E5A D;  1P3L A;  3WA9 A;  4YM6 D;  3VH6 W;  5BNX B;  3UTA B;  5GT0 A;  3W97 C;  1U35 A;  5JRG B;  5AV6 C;  4WU8 C;  4J8W C;  4KUD C;  2ZY5 A;  3AZK C;  5B31 C;  1AOI C;  3AZG B;  1P3I B;  1JFI B;  5F99 D;  5KDM B;  1P3F A;  5B1M A;  3P5J B;  5GSU A;  3B0C W;  2FJ7 A;  4H9O B;  3W99 B;  3WAA A;  3MGP A;  2YFW A;  5E5A B;  3AV2 B;  2PYO B;  1M18 C;  3AZH C;  3REJ C;  3W97 D;  5DNN A;  5AV6 D;  4KUD D;  1P3A C;  3AZK D;  5B31 D;  3AZE A;  4XZQ C;  1AOI D;  1KX5 A;  2CV5 A;  1P3B A;  2Y2N A;  3AV1 C;  4ZBJ B;  5F99 B;  3B0D C;  4DQY B;  4ZUX C;  2FFF B;  2F2A C;  3MGQ A;  4J8X D;  1ZLA C;  5AV9 C;  3WTP A;  3REJ D;  2BYM A;  3X1U C;  3W97 B;  5AV6 B;  4WU8 B;  4J8W B;  3AZN C;  4XUJ D;  4KUD B;  1P3A D;  3A1I A;  3AZK B;  4XZQ D;  5B31 B;  3NQJ A;  5B2J A;  1AOI B;  1F66 A;  3AV1 D;  5B0Z C;  2NQB A;  4KGC A;  5AV5 A;  5AY8 A;  4DRA A;  4WU9 C;  4ZUX D;  2F8N A;  4H9R B;  1BH9 B;  1ZLA D;  2HIO C;  3LJA D;  3C1C A;  3AZJ C;  3AZM A;  1M18 B;  3AZH B;  2F8N K;  3W96 C;  3VH6 A;  3X1U D;  3AZN D;  3REL A;  4KGC B;  1P3A B;  4H9Q A;  4CAY A;  3EG5 B;  2F8N B;  4LD9 A;  4XZQ B;  5B0Z D;  5AVB A;  3AV1 B;  3WKJ A;  1A7W A;  3REH C;  3B0D B;  1P3O C;  2HIO D;  1ZLA B;  3AZJ D;  3AL0 C;  3W96 D;  5AV9 B;  5BNV A;  4WU9 A;  4Z66 A;  3X1U B;  3UT9 D;  3TU4 A;  3AZN B;  5B33 C;  4KHA B;  5B0Z B;  4WU9 B;  2DF4 C;  4E45 A;  3REH D;  5B1L A;  3EPL A;  2Y2I A;  5AV8 C;  3KFU G;  1Z2C B;  5CPJ C;  2HIO B;  3C1B D;  5CPI C;  3MGS A;  3AZJ B;  3X1S C;  3W96 B;  1P34 C;  4JJN A;  1P3G C;  1HTA A;  3KUY A;  4R8P A;  3W98 D;  1KX4 C;  5B32 A;  2NZD A;  3MVD A;  3REH B;  1P3O B;  5B33 A;  2YFV B;  5AV8 D;  2Y2K A;  3KUY B;  4X23 C;  5CPJ D;  4NE6 A;  3IP4 C;  4J8V A;  1M19 C;  5CPI D;  4YM6 C;  3X1S D;  1P34 D;  1HQ3 C;  1P3G D;  5CP6 A;  3LEL A;  2JSS A;  5BNX A;  5B33 B;  1KX4 D;  3UTA A;  1H3O B;  5JRG A;  3AYW A;  4QLC D;  4H9S A;  1EQZ C;  1P3K D;  5AV8 B;  4X23 D;  1JFI A;  4WNN A;  5CPJ B;  1M19 D;  3EPH A;  3X1S B;  3AZF C;  1HQ3 D;  1P34 B;  4CSR A;  2JE5 A;  5KDM A;  5GT3 A;  1P3G B;  3AYW B;  3R45 B;  2RIQ A;  3X1V C;  4H9O A;  2ZM5 A;  3W99 A;  5FUG B;  5E5A A;  3AV2 A;  2PYO A;  4Z5T C;  5BO0 B;  1KX4 B;  4WNN B;  3REK C;  1EQZ D;  4M6B A;  1P3L D;  3WA9 D;  