4KGCC

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcC00
3KUYA 1ZLAD 4J8XA 3MGSB 1HQ3C 2YFWA 3LZ0A 1KX3A 3W98C 5CPJA 1P3MC 4LD9A 5B24A 3X1TA 1U35B 3KSYA 2BYMB 3R45B 3UT9B 3AZGD 4R8PA 5B31A 4J8WC 1P3LC 5B1LD 4CAYA 3AZEC 1S32D 1KX4C 3AFAB 4E45A 1BH9A 5CP6A 3MNND 4HGAB 3RELD 3LELC 3NQJA 3A6NA 3C1CB 5B0ZC 1N1JA 1TZYC 3AZLA 3B0DB 3KWQC 3REJD 1P3FB 3O62C 1M18A 3W96C 1AOIC 2PYOB 2HIOD 2AROA 5GXQC 5CPKB 3REKD 1ZLAA 3MGQA 4YS3D 1P3OB 3AZKB 3WA9B 4XZQD 4NE6A 3REID 4YM6B 3AZHA 1P34C 5DNNB 3AZFC 3AZGA 4KGCB 2CV5C 5GT0D 5F99B 4JJNC 4WU8D 1S32A 4H9RB 2F8NB 1P3IC 3X1UD 5AV5D 3KXBC 5BNVB 5AVBC 4AWLC 1P3PB 4EO5C 3X1SC 4WU9D 1TAFA 5AV8B 3WKJB 3VH6A 3RELA 3AZNC 5B1MB 3AZID 1EQZD 3C1BC 2BYKA 2RVQC 3VH6T 4KUDD 5GT3D 3REJA 1WWSA 4ZBJB 1ID3C 2HIOA 5GSUB 4Z2MH 1M19A 1P3KD 3AZMC 5AV9D 3MGSC 3REKA 3KUYB 3W98B 4YS3A 3W97A 5BT1D 4XZQA 2FJ7D 5KDMA 3UT9C 3WTPD 5B24B 3B6FD 4J8WB 4M6BA 5JRGD 5B2ID 4H9OA 3UTBD 3AYWC 3AV1D 5AV6C 5GT0A 4WU8A 1H3OA 3NQUA 4HGAC 4XUJD 5E5AD 1BH9B 4H9QA 4WU9A 1TZYB 4Z5TD 3C1CC 1P3BD 1BH8B 3O62B 1JFIB 1P3FC 5BO0A 4ZUXD 3A6NB 4J8UB 1EQZA 1N1JB 3AZLB 3LJAB 4J8XD 5GT3A 2NQBD 5CPKC 1M18B 3LZ0D 3AZIC 1KX3D 4LD9D 1P3OC 3WA9C 1P3KA 5BS7C 5AVCA 5AV9A 1ZLAB 3TU4A 5B0YD 3AZFB 2FJ7A 4E44A 1P3GD 4G91C 2NZDC 3WTPA 4J8VA 4JJNB 2F8NG 3WAAD 4NFTA 5B2IA 3KXBB 3UTBA 3W99C 5AVBB 4AWLB 3X1SB 4H9PB 3AV1A 1P3PC 5B1LB 3UTAD 1S32B 4XUJA 3B6GD 4Z5TA 3MNNB 3C1BB 5B40A 5C3IB 1A7WA 3B0CW 1P3BA 3RELB 3X1VC 4ZUXA 4UUZA 1F66A 3MGQD 3REHA 1ID3B 4H9NB 4ZBJC 3AZMB 2NQBA 5GSUC 3AN2C 5G49A 5B2JD 3MGPA 3KUYC 4KHAB 5DNMD 3AZHD 4YS3B 4Z66D 5B0YA 2HUEB 5CPJC 5B24C 3X1TC 1P3GA 3REIB 5AY8D 3B0BA 5B31G 3AYWB 4R8PC 5AV6B 1P3AD 5B31C 3WAAA 3LZ1D 1P3MA 3MGRD 5CP6C 3UTAA 3X1UB 5AV5B 4WU9B 1P3LA 1WWIA 3AV2D 3A6NC 4J8UC 3B6GA 1KX5D 3AZLC 5B32D 4WNNB 3LJAC 1M19D 3AZIB 1EQZB 1M18C 3W97D 4KUDB 5GT3B 2AROC 5B2JA 5JA4B 3LELA 3B0CT 1ZLAC 5B33D 5DNMA 4DRAA 3V9RB 1P3KB 5AV9B 4G91B 2NZDB 4Z66A 3W96A 1AOIA 4X23A 2FJ7B 5BNXB 5GXQA 5FUGA 5AY8A 3AZGC 5CPID 4CSRA 3W99B 3B6FB 1M1AD 5JRGB 1P3AA 1U35D 5B1LC 3LZ1A 1BFMA 5B2IB 1S32C 3UTBB 3MGRA 3AV1B 3MNNC 5C3IC 5E5AB 3X1VB 3RELC 3AFAD 4QLCD 4H9SA 3AV2A 1KX5A 1P3BB 5B32A 3AN2B 1P3IA 3REJC 4ZUXB 5AVCD 3MVDD 3TU4D 4J8XB 2HIOC 1KU5A 1M19C 2YFWB 3LZ0B 3REKC 1KX3B 5CPJB 5B33A 4YS3C 4LD9B 3X1TB 2PYOD 2HUEC 4J8VD 4XZQC 3REIC 4R8PB 3AZKD 5B31B 1P3GB 4CAYB 5CPIA 4WV4B 2F8NH 4YM6D 5CP6B 1M1AA 4NE3A 5GT0C 3WAAB 1U35A 5B40D 3R45A 4WU8C 4KGCD 3X1UC 5AV5C 3NQJB 1F66D 4WU9C 5F99D 3REHD 2YFVA 3AFAA 3B6GB 4QLCA 3MGPD 1EQZC 5AV8D 3WKJD 2AROB 4KUDC 5GT3C 3MVDA 3MGQB 5B1MD 3C1CA 3AZJD 1P3KC 1P3FA 5AV9C 5DNMB 3AZHB 5BT1C 2PYOA 2FJ7C 3AZGB 5CPKA 1HQ3D 3W98D 1P3MD 3WTPC 3B6FC 3AZKA 4J8VC 5JRGC 5B2IC 4YM6A 3UTBC 5DNNA 3AV1C 1P3LD 1TAFB 4J8WD 3AZED 4XUJC 3MGRB 1KX4D 4KGCA 5E5AC 4Z5TC 5F99A 2BYKB 1P3BC 4H9RA 3REJB 2F8NA 1P3PA 5BNVA 3LELD 4ZUXC 5B0ZD 1KX5B 1TZYD 5AV8A 2HIOB 5B32B 3WKJA 3KWQD 1M19B 4J8XC 2NQBC 3O62D 3REKB 5B1MA 3LZ0C 1KX3C 3W97B 3W96D 1AOID 4LD9C 4XZQB 4X23D 3AZJA 5GXQD 5KDMB 5B0YC 5GSUA 1R4VA 1HQ3A 1P3GC 3W98A 4H9OB 1P34D 5GT0B 3AZFD 4WU8B 3WAAC 1H3OB 3NQUB 5CPIB 1M1AB 4H9QB 2CV5D 4J8WA 3UTAC 4JJND 3AZEA 1KX4A 1P3ID 3KXBD 5AVBD 5BO0B 3X1SD 3B6GC 3AZND 2YFVB 3VH6W 4QLCB 4WZSB 5B0ZA 1TZYA 3MGQC 3C1BD 2RVQD 3KWQA 1BH8A 3O62A 5AVCB 3MVDB 3TU4B 5B2JC 1JFIA 4J8UA 1ID3D 5DNMC 3AZHC 3LJAA 4G92B 3AZMD 3MGSD 3WTPB 4Z66C 4J8VB 4X23C 3WTPE 3UT9D 5AY8C 1P34A 3AZFA 1P3AC 4XUJB 3LZ1C 1B67A 3AYWD 3MGRC 5AV6D 2CV5A 4Z5TB 5B40B 4JJNA 2JSSA 1ULYA 3KXBA 5AVBA 3X1SA 4H9PA 4UUZB 5B32G 1F66B 3REHB 4H9SC 5B1LA 3C1CD 3AV2C 1KX5C 2NQBB 5B32C 2IO5B 3AZNA 5G49B 1P3FD 3MGPB 3MNNA 2LY8A 3C1BA 3W97C 5CPKD 5B0YB 5B33C 1ID3A 4H9NA 1P3OD 3AZJB 3WA9D 3AZMA 1B6WA 3MGSA 2F8NK 4KHAA 5DNND 1HQ3B 2BYMA 3VH5W 3UT9A 1P3MB 5CPIC 2NZDD 1M1AC 3UTAB 1U35C 3REIA 3AYWA 3W99D 2F8ND 5AV6A 1P3LB 1HTAA 1P3PD 3AZEB 1KX4B 4NE5A 3AFAC 4QLCC 3AN2A 1F1EA 3X1UA 5AV5A 5B2JB 3LELB 3X1VD 5AVCC 3MVDC 5B0ZB 3TU4C 3KWQB 3B0DC 5GSUD 4WNNA 3AN2D 4G92C 3AZIA 4Z66B 3KUYD 3W96B 2L5AA 4Z2MG 1AOIB 4X23B 1P3OA 2PYOC 5GXQB 3WA9A 4KUDA 5BS7A 5FUGB 5AY8B 4CSRB 5JA4A 5CPJD 4DRBA 5B24D 3X1TD 3V9RA 3AZKC 1P3AB 3LZ1B 1Q9CA 2NZDA 1P34B 4R8PD 3VH5A 4YM6C 5DNNC 5BNXA 5B31D 5B40C 5CHLB 3W99A 3B6FA 2CV5B 4KGCC 3VH5T 5CP6D 3AV2B 5JRGA 1F66C 5F99C 3REHC 1P3IB 2IO5C 4EO5B 3A6ND 4J8UD 3MGPC 2CWEA 5AV8C 3AZLD 3WKJC 3AZNB 3LJAD 5E5AA 3X1VA 1M18D 5B33B 5B1MC 2AROD 3AZJC
