4KGCC

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcC00
2JSSA 3UT9A 1P3OC 1P3BC 5KDMA 1M19A 1M19C 4YS3A 3LZ1D 3REIB 2PYOA 4XUJC 5DNMA 3AZNA 4YS3C 3AV2A 4YM6D 2PYOC 4KGCC 5DNMC 5B24A 3TU4B 3AZNC 3AZLD 3AV2C 3B6GA 5B24C 1P34B 5CPJB 1P3KB 4QLCA 1TZYB 3VH6T 3AZIC 1BH8B 5GXQD 4QLCC 5B40A 4WU8B 5B40C 3LELB 5CPKB 3V9RB 3A6NA 1F66A 5F99C 3MNNB 3X1VA 4WV4B 3AYWB 5CPID 3NQUB 1P3GB 1P3KD 1F66C 3C1BB 3AZJB 3X1VC 3B0CT 3MGPA 3REJA 4J8VB 3AN2A 3MGPC 1A7WA 3REJC 3REID 4H9NA 3AN2C 4YM6A 4UUZB 4XZQA 5JA4A 2YFWA 3AZLA 3TU4D 4XZQC 3AV1C 3MVDB 1S32C 3AZLC 5B32B 4J8WA 1P34D 3REKA 3KWQB 4J8WC 1TZYD 2NZDB 4J8XB 3REKC 3WTPB 3LZ0B 3MGQB 4WU8D 3LELD 5CPKD 5AV6B 5GSUB 4H9PB 5CPIA 1P3KA 3MNND 4KUDC 2HIOB 3AYWD 1P3GD 1P3KC 3C1BD 3AZJD 3AZFB 4Z2MG 1P3OB 1KX5B 3VH6A 4J8VD 3REIA 1P3BB 4H9RB 5AVCD 4Z5TA 1M19B 3WA9C 5B32G 3TU4A 4Z5TC 3MGRC 4XUJB 4YS3B 3MVDD 5CPJA 5B32D 4KGCB 3AZNB 1TZYA 3KWQD 5CPJC 1BH8A 2NZDD 5BS7C 4J8XD 3WTPD 1N1JA 2RVQD 3LZ0D 3MGQD 3LELA 3AZIB 3KSYA 3V9RA 5AV6D 5GSUD 2CV5A 3AYWA 5B40B 5B31G 3AZKB 1P3GA 3WKJB 4E45A 3X1UA 1B67A 2HIOD 3C1BA 3AZJA 2CV5C 3AYWC 1P3GC 1ZLAA 5F99B 3X1UC 3AZJC 2CWEA 3B0BA 3O62C 4J8VA 3AZFD 3AZGB 1JFIA 1F66B 1ZLAC 3X1VB 1P3OD 3X1SA 1P3BD 3X1SC 5B2JB 3MGPB 1M19D 3REJB 4ZUXB 2F8NG 4KHAB 3MVDA 3AN2B 4XUJD 5B32A 4YS3D 3MVDC 4JJNA 5B32C 3AZND 4KGCD 4XZQB 3AV1B 5JA4B 4J8XA 1S32B 4JJNC 3C1CA 5B24D 4HGAC 4J8XC 4J8WB 3C1CC 2HUEC 3AZID 3REKB 4H9PA 2HIOA 5B40D 3AZKD 3WKJD 2HIOC 4H9QA 5B31A 3RELB 3X1TC 5F99D 4KUDB 5B31C 1P3OA 1KX5A 3B6FC 3AZGD 2BYKB 5AY8B 1F66D 3X1VD 4M6BA 4H9RA 3LJAC 1KX5C 5DNNC 1P3IA 5B2JD 1P3IC 5CP6B 3MGPD 4XUJA 4ZUXD 3REJD 1H3OA 3AN2D 4WU9A 3WA9B 2F8NA 