1BFM A;  4CSR B;  1ID3 C;  5GT3 B;  5C3I C;  5GT0 D;  4X23 B;  2JCH A;  3V9R B;  1M19 B;  2W8S A;  4J8X C;  4YM6 B;  2Y2O A;  3AZF D;  1HQ3 B;  5F99 A;  3KWQ C;  3X1V D;  4XUJ C;  4Z5T D;  3B0B A;  5GXQ C;  2BG1 A;  1P3F D;  5B1M D;  3W97 A;  5B2I C;  3REK D;  5AV6 A;  4WU8 A;  4J8W A;  2FJ7 D;  3WAA D;  4KUD A;  3MGP D;  1ID3 D;  1EQZ B;  3A6N C;  3AZK A;  5B31 A;  2Y2Q A;  1AOI A;  5DNN D;  4Z2M H;  3LJA C;  3B6F C;  5DNM C;  3KWQ D;  2ZY4 A;  4H9R A;  3MNN C;  1TZY C;  3AFA C;  1BH9 A;  3X1V B;  1P3B D;  5GXQ D;  4Z5T B;  3AZL C;  3AZH A;  1M18 A;  3REJ A;  4H9N B;  5B2I D;  3A6N D;  1P3A A;  5JA4 A;  1ID3 B;  4WV4 B;  1Q9C A;  1P3M C;  4XZQ A;  5C3I B;  2BYK B;  2ARO C;  3AV1 A;  3VH5 T;  4J8X B;  3UTB C;  3B6F D;  1KX3 C;  3REJ B;  5DNM D;  2F8N G;  3UT9 C;  1R4V A;  4ZUX A;  5B2J D;  3MNN D;  1TZY D;  3AFA D;  1F66 D;  3O62 C;  5BS7 C;  3X1T C;  3REI C;  4XUJ B;  1ZLA A;  5JA4 B;  1N1J B;  1TAF A;  2L5A A;  5AV5 D;  5GXQ B;  5B0Y C;  5AV9 A;  3LJA A;  3AZL D;  3B6G C;  3X1U A;  3EPK A;  5B2I B;  4E44 A;  3AZN A;  1KU5 A;  3A6N B;  1P3M D;  4ZUX B;  4J8U C;  2ARO D;  4KHA A;  5B0Z A;  3AZI C;  3C1B C;  2RVQ C;  3UTB D;  1TAF B;  3LJA B;  1KX3 D;  3B6F B;  4YS3 C;  5DNM B;  2Y2M A;  3X1T D;  3O62 D;  3AFA B;  3REI D;  1M1A C;  2HIO A;  3LZ1 C;  5B0Y D;  3AZJ A;  3B6G D;  3W98 C;  3AZL B;  3W96 A;  3UT9 A;  2LY8 A;  1P3M B;  4J8U D;  3H0L C;  3MGR C;  5B40 C;  2ARO B;  3AZI D;  2RVQ D;  2Y2H A;  1KX3 B;  4YS3 D;  3REH A;  1P3O A;  3UT9 B;  1F1E A;  2YFV A;  5AVC C;  3AN2 C;  1M1A D;  3O62 B;  3LZ1 D;  3X1T B;  3REI B;  4G92 C;  1WWS A;  3C1B A;  1WWI A;  5B24 C;  5B0Y B;  3B6G B;  5B1L D;  3KXB C;  3LZ0 C;  1P3P C;  4QLC C;  1B67 A;  1P3K C;  1W2E A;  4NE3 A;  4J8U B;  5B32 G;  5B40 D;  3MGR D;  1S32 C;  4NFT A;  3FDD A;  1H3O A;  3C1B B;  3AZI B;  3EPJ A;  5G49 A;  4YS3 B;  3AN2 D;  5AVC D;  4H9P B;  5AV8 A;  1M1A B;  5CPJ A;  3LZ1 B;  5CPK C;  5B24 D;  5CPI A;  3W98 B;  3X1S A;  4WZS B;  1P34 A;  3KXB D;  3LZ0 D;  1P3G A;  3R45 A;  1P3P D;  5G49 B;  4J8V D;  3AZG C;  5FUG A;  1P3L C;  3WA9 C;  5BO0 A;  3NQU B;  1KX4 A;  1S32 D;  5GT0 C;  5B40 B;  3MGR B;  1U35 C;  5CPI B;  4QLC A;  3AN2 B;  5AVC B;  3UTA D;  4X23 A;  3V9R A;  5CPK D;  5JRG