chains in the Genus database with same CATH superfamily
3KUYA 1ZLAD 4J8XA 3MGSB 2JCHA 1HQ3C 2YFWA 3LZ0A 1KX3A 3W98C 5CPJA 1P3MC 4LD9A 5B24A 3X1TA 1U35B 3KSYA 2BYMB 3R45B 3UT9B 3AZGD 4R8PA 3AL0C 5B31A 4J8WC 1P3LC 5B1LD 4CAYA 3AZEC 1S32D 1KX4C 2G5HC 3AFAB 4E45A 1BH9A 5CP6A 3MNND 4HGAB 3RELD 3LELC 3NQJA 3A6NA 3C1CB 5B0ZC 1N1JA 1TZYC 3AZLA 3B0DB 3KWQC 3REJD 1P3FB 3O62C 1M18A 3W96C 1AOIC 1Z2CB 2PYOB 2HIOD 2AROA 5GXQC 3A1KA 5CPKB 3REKD 1ZLAA 3MGQA 4YS3D 1P3OB 3AZKB 3WA9B 4XZQD 2ZM5A 4NE6A 3REID 4YM6B 3AZHA 1P34C 5DNNB 3AZFC 3AZGA 4KGCB 2CV5C 5GT0D 5F99B 3F6TA 4JJNC 4WU8D 1S32A 4H9RB 2F8NB 1P3IC 3X1UD 5AV5D 3KXBC 5BNVB 5AVBC 2ZY2A 4AWLC 4EO5C 3X1SC 1P3PB 2Y2MA 1TAFA 5AV8B 4WU9D 3WKJB 3VH6A 3RELA 3AZNC 5B1MB 3AZID 1EQZD 3C1BC 2BYKA 2RVQC 3VH6T 2G5IC 5GT3D 3REJA 4KUDD 1WWSA 4ZBJB 1ID3C 2HIOA 1W2EA 5GSUB 4Z2MH 1M19A 1P3KD 3AZMC 5AV9D 3MGSC 3REKA 3KUYB 3W98B 4YS3A 3W97A 5BT1D 4XZQA 2FJ7D 5KDMA 3UT9C 3WTPD 5B24B 3B6FD 4J8WB 4M6BA 5JRGD 2Y2NA 5B2ID 4H9OA 3UTBD 3AYWC 3AV1D 5AV6C 5GT0A 4WU8A 1H3OA 3NQUA 2F2AC 4HGAC 4XUJD 5E5AD 1BH9B 4H9QA 4WU9A 1TZYB 4Z5TD 3C1CC 1P3BD 1BH8B 3O62B 1JFIB 1P3FC 5BO0A 4ZUXD 2XD1A 3A6NB 3H0MC 4J8UB 1N1JB 1EQZA 3AZLB 3LJAB 4J8XD 5GT3A 2NQBD 2Y2GA 5CPKC 1M18B 3LZ0D 3AZIC 1KX3D 4LD9D 1P3OC 3WA9C 1P3KA 5BS7C 5AVCA 5AV9A 1ZLAB 3TU4A 3EG5B 5B0YD 3AZFB 2FJ7A 3IP4C 4E44A 1P3GD 4G91C 2NZDC 2XD5A 3WTPA 4J8VA 4JJNB 2F8NG 3WAAD 4NFTA 5B2IA 2Y2HA 3KXBB 3UTBA 3W99C 5AVBB 4AWLB 3X1SB 4H9PB 3AV1A 1P3PC 5B1LB 2Y2IA 3UTAD 2W8SA 1S32B 4XUJA 3B6GD 4Z5TA 3MNNB 3C1BB 5B40A 5C3IB 1A7WA 3B0CW 1P3BA 3RELB 3X1VC 4ZUXA 4UUZA 1F66A 3MGQD 3REHA 1ID3B 4H9NB 4ZBJC 3AZMB 2NQBA 5GSUC 3AN2C 5G49A 5B2JD 3MGPA 3KUYC 4KHAB 5DNMD 3AZHD 4YS3B 4Z66D 5B0YA 2BG1A 2HUEB 5CPJC 5B24C 3X1TC 1P3GA 3REIB 5AY8D 3B0BA 5B31G 3AYWB 4R8PC 5AV6B 1P3AD 5B31C 3WAAA 3LZ1D 3KFUG 1P3MA 3MGRD 5CP6C 3UTAA 3X1UB 5AV5B 4WU9B 1P3LA 1WWIA 3AV2D 3A6NC 4J8UC 3B6GA 1KX5D 3AZLC 5B32D 4WNNB 3LJAC 1M19D 3AZIB 1EQZB 1M18C 3W97D 4KUDB 5GT3B 2AROC 5B2JA 5JA4B 3LELA 3B0CT 1ZLAC 5B33D 5DNMA 4DRAA 3V9RB 1P3KB 5AV9B 4G91B 2NZDB 4Z66A 3W96A 1AOIA 4X23A 2FJ7B 5BNXB 5GXQA 5FUGA 5AY8A 3AZGC 5CPID 4CSRA 3W99B 3B6FB 1M1AD 5JRGB 2RIQA 1P3AA 1U35D 5B1LC 3LZ1A 1BFMA 5B2IB 1S32C 3UTBB 3MGRA 3AV1B 3MNNC 5C3IC 2DF4C 5E5AB 3X1VB 3RELC 3AFAD 4QLCD 4H9SA 3AV2A 1KX5A 1P3BB 5B32A 3AN2B 1P3IA 2VQRA 3REJC 4ZUXB 5AVCD 3MVDD 3TU4D 4J8XB 2HIOC 1KU5A 1M19C 2YFWB 3LZ0B 3REKC 1KX3B 5CPJB 5B33A 4YS3C 4LD9B 3X1TB 2PYOD 2HUEC 4J8VD 4XZQC 3REIC 4R8PB 2ZY3A 3AZKD 5B31B 1P3GB 4CAYB 5CPIA 4WV4B 2F8NH 4YM6D 5CP6B 1M1AA 4NE3A 5GT0C 3WAAB 1U35A 5B40D 3R45A 4WU8C 4KGCD 3X1UC 5AV5C 3NQJB 1F66D 4WU9C 5F99D 3REHD 2YFVA 3AFAA 3B6GB 4QLCA 3MGPD 1EQZC 5AV8D 3WKJD 2AROB 4KUDC 1PZRA 5GT3C 3MVDA 3MGQB 5B1MD 3C1CA 3AZJD 1P3KC 1P3FA 5AV9C 5DNMB 3AZHB 5BT1C 2PYOA 2FJ7C 3AZGB 5CPKA 1HQ3D 3W98D 1P3MD 3WTPC 3B6FC 3AZKA 4J8VC 5JRGC 5B2IC 4YM6A 3UTBC 5DNNA 3AV1C 1P3LD 1TAFB 4J8WD 2Y2PA 3A1IA 3AZED 4XUJC 3MGRB 1KX4D 4KGCA 5E5AC 2Y2KA 4Z5TC 5F99A 2DQNC 2BYKB 1P3BC 4H9RA 3REJB 2Y2QA 2F8NA 1P3PA 5BNVA 3LELD 4ZUXC 5B0ZD 1KX5B 1TZYD 5AV8A 2HIOB 5B32B 3WKJA 3KWQD 1M19B 4J8XC 2NQBC 3O62D 3REKB 5B1MA 3LZ0C 1KX3C 3W97B 3W96D 1AOID 4LD9C 4XZQB 4X23D 3AZJA 5GXQD 5KDMB 4UPKA 5B0YC 5GSUA 1R4VA 1HQ3A 2FFFB 1P3GC 3W98A 4H9OB 1P34D 5GT0B 3AZFD 4WU8B 3WAAC 1H3OB 3NQUB 5CPIB 1M1AB 4H9QB 2Y2OA 4J8WA 2CV5D 3UTAC 4JJND 3AZEA 1KX4A 1T3UA 1P3ID 3KXBD 5AVBD 5BO0B 3X1SD 3B6GC 3AZND 2YFVB 3VH6W 4WZSB 4QLCB 5B0ZA 1TZYA 3MGQC 3C1BD 2J8PA 2RVQD 3KWQA 1BH8A 3O62A 5AVCB 3MVDB 3TU4B 5B2JC 1JFIA 4J8UA 1ID3D 5DNMC 3AZHC 3LJAA 4G92B 3AZMD 3MGSD 3WTPB 4Z66C 4J8VB 4X23C 4WJ3C 3WTPE 3UT9D 5AY8C 1P34A 3AZFA 1P3AC 4XUJB 3LZ1C 2JE5A 1B67A 3AYWD 3MGRC 4DQYB 5AV6D 2CV5A 4Z5TB 5B40B 4JJNA 2JSSA 1ULYA 3P5JB 3KXBA 5AVBA 3X1SA 4H9PA 4UUZB 5B32G 1F66B 3REHB 4H9SC 5B1LA 3C1CD 3AV2C 1KX5C 2Y2LA 2NQBB 5B32C 2IO5B 3AZNA 3EPHA 5G49B 1P3FD 3MGPB 3MNNA 2LY8A 3C1BA 3W97C 3H0RC 5CPKD 5B0YB 5B33C 1ID3A 4H9NA 1P3OD 3AZJB 3WA9D 3AZMA 1B6WA 3MGSA 2F8NK 4KHAA 5DNND 1HQ3B 2BYMA 3VH5W 3UT9A 1P3MB 5CPIC 2NZDD 2Y2JA 1M1AC 3UTAB 2ZY5A 1U35C 3REIA 3EPLA 3H0LC 3AYWA 3W99D 2F8ND 5AV6A 1P3LB 1HTAA 1P3PD 3AZEB 1KX4B 4NE5A 3FDDA 3AFAC 4QLCC 3AN2A 1F1EA 3X1UA 2ZY4A 5AV5A 5B2JB 3LELB 3X1VD 5AVCC 3MVDC 5B0ZB 3TU4C 3KWQB 3B0DC 5GSUD 4WNNA 3AN2D 2UWXA 4G92C 3AZIA 4Z66B 3KUYD 3W96B 2L5AA 4Z2MG 1AOIB 4X23B 1P3OA 2PYOC 5GXQB 3WA9A 4KUDA 5BS7A 5FUGB 5AY8B 4CSRB 5JA4A 5CPJD 4DRBA 5B24D 3X1TD 3V9RA 3AZKC 1P3AB 3LZ1B 1Q9CA 2NZDA 1P34B 4R8PD 3VH5A 4YM6C 5DNNC 5BNXA 5B31D 5B40C 5CHLB 3W99A 3B6FA 2CV5B 4KGCC 3VH5T 5CP6D 3EPJA 3AV2B 5JRGA 1F66C 5F99C 3REHC 1P3IB 2IO5C 4EO5B 3A6ND 4J8UD 3MGPC 2CWEA 5AV8C 3AZLD 3WKJC 3AZNB 3LJAD 5E5AA 3X1VA 1M18D 5B33B 5B1MC 2AROD 3AZJC 3EPKA