4KGCA 4Z5TB 3MGRB 4WU9C 4XZQD 1WWIA 3AV1D 1S32D 4H9OB 3B0DC 5AVBA 3AZIA 4J8WD 5AVBC 3REKD 1P3FB 1ID3A 4Z2MH 3AZKA 1ID3C 3WKJA 3AZEA 1N1JB 3AZKC 3WKJC 5B2IB 5F99A 5AV9B 3AZEC 3RELD 3AZGA 5B0ZA 2CV5B 4KUDD 5B0YB 5AY8D 3AZGC 5B0ZC 3X1UB 4J8UA 1R4VA 3O62B 5B2JA 1ZLAB 4J8UC 4ZUXA 4KHAA 5B2JC 5CP6D 1JFIB 4ZUXC 3X1SB 2FJ7B 3WA9D 4Z5TD 5JRGB 3AV1A 3NQJA 3MGRD 1S32A 5E5AB 5CPJD 4JJNB 4HGAB 4DRAA 3C1CB 3W96B 2HUEB 4G92B 3RELA 5B2ID 5AV9D 1WWSA 4KUDA 5GT0A 3RELC 2F8NH 5C3IB 2BYKA 5B1LA 5AY8A 4AWLC 2CV5D 1BFMA 5GT0C 5B0YD 3X1TB 5AY8C 5B1LC 3X1UD 4H9QB 5B31B 1TAFA 1M1AA 3O62D 1ZLAD 3B6FB 5CP6A 3LJAB 1AOIB 5DNNB 4NE5A 1M1AC 5CP6C 3WA9A 3X1SD 1P3IB 2FJ7D 3MGRA 3KUYA 4H9OA 3UTBB 1H3OB 4WU9B 3KUYC 1EQZB 2F8NB 5BS7A 1P3FA 4JJND 4NE6A 3B0DB 5B33C 1P3FC 3VH5W 3WAAB 3C1CD 3W96D 5AVBB 5B2IA 5AV9A 1ID3B 5B2IC 5AV9C 5GT3B 5B0YA 4H9SA 3AZEB 1HTAA 5B0YC 4H9SC 3X1TD 3O62A 5B31D 3B6FD 1P3PA 3MGSA 5B0ZB 3LJAD 1KX5D 1P3LA 1B6WA 5DNND 1P3PC 1AOID 3MGSC 2FJ7A 4J8UB 1P3LC 5JRGA 1P3ID 1M18A 2FJ7C 3REHA 5JRGC 1M18C 4Z66A 3REHC 5E5AA 3UTBD 4Z66C 4WU9D 1EQZD 5E5AC 2F8ND 3AZHA 3NQJB 3W96A 3AZHC 3WAAD 3W96C 5AVBD 5CHLB 4G92C 1KX3B 1ID3D 1BH9B 5GT3D 5AV5B 3X1TA 5C3IC 3AZED 4NFTA 3B6FA 5BT1C 4DRBA 4AWLB 2BYMB 5GT0B 3LJAA 1AOIA 4EO5B 5DNNA 5B0ZD 5B1LB 2IO5C 3W99C 1AOIC 4J8UD 1TAFB 1M1AB 4G91B 3UTBA 4ZBJB 1EQZA 3W98B 3UTBC 1P3MB 5B1MB 1EQZC 3WAAA 3KUYB 4CSRB 5G49A 3WAAC 5AV8B 5B33B 4X23C 2NQBC 1KX3D 5GT3A 3W97B 1KU5A 5GT3C 5AV5D 4LD9A 3UT9C 5BNXB 4LD9C 4NE3A 5GT0D 5B1LD 3AZMA 4WZSB 1M1AD 1P3PB 3MGSB 3UTAB 3AZMC 4R8PB 2YFVB 1P3LB 5BO0A 3B6GC 3W98D 1M18B 3REHB 1P3MD 5B1MD 1P3AA 5BNVB 1U35A 4Z66B 3KUYD 1P3AC 2AROB 3KXBA 1U35C 4CAYB 