D;  4G92 B;  1M19 A;  4YM6 A;  5B24 B;  1HQ3 A;  1P3F C;  5B1M C;  3KXB B;  3LZ0 B;  5GSU C;  3AZG D;  1P3I D;  4QLC B;  3WAA C;  2FJ7 C;  3MGP C;  1P3K B;  1S32 B;  2DQN C;  1U35 D;  4G91 C;  4UUZ B;  5DNN C;  3W99 D;  1EQZ A;  2ZY2 A;  2Y2L A;  3AV2 D;  2PYO D;  3AZE C;  1KX5 C;  2CV5 C;  1P3B C;  5CHL B;  5CPK B;  3AZF A;  5GSU D;  3X1V A;  3MGQ C;  1P3L B;  2XD5 A;  2IO5 C;  3WA9 B;  5BT1 C;  4Z5T A;  3WTP C;  5GT0 B;  2Y2G A;  4H9N A;  1U35 B;  2CWE A;  3VH5 W;  3REK A;  3AZF B;  1ID3 A;  3VH6 T;  3AZE D;  5B31 G;  1KX5 D;  2CV5 D;  5B2J C;  1F66 C;  2BYK A;  4HGA C;  4J8X A;  4AWL C;  4WU8 D;  4J8W D;  2NQB C;  4KGC C;  5AV5 C;  5AY8 C;  1P3F B;  5B1M B;  4NE5 A;  1B6W A;  5GSU B;  3KWQ A;  3REK B;  2FJ7 B;  3MGQ D;  3WAA B;  4XUJ A;  3MGP B;  5BT1 D;  1T3U A;  2YFW B;  1N1J A;  3C1C C;  3AZM C;  5GXQ A;  3WTP D;  4G91 B;  5B2I A;  5DNN B;  3B0C T;  4EO5 C;  3REL C;  3KSY A;  3A6N A;  1M18 D;  2G5H C;  2HUE C;  3AZE B;  3AZH D;  4LD9 C;  1KX5 B;  3KWQ B;  2CV5 B;  1P3B B;  5AVB C;  2NQB D;  3WKJ C;  3B6F A;  4KGC D;  5AY8 D;  1PZR A;  2F8N D;  5DNM A;  3MNN A;  1TZY A;  3AFA A;  3MGQ B;  3C1C D;  2IO5 B;  3AZM D;  3AZL A;  3WTP B;  2BYM B;  4Z66 C;  3TU4 C;  3REL D;  1BH8 A;  2G5I C;  4LD9 D;  1P3M A;  5AV9 D;  3NQJ B;  5B2J B;  3MNN B;  1TZY B;  4HGA B;  4UPK A;  5AVB D;  2ARO A;  1F66 B;  4AWL B;  3WKJ D;  3UTB A;  2NQB B;  1KX3 A;  2J8P A;  5AV5 B;  5AY8 B;  3A1K A;  5B1L C;  2VQR A;  3WTP E;  1BH8 B;  3O62 A;  2ZY3 A;  5BS7 A;  3REI A;  3X1T A;  3C1C B;  3MGS C;  3AZM B;  5B0Y A;  3B6G A;  4WU9 D;  4Z66 D;  3TU4 D;  4JJN C;  3KUY C;  3UTB B;  4EO5 B;  3REL B;  3VH5 A;  4H9Q B;  4R8P C;  2HUE B;  4CAY B;  4LD9 B;  4J8U A;  5B32 C;  2NZD C;  5AVB B;  3AZI A;  3WKJ B;  4Z2M G;  3MVD C;  4YS3 A;  4H9P A;  1M1A A;  3LZ1 A;  4J8V C;  2Y2J A;  3MGS D;  3W98 A;  5BNV B;  4Z66 B;  1P3O D;  4JJN D;  3TU4 B;  5CP6 C;  3F6T A;  3KUY D;  3LEL C;  4R8P D;  3NQU A; 
#chains in the Genus database with same CATH homology