chains in the Genus database with same CATH topology
3KUYA 1ZLAD 4J8XA 3MGSB 2JCHA 1HQ3C 2YFWA 3LZ0A 1KX3A 3W98C 5CPJA 1P3MC 4LD9A 5B24A 3X1TA 1U35B 3KSYA 2BYMB 3R45B 3UT9B 3AZGD 4R8PA 3AL0C 5B31A 4J8WC 1P3LC 5B1LD 4CAYA 3AZEC 1S32D 1KX4C 2G5HC 3AFAB 4E45A 1BH9A 5CP6A 3MNND 4HGAB 3RELD 3LELC 3NQJA 3A6NA 3C1CB 5B0ZC 1N1JA 1TZYC 3AZLA 3B0DB 3KWQC 3REJD 1P3FB 3O62C 1M18A 3W96C 1AOIC 1Z2CB 2PYOB 2HIOD 2AROA 5GXQC 3A1KA 5CPKB 3REKD 1ZLAA 3MGQA 4YS3D 1P3OB 3AZKB 3WA9B 4XZQD 2ZM5A 4NE6A 3REID 4YM6B 3AZHA 1P34C 5DNNB 3AZFC 3AZGA 4KGCB 2CV5C 5GT0D 5F99B 3F6TA 4JJNC 4WU8D 1S32A 4H9RB 2F8NB 1P3IC 3X1UD 5AV5D 3KXBC 5BNVB 5AVBC 2ZY2A 4AWLC 4EO5C 3X1SC 1P3PB 2Y2MA 1TAFA 5AV8B 4WU9D 3WKJB 3VH6A 3RELA 3AZNC 5B1MB 3AZID 1EQZD 3C1BC 2BYKA 2RVQC 3VH6T 2G5IC 5GT3D 3REJA 4KUDD 1WWSA 4ZBJB 1ID3C 2HIOA 1W2EA 5GSUB 4Z2MH 1M19A 1P3KD 3AZMC 5AV9D 3MGSC 3REKA 3KUYB 3W98B 4YS3A 3W97A 5BT1D 4XZQA 2FJ7D 5KDMA 3UT9C 3WTPD 5B24B 3B6FD 4J8WB 4M6BA 5JRGD 2Y2NA 5B2ID 4H9OA 3UTBD 3AYWC 3AV1D 5AV6C 5GT0A 4WU8A 1H3OA 3NQUA 2F2AC 4HGAC 4XUJD 5E5AD 1BH9B 4H9QA 4WU9A 1TZYB 4Z5TD 3C1CC 1P3BD 1BH8B 3O62B 1JFIB 1P3FC 5BO0A 4ZUXD 2XD1A 3A6NB 3H0MC 4J8UB 1N1JB 1EQZA 3AZLB 3LJAB 4J8XD 5GT3A 2NQBD 2Y2GA 5CPKC 1M18B 3LZ0D 3AZIC 1KX3D 4LD9D 1P3OC 3WA9C 1P3KA 5BS7C 5AVCA 5AV9A 1ZLAB 3TU4A 3EG5B 5B0YD 3AZFB 2FJ7A 3IP4C 4E44A 1P3GD 4G91C 2NZDC 2XD5A 3WTPA 4J8VA 4JJNB 2F8NG 3WAAD 4NFTA 5B2IA 2Y2HA 3KXBB 3UTBA 3W99C 5AVBB 4AWLB 3X1SB 4H9PB 3AV1A 1P3PC 5B1LB 2Y2IA 3UTAD 2W8SA 1S32B 4XUJA 3B6GD 4Z5TA 3MNNB 3C1BB 5B40A 5C3IB 1A7WA 3B0CW 1P3BA 3RELB 3X1VC 4ZUXA 4UUZA 1F66A 3MGQD 3REHA 1ID3B 4H9NB 4ZBJC 3AZMB 2NQBA 5GSUC 3AN2C 5G49A 5B2JD 3MGPA 3KUYC 4KHAB 5DNMD 3AZHD 4YS3B 4Z66D 5B0YA 2BG1A 2HUEB 5CPJC 5B24C 3X1TC 1P3GA 3REIB 5AY8D 3B0BA 5B31G 3AYWB 4R8PC 5AV6B 1P3AD 5B31C 3WAAA 3LZ1D 3KFUG 1P3MA 3MGRD 5CP6C 3UTAA 3X1UB 5AV5B 4WU9B 1P3LA 1WWIA 3AV2D 3A6NC 4J8UC 3B6GA 1KX5D 3AZLC 5B32D 4WNNB 3LJAC 1M19D 3AZIB 1EQZB 1M18C 3W97D 4KUDB 5GT3B 2AROC 5B2JA 5JA4B 3LELA 3B0CT 1ZLAC 5B33D 5DNMA 4DRAA 3V9RB 1P3KB 5AV9B 4G91B 2NZDB 4Z66A 3W96A 1AOIA 4X23A 2FJ7B 5BNXB 5GXQA 5FUGA 5AY8A 3AZGC 5CPID 4CSRA 3W99B 3B6FB 1M1AD 5JRGB 2RIQA 1P3AA 1U35D 5B1LC 3LZ1A 1BFMA 5B2IB 1S32C 3UTBB 3MGRA 3AV1B 3MNNC 5C3IC 2DF4C 5E5AB 3X1VB 3RELC 3AFAD 4QLCD 4H9SA 3AV2A 1KX5A 1P3BB 5B32A 3AN2B 1P3IA 2VQRA 3REJC 4ZUXB 5AVCD 3MVDD 3TU4D 4J8XB 2HIOC 1KU5A 1M19C 2YFWB 3LZ0B 3REKC 1KX3B 5CPJB 5B33A 4YS3C 4LD9B 3X1TB 2PYOD 2HUEC 4J8VD 4XZQC 3REIC 4R8PB 2ZY3A 3AZKD 5B31B 1P3GB 4CAYB 5CPIA 4WV4B 2F8NH 4YM6D 5CP6B 1M1AA 4NE3A 5GT0C 3WAAB 1U35A 5B40D 3R45A 4WU8C 4KGCD 3X1UC 5AV5C 3NQJB 1F66D 4WU9C 5F99D 3REHD 2YFVA 3AFAA 3B6GB 4QLCA 3MGPD 1EQZC 5AV8D 3WKJD 2AROB 4KUDC 1PZRA 5GT3C 3MVDA 3MGQB 5B1MD 3C1CA 3AZJD 1P3KC 1P3FA 5AV9C 5DNMB 3AZHB 5BT1C 2PYOA 2FJ7C 3AZGB 5CPKA 1HQ3D 3W98D 1P3MD 3WTPC 3B6FC 3AZKA 4J8VC 5JRGC 5B2IC 4YM6A 3UTBC 5DNNA 3AV1C 1P3LD 1TAFB 4J8WD 2Y2PA 3A1IA 3AZED 4XUJC 3MGRB 1KX4D 4KGCA 5E5AC 2Y2KA 4Z5TC 5F99A 2DQNC 2BYKB 1P3BC 4H9RA 3REJB 2Y2QA 2F8NA 1P3PA 5BNVA 3LELD 4ZUXC 5B0ZD 1KX5B 1TZYD 5AV8A 2HIOB 5B32B 3WKJA 3KWQD 1M19B 4J8XC 2NQBC 3O62D 3REKB 5B1MA 3LZ0C 1KX3C 3W97B 3W96D 1AOID 4LD9C 4XZQB 4X23D 3AZJA 5GXQD 5KDMB 4UPKA 5B0YC 5GSUA 1R4VA 1HQ3A 2FFFB 1P3GC 3W98A 4H9OB 1P34D 5GT0B 3AZFD 4WU8B 3WAAC 1H3OB 3NQUB 5CPIB 1M1AB 4H9QB 2Y2OA 4J8WA 2CV5D 3UTAC 4JJND 3AZEA 1KX4A 1T3UA 1P3ID 3KXBD 5AVBD 5BO0B 3X1SD 3B6GC 3AZND 2YFVB 3VH6W 4WZSB 4QLCB 5B0ZA 1TZYA 3MGQC 3C1BD 2J8PA 2RVQD 3KWQA 1BH8A 3O62A 5AVCB 3MVDB 3TU4B 5B2JC 1JFIA 4J8UA 1ID3D 5DNMC 3AZHC 3LJAA 4G92B 3AZMD 3MGSD 3WTPB 4Z66C 4J8VB 4X23C 4WJ3C 3WTPE 3UT9D 5AY8C 1P34A 3AZFA 1P3AC 4XUJB 3LZ1C 2JE5A 1B67A 3AYWD 3MGRC 4DQYB 5AV6D 2CV5A 4Z5TB 5B40B 4JJNA 2JSSA 1ULYA 3P5JB 3KXBA 5AVBA 3X1SA 4H9PA 4UUZB 5B32G 1F66B 3REHB 4H9SC 5B1LA 3C1CD 3AV2C 1KX5C 2Y2LA 