1KX3A 1HQ3B 5AV8D 3AZHB 5B33D 1P3FD 3KXBC 1BH9A 3A6NC 1KX3C 3W97D 5AV5A 5AV5C 3VH6W 2BYMA 3LZ1A 2L5AA 5AVCB 3LZ1C 4EO5C 1KX4B 3R45B 3AFAB 4YM6C 2IO5B 3W99B 3VH5T 1P3PD 3MGSD 4G91C 3UTAD 5FUGB 4R8PD 1P3LD 3W98A 3B0CW 5GXQA 4ZBJC 4E44A 1P3MA 5B1MA 3W98C 5JRGD 1M18D 3REHD 5GXQC 1P3MC 5B1MC 4CSRA 4Z66D 5E5AD 5AV8A 2AROD 5B33A 1HQ3D 5AV8C 3AZHD 3W97A 5CPIC 3WTPE 4X23B 4WNNB 3W97C 2NQBB 5G49B 5BNXA 3UT9B 1ULYA 3REIC 2LY8A 4LD9B 5BT1D 1KX4D 5KDMB 3AFAD 2F8NK 3UTAA 3TU4C 3W99D 4R8PA 2YFVA 1P34A 1Q9CA 2PYOB 5DNMB 3UTAC 4R8PC 3AV2B 1P34C 1F1EA 5B24B 3AZMB 1TZYC 4WU8A 5BNVA 3B6GB 5CPKA 4WU8C 2AROA 5BO0B 4QLCB 4CAYA 3LELC 1HQ3A 5CPKC 3MNNA 2AROC 3NQUA 1P3AB 1HQ3C 3MNNC 1U35B 3VH5A 3C1BC 4X23D 3KXBB 2NQBD 3A6NB 5AVCA 4J8VC 3UT9D 1KX4A 4UUZA 3R45A 5AVCC 3AFAA 4LD9D 1KX4C 3LZ1B 3AFAC 3W99A 5FUGA 3KWQA 4H9NB 2PYOD 4YM6B 5DNMD 2NZDA 2YFWB 3AV2D 3KWQC 3WTPA 3AZLB 3AZMD 3LZ0A 2NZDC 3MGQA 3WTPC 3B6GD 2RVQC 3LZ0C 3MGQC 5AV6A 5GSUA 4QLCD 5GXQB 5AV6C 5GSUC 1P3AD 4X23A 4WNNA 1U35D 2NQBA 3AZFA 3KXBD 5CPIB 3A6ND 1P3BA 3AZFC
chains in the Genus database with same CATH superfamily
2JSSA 3UT9A 1P3OC 1P3BC 5KDMA 1M19A 1M19C 4YS3A 3LZ1D 3REIB 2PYOA 4XUJC 5DNMA 3AZNA 4YS3C 3FDDA 3AV2A 4YM6D 2PYOC 4KGCC 5DNMC 5B24A 3TU4B 2G5HC 3AZNC 3AZLD 3AV2C 3B6GA 5B24C 1P34B 5CPJB 1P3KB 4QLCA 1TZYB 3VH6T 3AZIC 1BH8B 3A1IA 5GXQD 4QLCC 5B40A 4WU8B 5B40C 3LELB 5CPKB 3V9RB 3A6NA 1F66A 5F99C 3MNNB 3X1VA 4WV4B 2JCHA 3AYWB 3NQUB 5CPID 1P3GB 1P3KD 1F66C 3C1BB 3AZJB 3X1VC 3B0CT 3MGPA 2FFFB 3REJA 2UWXA 4J8VB 3AN2A 3MGPC 1A7WA 3REJC 3REID 4H9NA 3AN2C 4YM6A 4UUZB 4XZQA 5JA4A 2YFWA 3AZLA 4UPKA 4XZQC 3TU4D 3AV1C 3MVDB 1S32C 3AZLC 5B32B 