 3UTA C;  5B32 D;  2NZD D;  5B40 A;  3MGR A;  2XD1 A;  3AYW C;  5JRG C;  4H9S C;  3MVD D;  5B1L B;  5B33 D;  3AN2 A;  5AVC A;  1P3I C;  3MGS B;  5B24 A;  4WJ3 C;  3KXB A;  5GT3 C;  5CP6 D;  2UWX A;  3LZ0 A;  4JJN B;  3LEL D;  1P3P A;  3W99 C;  1P3K A;  5E5A C;  4R8P B;  3AV2 C;  3H0R C;  2PYO C;  1S32 A;  5B32 B;  2NZD B;  4UUZ A;  3AYW D;  3MVD B;  1P3P B;  3H0M C;  4J8V B;  5CPK A;  4DRB A;  4ZBJ C;  1ULY A;  2F8N H;  5GT3 D;  5F99 C;  5CP6 B;  2Y2P A;  3LEL B;  3AZG A;  1P3I A;  5E5A D;  1P3L A;  3WA9 A;  4YM6 D;  3VH6 W;  5BNX B;  3UTA B;  5GT0 A;  3W97 C;  1U35 A;  5JRG B;  5AV6 C;  4WU8 C;  4J8W C;  4KUD C;  2ZY5 A;  3AZK C;  5B31 C;  1AOI C;  3AZG B;  1P3I B;  1JFI B;  5F99 D;  5KDM B;  1P3F A;  5B1M A;  3P5J B;  5GSU A;  3B0C W;  2FJ7 A;  4H9O B;  3W99 B;  3WAA A;  3MGP A;  2YFW A;  5E5A B;  3AV2 B;  2PYO B;  1M18 C;  3AZH C;  3REJ C;  3W97 D;  5DNN A;  5AV6 D;  4KUD D;  1P3A C;  3AZK D;  5B31 D;  3AZE A;  4XZQ C;  1AOI D;  1KX5 A;  2CV5 A;  1P3B A;  2Y2N A;  3AV1 C;  4ZBJ B;  5F99 B;  3B0D C;  4DQY B;  4ZUX C;  2FFF B;  2F2A C;  3MGQ A;  4J8X D;  1ZLA C;  5AV9 C;  3WTP A;  3REJ D;  2BYM A;  3X1U C;  3W97 B;  5AV6 B;  4WU8 B;  4J8W B;  3AZN C;  4XUJ D;  4KUD B;  1P3A D;  3A1I A;  3AZK B;  4XZQ D;  5B31 B;  3NQJ A;  5B2J A;  1AOI B;  1F66 A;  3AV1 D;  5B0Z C;  2NQB A;  4KGC A;  5AV5 A;  5AY8 A;  4DRA A;  4WU9 C;  4ZUX D;  2F8N A;  4H9R B;  1BH9 B;  1ZLA D;  2HIO C;  3LJA D;  3C1C A;  3AZJ C;  3AZM A;  1M18 B;  3AZH B;  2F8N K;  3W96 C;  3VH6 A;  3X1U D;  3AZN D;  3REL A;  4KGC B;  1P3A B;  4H9Q A;  4CAY A;  3EG5 B;  2F8N B;  4LD9 A;  4XZQ B;  5B0Z D;  5AVB A;  3AV1 B;  3WKJ A;  1A7W A;  3REH C;  3B0D B;  1P3O C;  2HIO D;  1ZLA B;  3AZJ D;  3AL0 C;  3W96 D;  5AV9 B;  5BNV A;  4WU9 A;  4Z66 A;  3X1U B;  3UT9 D;  3TU4 A;  3AZN B;  5B33 C;  4KHA B;  5B0Z B;  4WU9 B;  2DF4 C;  4E45 A;  3REH D;  5B1L A;  3EPL A;  2Y2I A;  5AV8 C;  3KFU G;  1Z2C B;  5CPJ C;  2HIO B;  3C1B D;  5CPI C;  3MGS A;  3AZJ B;  3X1S C;  3W96 B;  1P34 C;  4JJN A;  1P3G C;  1HTA A;  3KUY A;  4R8P A;  3W98 D;  1KX4 C;  5B32 A;  2NZD A;  3MVD A;  3REH B;  1P3O B;  5B33 A;  2YFV B;  5AV8 D;  2Y2K A;  3KUY B;  4X23 C;  5CPJ D;  4NE6 A;  3IP4 C;  4J8V A;  1M19 C;  5CPI D;  4YM6 C;  3X1S D;  1P34 D;  1HQ3 C;  1P3G D;  5CP6 A;  3LEL A;  2JSS A;  5BNX A;  5B33 B;  1KX4 D;  3UTA A;  1H3O B;  5JRG A;  3AYW A;  4QLC D;  4H9S A;  1EQZ C;  1P3K D;  5AV8 B;  4X23 D;  1JFI A;  4WNN A;  5CPJ B;  1M19 D;  3EPH A;  3X1S B;  3AZF