2NQBB 5B32C 2IO5B 3AZNA 3EPHA 5G49B 1P3FD 3MGPB 3MNNA 2LY8A 3C1BA 3W97C 3H0RC 5CPKD 5B0YB 5B33C 1ID3A 4H9NA 1P3OD 3AZJB 3WA9D 3AZMA 1B6WA 3MGSA 2F8NK 4KHAA 5DNND 1HQ3B 2BYMA 3VH5W 3UT9A 1P3MB 5CPIC 2NZDD 2Y2JA 1M1AC 3UTAB 2ZY5A 1U35C 3REIA 3EPLA 3H0LC 3AYWA 3W99D 2F8ND 5AV6A 1P3LB 1HTAA 1P3PD 3AZEB 1KX4B 4NE5A 3FDDA 3AFAC 4QLCC 3AN2A 1F1EA 3X1UA 2ZY4A 5AV5A 5B2JB 3LELB 3X1VD 5AVCC 3MVDC 5B0ZB 3TU4C 3KWQB 3B0DC 5GSUD 4WNNA 3AN2D 2UWXA 4G92C 3AZIA 4Z66B 3KUYD 3W96B 2L5AA 4Z2MG 1AOIB 4X23B 1P3OA 2PYOC 5GXQB 3WA9A 4KUDA 5BS7A 5FUGB 5AY8B 4CSRB 5JA4A 5CPJD 4DRBA 5B24D 3X1TD 3V9RA 3AZKC 1P3AB 3LZ1B 1Q9CA 2NZDA 1P34B 4R8PD 3VH5A 4YM6C 5DNNC 5BNXA 5B31D 5B40C 5CHLB 3W99A 3B6FA 2CV5B 4KGCC 3VH5T 5CP6D 3EPJA 3AV2B 5JRGA 1F66C 5F99C 3REHC 1P3IB 2IO5C 4EO5B 3A6ND 4J8UD 3MGPC 2CWEA 5AV8C 3AZLD 3WKJC 3AZNB 3LJAD 5E5AA 3X1VA 1M18D 5B33B 5B1MC 2AROD 3AZJC 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY A;  1ZLA D;  4J8X A;  3MGS B;  1HQ3 C;  2YFW A;  3LZ0 A;  1KX3 A;  3W98 C;  5CPJ A;  1P3M C;  4LD9 A;  5B24 A;  3X1T A;  1U35 B;  3KSY A;  2BYM B;  3R45 B;  3UT9 B;  3AZG D;  4R8P A;  5B31 A;  4J8W C;  1P3L C;  5B1L D;  4CAY A;  3AZE C;  1S32 D;  1KX4 C;  3AFA B;  4E45 A;  1BH9 A;  5CP6 A;  3MNN D;  4HGA B;  3REL D;  3LEL C;  3NQJ A;  3A6N A;  3C1C B;  5B0Z C;  1N1J A;  1TZY C;  3AZL A;  3B0D B;  3KWQ C;  3REJ D;  1P3F B;  3O62 C;  1M18 A;  3W96 C;  1AOI C;  2PYO B;  2HIO D;  2ARO A;  5GXQ C;  5CPK B;  3REK D;  1ZLA A;  3MGQ A;  4YS3 D;  1P3O B;  3AZK B;  3WA9 B;  4XZQ D;  4NE6 A;  3REI D;  4YM6 B;  3AZH A;  1P34 C;  5DNN B;  3AZF C;  3AZG A;  4KGC B;  2CV5 C;  5GT0 D;  5F99 B;  4JJN C;  4WU8 D;  1S32 A;  4H9R B;  2F8N B;  1P3I C;  3X1U D;  5AV5 D;  3KXB C;  5BNV B;  5AVB C;  4AWL C;  1P3P B;  4EO5 C;  3X1S C;  4WU9 D;  1TAF A;  5AV8 B;  3WKJ B;  3VH6 A;  3REL A;  3AZN C;  5B1M B;  3AZI D;  1EQZ D;  3C1B C;  2BYK A;  2RVQ C;  3VH6 T;  4KUD D;  5GT3 D;  3REJ A;  1WWS A;  4ZBJ B;  1ID3 C;  2HIO A;  5GSU B;  4Z2M H;  1M19 A;  1P3K D;  3AZM C;  5AV9 D;  3MGS C;  3REK A;  3KUY B;  3W98 B;  4YS3 A;  3W97 A;  5BT1 D;  4XZQ A;  2FJ7 D;  5KDM A;  3UT9 C;  3WTP D;  5B24 B;  3B6F D;  4J8W B;  4M6B A;  5JRG D;  5B2I D;  4H9O A;  3UTB D;  3AYW C;  3AV1 D;  5AV6 C;  5GT0 A;  4WU8 A;  1H3O A;  3NQU A;  4HGA C;  4XUJ D;  5E5A D;  1BH9 B;  4H9Q A;  4WU9 A;  1TZY B;  4Z5T D;  3C1C C;  1P3B D;  1BH8 B;  3O62 B;  1JFI B;  1P3F C;  5BO0 A;  4ZUX D;  3A6N B;  4J8U B;  1EQZ A;  1N1J B;  3AZL B;  3LJA B;  4J8X D;  5GT3 A;  2NQB D;  5CPK C;  1M18 B;  3LZ0 D;  3AZI C;  1KX3 D;  4LD9 D;  1P3O C;  3WA9 C;  1P3K A;  5BS7 C;  5AVC A;  5AV9 A;  1ZLA B;  3TU4 A;  5B0Y D;  3AZF B;  2FJ7 A;  4E44 A;  1P3G D;  4G91 C;  2NZD C;  3WTP A;  4J8V A;  4JJN B;  2F8N G;  3WAA D;  4NFT A;  5B2I A;  3KXB B;  3UTB A;  3W99 C;  5AVB B;  4AWL B;  3X1S B;  4H9P B;  3AV1 A;  1P3P C;  5B1L B;  3UTA D;  1S32 B;  4XUJ A;  3B6G D;  4Z5T A;  3MNN B;  3C1B B;  5B40 A;  5C3I B;  1A7W A;  3B0C W;  1P3B A;  3REL B;  3X1V C;  4ZUX A;  4UUZ A;  1F66 A;  3MGQ D;  3REH A;  1ID3 B;  4H9N B;  4ZBJ C;  3AZM B;  2NQB A;  5GSU C;  3AN2 C;  5G49 A;  5B2J D;  3MGP A;  3KUY C;  4KHA B;  5DNM D;  3AZH D;  4YS3 B;  4Z66 D;  5B0Y A;  2HUE B;  5CPJ C;  5B24 C;  3X1T C;  1P3G A;  3REI B;  5AY8 D;  3B0B A;  5B31 G;  3AYW B;  4R8P C;  5AV6 B;  1P3A D;  5B31 C;  3WAA A;  3LZ1 D;  1P3M A;  3MGR D;  5CP6 C;  3UTA A;  3X1U B;  5AV5 B;  4WU9 B;  1P3L A;  1WWI A;  3AV2 D;  3A6N C;  4J8U C;  3B6G A;  1KX5 D;  3AZL C;  5B32 D;  4WNN B;  3LJA C;  1M19 D;  3AZI B;  1EQZ B;  1M18 C;  3W97 D;  4KUD B;  5GT3 B;  2ARO C;  5B2J A;  5JA4 B;  3LEL A;  3B0C T;  1ZLA C;  5B33 D;  5DNM A;  4DRA A;  3V9R B;  1P3K B;  5AV9 B;  4G91 B;  2NZD B;  4Z66 A;  3W96 A;  1AOI A;  4X23 A;  2FJ7 B;  5BNX B;  5GXQ A;  5FUG A;  5AY8 A;  3AZG C;  5CPI D;  4CSR A;  3W99 B;  3B6F B;  1M1A D;  5JRG B;  1P3A A;  1U35 D;  5B1L C;  3LZ1 A;  1BFM A;  5B2I B;  1S32 C;  3UTB B;  3MGR A;  3AV1 B;  3MNN C;  5C3I C;  5E5A B;  3X1V B;  3REL C;  3AFA D;  4QLC D;  4H9S A;  3AV2 A;  1KX5 A;  1P3B B;  5B32 A;  3AN2 B;  1P3I A;  3REJ C;  4ZUX B;  5AVC D;  3MVD D;  3TU4 D;  4J8X B;  2HIO C;  1KU5 A;  1M19 C;  2YFW B;  3LZ0 B;  3REK C;  1KX3 B;  5CPJ B;  5B33 A;  4YS3 C;  4LD9 B;  3X1T B;  2PYO D;  2HUE C;  4J8V D;  4XZQ C;  3REI C;  4R8P B;  3AZK D;  5B31 B;  1P3G B;  4CAY B;  5CPI A;  4WV4 B;  2F8N H;  4YM6 D;  5CP6 B;  1M1A A;  4NE3 A;  5GT0 C;  3WAA B;  1U35 A;  5B40 D;  3R45 A;  4WU8 C;  4KGC D;  3X1U C;  5AV5 C;  3NQJ B;  1F66 D;  4WU9 C;  5F99 D;  3REH D;  2YFV A;  3AFA A;  3B6G B;  4QLC A;  3MGP D;  1EQZ C;  5AV8 D;  3WKJ D;  2ARO B;  4KUD C;  5GT3 C;  3MVD A;  3MGQ B;  5B1M D;  3C1C A;  3AZJ D;  1P3K C;  1P3F A;  5AV9 C;  5DNM B;  3AZH B;  5BT1 C;  2PYO A;  2FJ7 C;  3AZG B;  5CPK A;  1HQ3 D;  3W98 D;  1P3M D;  3WTP C;  3B6F C;  3AZK A;  4J8V C;  5JRG C;  5B2I C;  4YM6 A;  3UTB C;  5DNN A;  3AV1 C;  1P3L D;  1TAF B;  4J8W D;  3AZE D;  4XUJ C;  3MGR B;  1KX4 D;  4KGC A;  5E5A C;  4Z5T C;  5F99 A;  2BYK B;  1P3B C;  4H9R A;  3REJ B;  2F8N A;  1P3P A;  5BNV A;  3LEL D;  4ZUX C;  5B0Z D;  1KX5 B;  1TZY D;  5AV8 A;  2HIO B;  5B32 B;  3WKJ A;  3KWQ D;  1M19 B;  4J8X C;  2NQB C;  3O62 D;  3REK B;  5B1M A;  3LZ0 C;  1KX3 C;  3W97 B;  3W96 D;  1AOI D;  4LD9 C;  4XZQ B;  4X23 D;  3AZJ A;  5GXQ D;  5KDM B;  5B0Y C;  5GSU A;  1R4V A;  1HQ3 A;  1P3G C;  3W98 A;  4H9O B;  1P34 D;  5GT0 B;  3AZF D;  4WU8 B;  3WAA C;  1H3O B;  3NQU B;  5CPI B;  1M1A B;  4H9Q B;  2CV5 D;  4J8W A;  3UTA C;  4JJN D;  3AZE A;  1KX4 A;  1P3I D;  3KXB D;  5AVB D;  5BO0 B;  3X1S D;  3B6G C;  3AZN D;  2YFV B;  3VH6 W;  4QLC B;  4WZS B;  5B0Z A;  1TZY A;  3MGQ C;  3C1B D;  2RVQ D;  3KWQ A;  1BH8 A;  3O62 A;  5AVC B;  3MVD B;  3TU4 B;  5B2J C;  1JFI A;  4J8U A;  1ID3 D;  5DNM C;  3AZH C;  3LJA A;  4G92 B;  3AZM D;  3MGS D;  3WTP B;  4Z66 C;  4J8V B;  4X23 C;  3WTP E;  3UT9 D;  5AY8 C;  1P34 A;  3AZF A;  1P3A C;  4XUJ B;  3LZ1 C;  1B67 A;  3AYW D;  3MGR C;  5AV6 D;  2CV5 A;  4Z5T B;  5B40 B;  4JJN A;  2JSS A;  1ULY A;  3KXB A;  5AVB A;  3X1S A;  4H9P A;  4UUZ B;  5B32 G;  1F66 B;  3REH B;  4H9S C;  5B1L A;  3C1C D;  3AV2 C;  1KX5 C;  2NQB B;  5B32 C;  2IO5 B;  3AZN A;  5G49 B;  1P3F D;  3MGP B;  3MNN A;  2LY8 A;  3C1B A;  3W97 C;  5CPK D;  5B0Y B;  5B33 C;  1ID3 A;  4H9N A;  1P3O D;  3AZJ B;  3WA9 D;  3AZM A;  1B6W A;  3MGS A;  2F8N K;  4KHA A;  5DNN D;  1HQ3 B;  2BYM A;  3VH5 W;  3UT9 A;  1P3M B;  5CPI C;  2NZD D;  1M1A C;  3UTA B;  1U35 C;  3REI A;  3AYW A;  3W99 D;  2F8N D;  5AV6 A;  1P3L B;  1HTA A;  1P3P D;  3AZE B;  1KX4 B;  4NE5 A;  3AFA C;  4QLC C;  3AN2 A;  1F1E A;  3X1U A;  5AV5 A;  5B2J B;  3LEL B;  3X1V D;  5AVC C;  3MVD C;  5B0Z B;  3TU4 C;  3KWQ B;  3B0D C;  5GSU D;  4WNN A;  3AN2 D;  4G92 C;  3AZI A;  4Z66 B;  3KUY D;  3W96 B;  2L5A A;  4Z2M G;  1AOI B;  4X23 B;  1P3O A;  2PYO C;  5GXQ B;  3WA9 A;  4KUD A;  5BS7 A;  5FUG B;  5AY8 B;  4CSR B;  5JA4 A;  5CPJ D;  4DRB A;  5B24 D;  3X1T D;  3V9R A;  3AZK C;  1P3A B;  3LZ1 B;  1Q9C A;  2NZD A;  1P34 B;  4R8P D;  3VH5 A;  4YM6 C;  5DNN C;  5BNX A;  5B31 D;  5B40 C;  5CHL B;  3W99 A;  3B6F A;  2CV5 B;  4KGC C;  3VH5 T;  5CP6 D;  3AV2 B;  5JRG A;  1F66 C;  5F99 C;  3REH C;  1P3I B;  2IO5 C;  4EO5 B;  3A6N D;  4J8U D;  3MGP C;  2CWE A;  5AV8 C;  3AZL D;  3WKJ C;  3AZN B;  3LJA D;  5E5A A;  3X1V A;  1M18 D;  5B33 B;  5B1M C;  2ARO D;  3AZJ C; 
#chains in the Genus database with same CATH topology
 3KUY A;  1ZLA D;  4J8X A;  3MGS B;  2JCH A;  1HQ3 C;  2YFW A;  3LZ0 A;  1KX3 A;  3W98 C;  5CPJ A;  1P3M C;  4LD9 A;  5B24 A;  3X1T A;  1U35 B;  3KSY A;  2BYM B;  3R45 B;  3UT9 B;  3AZG D;  4R8P A;  3AL0 C;  5B31 A;  4J8W C;  1P3L C;  5B1L D;  4CAY A;  3AZE C;  1S32 D;  1KX4 C;  2G5H C;  3AFA B;  4E45 A;  1BH9 A;  5CP6 A;  3MNN D;  4HGA B;  3REL D;  3LEL C;  3NQJ A;  3A6N A;  3C1C B;  5B0Z C;  1N1J A;  1TZY C;  3AZL A;  3B0D B;  3KWQ C;  3REJ D;  1P3F B;  3O62 C;  1M18 A;  3W96 C;  1AOI C;  1Z2C B;  2PYO B;  2HIO D;  2ARO A;  5GXQ C;  3A1K A;  5CPK B;  3REK D;  1ZLA A;  3MGQ A;  4YS3 D;  1P3O B;  3AZK B;  3WA9 B;  4XZQ D;  2ZM5 A;  4NE6 A;  3REI D;  4YM6 B;  3AZH A;  1P34 C;  5DNN B;  3AZF C;  3AZG A;  4KGC B;  2CV5 C;  5GT0 D;  5F99 B;  3F6T A;  4JJN C;  4WU8 D;  1S32 A;  4H9R B;  2F8N B;  1P3I C;  3X1U D;  5AV5 D;  3KXB C;  5BNV B;  5AVB C;  2ZY2 A;  4AWL C;  4EO5 C;  3X1S C;  1P3P B;  2Y2M A;  1TAF A;  5AV8 B;  4WU9 D;  3WKJ B;  3VH6 A;  3REL A;  3AZN C;  5B1M B;  3AZI D;  1EQZ D;  3C1B C;  2BYK A;  2RVQ C;  3VH6 T;  2G5I C;  5GT3 D;  3REJ A;  4KUD D;  1WWS A;  4ZBJ B;  1ID3 C;  2HIO A;  1W2E