C;  1HQ3 D;  1P34 B;  4CSR A;  2JE5 A;  5KDM A;  5GT3 A;  1P3G B;  3AYW B;  3R45 B;  2RIQ A;  3X1V C;  4H9O A;  2ZM5 A;  3W99 A;  5FUG B;  5E5A A;  3AV2 A;  2PYO A;  4Z5T C;  5BO0 B;  1KX4 B;  4WNN B;  3REK C;  1EQZ D;  4M6B A;  1P3L D;  3WA9 D;  1BFM A;  4CSR B;  1ID3 C;  5GT3 B;  5C3I C;  5GT0 D;  4X23 B;  2JCH A;  3V9R B;  1M19 B;  2W8S A;  4J8X C;  4YM6 B;  2Y2O A;  3AZF D;  1HQ3 B;  5F99 A;  3KWQ C;  3X1V D;  4XUJ C;  4Z5T D;  3B0B A;  5GXQ C;  2BG1 A;  1P3F D;  5B1M D;  3W97 A;  5B2I C;  3REK D;  5AV6 A;  4WU8 A;  4J8W A;  2FJ7 D;  3WAA D;  4KUD A;  3MGP D;  1ID3 D;  1EQZ B;  3A6N C;  3AZK A;  5B31 A;  2Y2Q A;  1AOI A;  5DNN D;  4Z2M H;  3LJA C;  3B6F C;  5DNM C;  3KWQ D;  2ZY4 A;  4H9R A;  3MNN C;  1TZY C;  3AFA C;  1BH9 A;  3X1V B;  1P3B D;  5GXQ D;  4Z5T B;  3AZL C;  3AZH A;  1M18 A;  3REJ A;  4H9N B;  5B2I D;  3A6N D;  1P3A A;  5JA4 A;  1ID3 B;  4WV4 B;  1Q9C A;  1P3M C;  4XZQ A;  5C3I B;  2BYK B;  2ARO C;  3AV1 A;  3VH5 T;  4J8X B;  3UTB C;  3B6F D;  1KX3 C;  3REJ B;  5DNM D;  2F8N G;  3UT9 C;  1R4V A;  4ZUX A;  5B2J D;  3MNN D;  1TZY D;  3AFA D;  1F66 D;  3O62 C;  5BS7 C;  3X1T C;  3REI C;  4XUJ B;  1ZLA A;  5JA4 B;  1N1J B;  1TAF A;  2L5A A;  5AV5 D;  5GXQ B;  5B0Y C;  5AV9 A;  3LJA A;  3AZL D;  3B6G C;  3X1U A;  3EPK A;  5B2I B;  4E44 A;  3AZN A;  1KU5 A;  3A6N B;  1P3M D;  4ZUX B;  4J8U C;  2ARO D;  4KHA A;  5B0Z A;  3AZI C;  3C1B C;  2RVQ C;  3UTB D;  1TAF B;  3LJA B;  1KX3 D;  3B6F B;  4YS3 C;  5DNM B;  2Y2M A;  3X1T D;  3O62 D;  3AFA B;  3REI D;  1M1A C;  2HIO A;  3LZ1 C;  5B0Y D;  3AZJ A;  3B6G D;  3W98 C;  3AZL B;  3W96 A;  3UT9 A;  2LY8 A;  1P3M B;  4J8U D;  3H0L C;  3MGR C;  5B40 C;  2ARO B;  3AZI D;  2RVQ D;  2Y2H A;  1KX3 B;  4YS3 D;  3REH A;  1P3O A;  3UT9 B;  1F1E A;  2YFV A;  5AVC C;  3AN2 C;  1M1A D;  3O62 B;  3LZ1 D;  3X1T B;  3REI B;  4G92 C;  1WWS A;  3C1B A;  1WWI A;  5B24 C;  5B0Y B;  3B6G B;  5B1L D;  3KXB C;  3LZ0 C;  1P3P C;  4QLC C;  1B67 A;  1P3K C;  1W2E A;  4NE3 A;  4J8U B;  5B32 G;  5B40 D;  3MGR D;  1S32 C;  4NFT A;  3FDD A;  1H3O A;  3C1B B;  3AZI B;  3EPJ A;  5G49 A;  4YS3 B;  3AN2 D;  5AVC D;  4H9P B;  5AV8 A;  1M1A B;  5CPJ A;  3LZ1 B;  5CPK C;  5B24 D;  5CPI A;  3W98 B;  3X1S A;  4WZS B;  1P34 A;  