A;  5GSU B;  4Z2M H;  1M19 A;  1P3K D;  3AZM C;  5AV9 D;  3MGS C;  3REK A;  3KUY B;  3W98 B;  4YS3 A;  3W97 A;  5BT1 D;  4XZQ A;  2FJ7 D;  5KDM A;  3UT9 C;  3WTP D;  5B24 B;  3B6F D;  4J8W B;  4M6B A;  5JRG D;  2Y2N A;  5B2I D;  4H9O A;  3UTB D;  3AYW C;  3AV1 D;  5AV6 C;  5GT0 A;  4WU8 A;  1H3O A;  3NQU A;  2F2A C;  4HGA C;  4XUJ D;  5E5A D;  1BH9 B;  4H9Q A;  4WU9 A;  1TZY B;  4Z5T D;  3C1C C;  1P3B D;  1BH8 B;  3O62 B;  1JFI B;  1P3F C;  5BO0 A;  4ZUX D;  2XD1 A;  3A6N B;  3H0M C;  4J8U B;  1N1J B;  1EQZ A;  3AZL B;  3LJA B;  4J8X D;  5GT3 A;  2NQB D;  2Y2G A;  5CPK C;  1M18 B;  3LZ0 D;  3AZI C;  1KX3 D;  4LD9 D;  1P3O C;  3WA9 C;  1P3K A;  5BS7 C;  5AVC A;  5AV9 A;  1ZLA B;  3TU4 A;  3EG5 B;  5B0Y D;  3AZF B;  2FJ7 A;  3IP4 C;  4E44 A;  1P3G D;  4G91 C;  2NZD C;  2XD5 A;  3WTP A;  4J8V A;  4JJN B;  2F8N G;  3WAA D;  4NFT A;  5B2I A;  2Y2H A;  3KXB B;  3UTB A;  3W99 C;  5AVB B;  4AWL B;  3X1S B;  4H9P B;  3AV1 A;  1P3P C;  5B1L B;  2Y2I A;  3UTA D;  2W8S A;  1S32 B;  4XUJ A;  3B6G D;  4Z5T A;  3MNN B;  3C1B B;  5B40 A;  5C3I B;  1A7W A;  3B0C W;  1P3B A;  3REL B;  3X1V C;  4ZUX A;  4UUZ A;  1F66 A;  3MGQ D;  3REH A;  1ID3 B;  4H9N B;  4ZBJ C;  3AZM B;  2NQB A;  5GSU C;  3AN2 C;  5G49 A;  5B2J D;  3MGP A;  3KUY C;  4KHA B;  5DNM D;  3AZH D;  4YS3 B;  4Z66 D;  5B0Y A;  2BG1 A;  2HUE B;  5CPJ C;  5B24 C;  3X1T C;  1P3G A;  3REI B;  5AY8 D;  3B0B A;  5B31 G;  3AYW B;  4R8P C;  5AV6 B;  1P3A D;  5B31 C;  3WAA A;  3LZ1 D;  3KFU G;  1P3M A;  3MGR D;  5CP6 C;  3UTA A;  3X1U B;  5AV5 B;  4WU9 B;  1P3L A;  1WWI A;  3AV2 D;  3A6N C;  4J8U C;  3B6G A;  1KX5 D;  3AZL C;  5B32 D;  4WNN B;  3LJA C;  1M19 D;  3AZI B;  1EQZ B;  1M18 C;  3W97 D;  4KUD B;  5GT3 B;  2ARO C;  5B2J A;  5JA4 B;  3LEL A;  3B0C T;  1ZLA C;  5B33 D;  5DNM A;  4DRA A;  3V9R B;  1P3K B;  5AV9 B;  4G91 B;  2NZD B;  4Z66 A;  3W96 A;  1AOI A;  4X23 A;  2FJ7 B;  5BNX B;  5GXQ A;  5FUG A;  5AY8 A;  3AZG C;  5CPI D;  4CSR A;  3W99 B;  3B6F B;  1M1A D;  5JRG B;  2RIQ A;  1P3A A;  1U35 D;  5B1L C;  3LZ1 A;  1BFM A;  5B2I B;  1S32 C;  3UTB B;  3MGR A;  3AV1 B;  3MNN C;  5C3I C;  2DF4 C;  5E5A B;  3X1V B;  3REL C;  3AFA D;  4QLC D;  4H9S A;  3AV2 A;  1KX5 A;  1P3B B;  5B32 A;  3AN2 B;  1P3I A;  2VQR A;  3REJ C;  4ZUX B;  5AVC D;  3MVD D;  3TU4 D;  4J8X B;  2HIO C;  1KU5 A;  1M19 C;  2YFW B;  3LZ0 B;  3REK C;  1KX3 B;  5CPJ B;  5B33 A;  4YS3 C;  4LD9 B;  3X1T B;  2PYO D;  2HUE C;  4J8V D;  4XZQ C;  3REI C;  4R8P B;  2ZY3 A;  3AZK D;  5B31 B;  1P3G B;  4CAY B;  5CPI A;  4WV4 B;  2F8N H;  4YM6 D;  5CP6 B;  1M1A A;  4NE3 A;  5GT0 C;  3WAA B;  1U35 A;  5B40 D;  3R45 A;  4WU8 C;  4KGC D;  3X1U C;  5AV5 C;  3NQJ B;  1F66 D;  4WU9 C;  5F99 D;  3REH D;  2YFV A;  3AFA A;  3B6G B;  4QLC A;  3MGP D;  1EQZ C;  5AV8 D;  3WKJ D;  2ARO B;  4KUD C;  1PZR A;  5GT3 C;  3MVD A;  3MGQ B;  5B1M D;  3C1C A;  3AZJ D;  1P3K C;  1P3F A;  5AV9 C;  5DNM B;  3AZH B;  5BT1 C;  2PYO A;  2FJ7 C;  3AZG B;  5CPK A;  1HQ3 D;  3W98 D;  1P3M D;  3WTP C;  3B6F C;  3AZK A;  4J8V C;  5JRG C;  5B2I C;  4YM6 A;  3UTB C;  5DNN A;  3AV1 C;  1P3L D;  1TAF B;  4J8W D;  2Y2P A;  3A1I A;  3AZE D;  4XUJ C;  3MGR B;  1KX4 D;  4KGC A;  5E5A C;  2Y2K A;  4Z5T C;  5F99 A;  2DQN C;  2BYK B;  1P3B C;  4H9R A;  3REJ B;  2Y2Q A;  2F8N A;  1P3P A;  5BNV A;  3LEL D;  4ZUX C;  5B0Z D;  1KX5 B;  1TZY D;  5AV8 A;  2HIO B;  5B32 B;  3WKJ A;  3KWQ D;  1M19 B;  4J8X C;  2NQB C;  3O62 D;  3REK B;  5B1M A;  3LZ0 C;  1KX3 C;  3W97 B;  3W96 D;  1AOI D;  4LD9 C;  4XZQ B;  4X23 D;  3AZJ A;  5GXQ D;  5KDM B;  4UPK A;  5B0Y C;  5GSU A;  1R4V A;  1HQ3 A;  2FFF B;  1P3G C;  3W98 A;  4H9O B;  1P34 D;  5GT0 B;  3AZF D;  4WU8 B;  3WAA C;  1H3O B;  3NQU B;  5CPI B;  1M1A B;  4H9Q B;  2Y2O A;  4J8W A;  2CV5 D;  3UTA C;  4JJN D;  3AZE A;  1KX4 A;  1T3U A;  1P3I D;  3KXB D;  5AVB D;  5BO0 B;  3X1S D;  3B6G C;  3AZN D;  2YFV B;  3VH6 W;  4WZS B;  4QLC B;  5B0Z A;  1TZY A;  3MGQ C;  3C1B D;  2J8P A;  2RVQ D;  3KWQ A;  1BH8 A;  3O62 A;  5AVC B;  3MVD B;  3TU4 B;  5B2J C;  1JFI A;  4J8U A;  1ID3 D;  5DNM C;  3AZH C;  3LJA A;  4G92 B;  3AZM D;  3MGS D;  3WTP B;  4Z66 C;  4J8V B;  4X23 C;  4WJ3 C;  3WTP E;  3UT9 D;  5AY8 C;  1P34 A;  3AZF A;  1P3A C;  4XUJ B;  3LZ1 C;  2JE5 A;  1B67 A;  3AYW D;  3MGR C;  4DQY B;  5AV6 D;  2CV5 A;  4Z5T B;  5B40 B;  4JJN A;  2JSS A;  1ULY A;  3P5J B;  3KXB A;  5AVB A;  3X1S A;  4H9P A;  4UUZ B;  5B32 G;  1F66 B;  3REH B;  4H9S C;  5B1L A;  3C1C D;  3AV2 C;  1KX5 C;  2Y2L A;  2NQB B;  5B32 C;  2IO5 B;  3AZN A;  3EPH A;  5G49 B;  1P3F D;  3MGP B;  3MNN A;  2LY8 A;  3C1B A;  3W97 C;  3H0R C;  5CPK D;  5B0Y B;  5B33 C;  1ID3 A;  4H9N A;  1P3O D;  3AZJ B;  3WA9 D;  3AZM A;  1B6W A;  3MGS A;  2F8N K;  4KHA A;  5DNN D;  1HQ3 B;  2BYM A;  3VH5 W;  3UT9 A;  1P3M B;  5CPI C;  2NZD D;  2Y2J A;  1M1A C;  3UTA B;  2ZY5 A;  1U35 C;  3REI A;  3EPL A;  3H0L C;  3AYW A;  3W99 D;  2F8N D;  5AV6 A;  1P3L B;  1HTA A;  1P3P D;  3AZE B;  1KX4 B;  4NE5 A;  3FDD A;  3AFA C;  4QLC C;  3AN2 A;  1F1E A;  3X1U A;  2ZY4 A;  5AV5 A;  5B2J B;  3LEL B;  3X1V D;  5AVC C;  3MVD C;  5B0Z B;  3TU4 C;  3KWQ B;  3B0D C;  5GSU D;  4WNN A;  3AN2 D;  2UWX A;  4G92 C;  3AZI A;  4Z66 B;  3KUY D;  3W96 B;  2L5A A;  4Z2M G;  1AOI B;  4X23 B;  1P3O A;  2PYO C;  5GXQ B;  3WA9 A;  4KUD A;  5BS7 A;  5FUG B;  5AY8 B;  4CSR B;  5JA4 A;  5CPJ D;  4DRB A;  5B24 D;  3X1T D;  3V9R A;  3AZK C;  1P3A B;  3LZ1 B;  1Q9C A;  2NZD A;  1P34 B;  4R8P D;  3VH5 A;  4YM6 C;  5DNN C;  5BNX A;  5B31 D;  5B40 C;  5CHL B;  3W99 A;  3B6F A;  2CV5 B;  4KGC C;  3VH5 T;  5CP6 D;  3EPJ A;  3AV2 B;  5JRG A;  1F66 C;  5F99 C;  3REH C;  1P3I B;  2IO5 C;  4EO5 B;  3A6N D;  4J8U D;  3MGP C;  2CWE A;  5AV8 C;  3AZL D;  3WKJ C;  3AZN B;  3LJA D;  5E5A A;  3X1V A;  1M18 D;  5B33 B;  5B1M C;  2ARO D;  3AZJ C;  3EPK A; 
#chains in the Genus database with same CATH homology
 3KUY A;  1ZLA D;  4J8X A;  3MGS B;  2JCH A;  1HQ3 C;  2YFW A;  3LZ0 A;  1KX3 A;  3W98 C;  5CPJ A;  1P3M C;  4LD9 A;  5B24 A;  3X1T A;  1U35 B;  3KSY A;  2BYM B;  3R45 B;  3UT9 B;  3AZG D;  4R8P A;  3AL0 C;  5B31 A;  4J8W C;  1P3L C;  5B1L D;  4CAY A;  3AZE C;  1S32 D;  1KX4 C;  2G5H C;  3AFA B;  4E45 A;  1BH9 A;  5CP6 A;  3MNN D;  4HGA B;  3REL D;  3LEL C;  3NQJ A;  3A6N A;  3C1C B;  5B0Z C;  1N1J A;  1TZY C;  3AZL A;  3B0D B;  3KWQ C;  3REJ D;  1P3F B;  3O62 C;  1M18 A;  3W96 C;  1AOI C;  1Z2C B;  2PYO B;  2HIO D;  2ARO A;  5GXQ C;  3A1K A;  5CPK B;  3REK D;  1ZLA A;  3MGQ A;  4YS3 D;  1P3O B;  3AZK B;  3WA9 B;  4XZQ D;  2ZM5 A;  4NE6 A;  3REI D;  4YM6 B;  3AZH A;  1P34 C;  5DNN B;  3AZF C;  3AZG A;  4KGC B;  2CV5 C;  5GT0 D;  5F99 B;  3F6T A;  4JJN C;  4WU8 D;  1S32 A;  4H9R B;  2F8N B;  1P3I C;  3X1U D;  5AV5 D;  3KXB C;  5BNV B;  5AVB C;  2ZY2 A;  4AWL C;  4EO5 C;  3X1S C;  1P3P B;  2Y2M A;  1TAF A;  5AV8 B;  4WU9 D;  3WKJ B;  3VH6 A;  3REL A;  3AZN C;  5B1M B;  3AZI D;  1EQZ D;  3C1B C;  2BYK A;  2RVQ C;  3VH6 T;  2G5I C;  5GT3 D;  3REJ A;  4KUD D;  1WWS A;  4ZBJ B;  1ID3 C;  2HIO A;  1W2E A;  5GSU B;  4Z2M H;  1M19 A;  1P3K D;  3AZM C;  5AV9 D;  3MGS C;  3REK A;  3KUY B;  3W98 B;  4YS3 A;  3W97 A;  5BT1 D;  4XZQ A;  2FJ7 D;  5KDM A;  3UT9 C;  3WTP D;  5B24 B;  3B6F D;  4J8W B;  4M6B A;  5JRG D;  2Y2N A;  5B2I D;  4H9O A;  3UTB D;  3AYW C;  3AV1 D;  5AV6 C;  5GT0 A;  4WU8 A;  1H3O A;  3NQU A;  2F2A C;  4HGA C;  4XUJ D;  5E5A D;  1BH9 B;  4H9Q A;  4WU9 A;  1TZY B;  4Z5T D;  3C1C C;  1P3B D;  1BH8 B;  3O62 B;  1JFI B;  1P3F C;  5BO0 A;  4ZUX D;  2XD1 A;  3A6N B;  3H0M C;  4J8U B;  1N1J B;  1EQZ A;  3AZL B;  3LJA B;  4J8X D;  5GT3 A;  2NQB D;  2Y2G A;  5CPK C;  1M18 B;  3LZ0 D;  3AZI C;  1KX3 D;  4LD9 D;  1P3O C;  3WA9 C;  1P3K A;  5BS7 C;  5AVC A;  5AV9 A;  1ZLA B;  3TU4 A;  3EG5 B;  5B0Y D;  3AZF B;  2FJ7 A;  3IP4 C;  4E44 A;  1P3G D;  4G91 C;  2NZD C;  2XD5 A;  3WTP A;  4J8V A;  4JJN B;  2F8N G;  3WAA D;  4NFT A;  5B2I A;  2Y2H A;  3KXB B;  3UTB A;  3W99 C;  5AVB B;  4AWL B;  3X1S B;  4H9P B;  3AV1 A;  1P3P C;  5B1L B;  2Y2I A;  3UTA D;  2W8S A;  1S32 B;  4XUJ A;  3B6G D;  4Z5T A;  3MNN B;  3C1B B;  5B40 A;  5C3I B;  1A7W A;  3B0C W;  1P3B A;  3REL B;  3X1V C;  4ZUX A;  4UUZ A;  1F66 A;  3MGQ D;  3REH A;  1ID3 B;  4H9N B;  4ZBJ C;  3AZM B;  2NQB A;  5GSU C;  3AN2 C;  5G49 A;  5B2J D;  3MGP A;  3KUY C;  4KHA B;  5DNM D;  3AZH D;  4YS3 B;  4Z66 D;  5B0Y A;  2BG1 A;  2HUE B;  5CPJ C;  5B24 C;  3X1T C;  1P3G A;  3REI B;  5AY8 D;  3B0B A;  5B31 G;  3AYW B;  4R8P C;  5AV6 B;  1P3A D;  5B31 C;  3WAA A;  3LZ1 D;  3KFU G;  1P3M A;  3MGR D;  5CP6 C;  3UTA A;  3X1U B;  5AV5 B;  4WU9 B;  1P3L