3KXB D;  3LZ0 D;  1P3G A;  3R45 A;  1P3P D;  5G49 B;  4J8V D;  3AZG C;  5FUG A;  1P3L C;  3WA9 C;  5BO0 A;  3NQU B;  1KX4 A;  1S32 D;  5GT0 C;  5B40 B;  3MGR B;  1U35 C;  5CPI B;  4QLC A;  3AN2 B;  5AVC B;  3UTA D;  4X23 A;  3V9R A;  5CPK D;  5JRG D;  4G92 B;  1M19 A;  4YM6 A;  5B24 B;  1HQ3 A;  1P3F C;  5B1M C;  3KXB B;  3LZ0 B;  5GSU C;  3AZG D;  1P3I D;  4QLC B;  3WAA C;  2FJ7 C;  3MGP C;  1P3K B;  1S32 B;  2DQN C;  1U35 D;  4G91 C;  4UUZ B;  5DNN C;  3W99 D;  1EQZ A;  2ZY2 A;  2Y2L A;  3AV2 D;  2PYO D;  3AZE C;  1KX5 C;  2CV5 C;  1P3B C;  5CHL B;  5CPK B;  3AZF A;  5GSU D;  3X1V A;  3MGQ C;  1P3L B;  2XD5 A;  2IO5 C;  3WA9 B;  5BT1 C;  4Z5T A;  3WTP C;  5GT0 B;  2Y2G A;  4H9N A;  1U35 B;  2CWE A;  3VH5 W;  3REK A;  3AZF B;  1ID3 A;  3VH6 T;  3AZE D;  5B31 G;  1KX5 D;  2CV5 D;  5B2J C;  1F66 C;  2BYK A;  4HGA C;  4J8X A;  4AWL C;  4WU8 D;  4J8W D;  2NQB C;  4KGC C;  5AV5 C;  5AY8 C;  1P3F B;  5B1M B;  4NE5 A;  1B6W A;  5GSU B;  3KWQ A;  3REK B;  2FJ7 B;  3MGQ D;  3WAA B;  4XUJ A;  3MGP B;  5BT1 D;  1T3U A;  2YFW B;  1N1J A;  3C1C C;  3AZM C;  5GXQ A;  3WTP D;  4G91 B;  5B2I A;  5DNN B;  3B0C T;  4EO5 C;  3REL C;  3KSY A;  3A6N A;  1M18 D;  2G5H C;  2HUE C;  3AZE B;  3AZH D;  4LD9 C;  1KX5 B;  3KWQ B;  2CV5 B;  1P3B B;  5AVB C;  2NQB D;  3WKJ C;  3B6F A;  4KGC D;  5AY8 D;  1PZR A;  2F8N D;  5DNM A;  3MNN A;  1TZY A;  3AFA A;  3MGQ B;  3C1C D;  2IO5 B;  3AZM D;  3AZL A;  3WTP B;  2BYM B;  4Z66 C;  3TU4 C;  3REL D;  1BH8 A;  2G5I C;  4LD9 D;  1P3M A;  5AV9 D;  3NQJ B;  5B2J B;  3MNN B;  1TZY B;  4HGA B;  4UPK A;  5AVB D;  2ARO A;  1F66 B;  4AWL B;  3WKJ D;  3UTB A;  2NQB B;  1KX3 A;  2J8P A;  5AV5 B;  5AY8 B;  3A1K A;  5B1L C;  2VQR A;  3WTP E;  1BH8 B;  3O62 A;  2ZY3 A;  5BS7 A;  3REI A;  3X1T A;  3C1C B;  3MGS C;  3AZM B;  5B0Y A;  3B6G A;  4WU9 D;  4Z66 D;  3TU4 D;  4JJN C;  3KUY C;  3UTB B;  4EO5 B;  3REL B;  3VH5 A;  4H9Q B;  4R8P C;  2HUE B;  4CAY B;  4LD9 B;  4J8U A;  5B32 C;  2NZD C;  5AVB B;  3AZI A;  3WKJ B;  4Z2M G;  3MVD C;  4YS3 A;  4H9P A;  1M1A A;  3LZ1 A;  4J8V C;  2Y2J A;  3MGS D;  3W98 A;  5BNV B;  4Z66 B;  1P3O D;  4JJN D;  3TU4 B;  5CP6 C;  3F6T A;  3KUY D;  3LEL C;  4R8P D;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...