A;  1WWI A;  3AV2 D;  3A6N C;  4J8U C;  3B6G A;  1KX5 D;  3AZL C;  5B32 D;  4WNN B;  3LJA C;  1M19 D;  3AZI B;  1EQZ B;  1M18 C;  3W97 D;  4KUD B;  5GT3 B;  2ARO C;  5B2J A;  5JA4 B;  3LEL A;  3B0C T;  1ZLA C;  5B33 D;  5DNM A;  4DRA A;  3V9R B;  1P3K B;  5AV9 B;  4G91 B;  2NZD B;  4Z66 A;  3W96 A;  1AOI A;  4X23 A;  2FJ7 B;  5BNX B;  5GXQ A;  5FUG A;  5AY8 A;  3AZG C;  5CPI D;  4CSR A;  3W99 B;  3B6F B;  1M1A D;  5JRG B;  2RIQ A;  1P3A A;  1U35 D;  5B1L C;  3LZ1 A;  1BFM A;  5B2I B;  1S32 C;  3UTB B;  3MGR A;  3AV1 B;  3MNN C;  5C3I C;  2DF4 C;  5E5A B;  3X1V B;  3REL C;  3AFA D;  4QLC D;  4H9S A;  3AV2 A;  1KX5 A;  1P3B B;  5B32 A;  3AN2 B;  1P3I A;  2VQR A;  3REJ C;  4ZUX B;  5AVC D;  3MVD D;  3TU4 D;  4J8X B;  2HIO C;  1KU5 A;  1M19 C;  2YFW B;  3LZ0 B;  3REK C;  1KX3 B;  5CPJ B;  5B33 A;  4YS3 C;  4LD9 B;  3X1T B;  2PYO D;  2HUE C;  4J8V D;  4XZQ C;  3REI C;  4R8P B;  2ZY3 A;  3AZK D;  5B31 B;  1P3G B;  4CAY B;  5CPI A;  4WV4 B;  2F8N H;  4YM6 D;  5CP6 B;  1M1A A;  4NE3 A;  5GT0 C;  3WAA B;  1U35 A;  5B40 D;  3R45 A;  4WU8 C;  4KGC D;  3X1U C;  5AV5 C;  3NQJ B;  1F66 D;  4WU9 C;  5F99 D;  3REH D;  2YFV A;  3AFA A;  3B6G B;  4QLC A;  3MGP D;  1EQZ C;  5AV8 D;  3WKJ D;  2ARO B;  4KUD C;  1PZR A;  5GT3 C;  3MVD A;  3MGQ B;  5B1M D;  3C1C A;  3AZJ D;  1P3K C;  1P3F A;  5AV9 C;  5DNM B;  3AZH B;  5BT1 C;  2PYO A;  2FJ7 C;  3AZG B;  5CPK A;  1HQ3 D;  3W98 D;  1P3M D;  3WTP C;  3B6F C;  3AZK A;  4J8V C;  5JRG C;  5B2I C;  4YM6 A;  3UTB C;  5DNN A;  3AV1 C;  1P3L D;  1TAF B;  4J8W D;  2Y2P A;  3A1I A;  3AZE D;  4XUJ C;  3MGR B;  1KX4 D;  4KGC A;  5E5A C;  2Y2K A;  4Z5T C;  5F99 A;  2DQN C;  2BYK B;  1P3B C;  4H9R A;  3REJ B;  2Y2Q A;  2F8N A;  1P3P A;  5BNV A;  3LEL D;  4ZUX C;  5B0Z D;  1KX5 B;  1TZY D;  5AV8 A;  2HIO B;  5B32 B;  3WKJ A;  3KWQ D;  1M19 B;  4J8X C;  2NQB C;  3O62 D;  3REK B;  5B1M A;  3LZ0 C;  1KX3 C;  3W97 B;  3W96 D;  1AOI D;  4LD9 C;  4XZQ B;  4X23 D;  3AZJ A;  5GXQ D;  5KDM B;  4UPK A;  5B0Y C;  5GSU A;  1R4V A;  1HQ3 A;  2FFF B;  1P3G C;  3W98 A;  4H9O B;  1P34 D;  5GT0 B;  3AZF D;  4WU8 B;  3WAA C;  1H3O B;  3NQU B;  5CPI B;  1M1A B;  4H9Q B;  2Y2O A;  4J8W A;  2CV5 D;  3UTA C;  4JJN D;  3AZE A;  1KX4 A;  1T3U A;  1P3I D;  3KXB D;  5AVB D;  5BO0 B;  3X1S D;  3B6G C;  3AZN D;  2YFV B;  3VH6 W;  4WZS B;  4QLC B;  5B0Z A;  1TZY A;  3MGQ C;  3C1B D;  2J8P A;  2RVQ D;  3KWQ A;  1BH8 A;  3O62 A;  5AVC B;  3MVD B;  3TU4 B;  5B2J C;  1JFI A;  4J8U A;  1ID3 D;  5DNM C;  3AZH C;  3LJA A;  4G92 B;  3AZM D;  3MGS D;  3WTP B;  4Z66 C;  4J8V B;  4X23 C;  4WJ3 C;  3WTP E;  3UT9 D;  5AY8 C;  1P34 A;  3AZF A;  1P3A C;  4XUJ B;  3LZ1 C;  2JE5 A;  1B67 A;  3AYW D;  3MGR C;  4DQY B;  5AV6 D;  2CV5 A;  4Z5T B;  5B40 B;  4JJN A;  2JSS A;  1ULY A;  3P5J B;  3KXB A;  5AVB A;  3X1S A;  4H9P A;  4UUZ B;  5B32 G;  1F66 B;  3REH B;  4H9S C;  5B1L A;  3C1C D;  3AV2 C;  1KX5 C;  2Y2L A;  2NQB B;  5B32 C;  2IO5 B;  3AZN A;  3EPH A;  5G49 B;  1P3F D;  3MGP B;  3MNN A;  2LY8 A;  3C1B A;  3W97 C;  3H0R C;  5CPK D;  5B0Y B;  5B33 C;  1ID3 A;  4H9N A;  1P3O D;  3AZJ B;  3WA9 D;  3AZM A;  1B6W A;  3MGS A;  2F8N K;  4KHA A;  5DNN D;  1HQ3 B;  2BYM A;  3VH5 W;  3UT9 A;  1P3M B;  5CPI C;  2NZD D;  2Y2J A;  1M1A C;  3UTA B;  2ZY5 A;  1U35 C;  3REI A;  3EPL A;  3H0L C;  3AYW A;  3W99 D;  2F8N D;  5AV6 A;  1P3L B;  1HTA A;  1P3P D;  3AZE B;  1KX4 B;  4NE5 A;  3FDD A;  3AFA C;  4QLC C;  3AN2 A;  1F1E A;  3X1U A;  2ZY4 A;  5AV5 A;  5B2J B;  3LEL B;  3X1V D;  5AVC C;  3MVD C;  5B0Z B;  3TU4 C;  3KWQ B;  3B0D C;  5GSU D;  4WNN A;  3AN2 D;  2UWX A;  4G92 C;  3AZI A;  4Z66 B;  3KUY D;  3W96 B;  2L5A A;  4Z2M G;  1AOI B;  4X23 B;  1P3O A;  2PYO C;  5GXQ B;  3WA9 A;  4KUD A;  5BS7 A;  5FUG B;  5AY8 B;  4CSR B;  5JA4 A;  5CPJ D;  4DRB A;  5B24 D;  3X1T D;  3V9R A;  3AZK C;  1P3A B;  3LZ1 B;  1Q9C A;  2NZD A;  1P34 B;  4R8P D;  3VH5 A;  4YM6 C;  5DNN C;  5BNX A;  5B31 D;  5B40 C;  5CHL B;  3W99 A;  3B6F A;  2CV5 B;  4KGC C;  3VH5 T;  5CP6 D;  3EPJ A;  3AV2 B;  5JRG A;  1F66 C;  5F99 C;  3REH C;  1P3I B;  2IO5 C;  4EO5 B;  3A6N D;  4J8U D;  3MGP C;  2CWE A;  5AV8 C;  3AZL D;  3WKJ C;  3AZN B;  3LJA D;  5E5A A;  3X1V A;  1M18 D;  5B33 B;  5B1M C;  2ARO D;  3AZJ C;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...