2Y2JA 4J8WA 1P34D 3REKA 3KWQB 4J8WC 1TZYD 2NZDB 4J8XB 3REKC 3WTPB 3LZ0B 3MGQB 4WU8D 3LELD 5CPKD 5AV6B 5GSUB 4H9PB 5CPIA 1P3KA 3MNND 4KUDC 2HIOB 2ZY5A 3IP4C 3AYWD 1P3GD 1P3KC 2J8PA 3C1BD 3AZJD 3EPHA 3AZFB 4Z2MG 1P3OB 1KX5B 3VH6A 4J8VD 3REIA 2Y2NA 1P3BB 4H9RB 5AVCD 4Z5TA 1M19B 3WA9C 5B32G 3TU4A 4Z5TC 2W8SA 3MGRC 4XUJB 4YS3B 3MVDD 5CPJA 5B32D 4KGCB 3AZNB 1TZYA 3KWQD 5CPJC 2VQRA 1BH8A 2NZDD 5BS7C 4J8XD 3WTPD 1N1JA 2RVQD 3LZ0D 3MGQD 3LELA 3AZIB 3KSYA 3V9RA 5AV6D 5GSUD 2CV5A 3AYWA 5B40B 5B31G 3AZKB 1P3GA 3WKJB 4E45A 3X1UA 1B67A 2HIOD 3C1BA 3AZJA 2CV5C 3AYWC 1P3GC 1ZLAA 5F99B 3X1UC 3AZJC 2CWEA 3B0BA 3O62C 4J8VA 3AZFD 3AZGB 1JFIA 1F66B 1ZLAC 3X1VB 1P3OD 3X1SA 1P3BD 3X1SC 5B2JB 3MGPB 1M19D 3REJB 4ZUXB 3EPKA 2F8NG 4KHAB 3MVDA 3AN2B 4XUJD 5B32A 4YS3D 3MVDC 4JJNA 5B32C 3AZND 4KGCD 4XZQB 3AV1B 5JA4B 4J8XA 1S32B 4JJNC 3C1CA 5B24D 4HGAC 4J8XC 4J8WB 3C1CC 2HUEC 2Y2OA 3REKB 3AZID 4H9PA 2HIOA 5B40D 3AZKD 3WKJD 2HIOC 4H9QA 5B31A 3RELB 3X1TC 5F99D 4KUDB 5B31C 1P3OA 1KX5A 3B6FC 3AZGD 2BYKB 5AY8B 1F66D 3X1VD 4M6BA 4H9RA 3LJAC 1KX5C 5DNNC 1P3IA 5B2JD 1P3IC 1Z2CB 5CP6B 3MGPD 4XUJA 4ZUXD 3REJD 1H3OA 3AN2D 2DF4C 4WU9A 3WA9B 2F8NA 4KGCA 4Z5TB 2ZM5A 3MGRB 4WU9C 4XZQD 1WWIA 3AV1D 1S32D 4H9OB 3B0DC 5AVBA 3P5JB 3AZIA 4J8WD 5AVBC 3REKD 1P3FB 1ID3A 4Z2MH 3AZKA 1ID3C 3WKJA 3AZEA 1N1JB 3AZKC 3WKJC 5B2IB 5F99A 5AV9B 3AZEC 3RELD 3AZGA 5B0ZA 2CV5B 4KUDD 5B0YB 5AY8D 3AZGC 5B0ZC 3X1UB 4J8UA 1R4VA 3O62B 5B2JA 1ZLAB 4J8UC 4ZUXA 4KHAA 5B2JC 5CP6D 1JFIB 4ZUXC 3X1SB 2FJ7B 3WA9D 4Z5TD 5JRGB 3AV1A 3NQJA 3MGRD 1S32A 2XD1A 5E5AB 5CPJD 3A1KA 4JJNB 4HGAB 4DRAA 3C1CB 3W96B 2HUEB 4G92B 3RELA 5B2ID 5AV9D 1WWSA 4KUDA 5GT0A 3RELC 2F8NH 5C3IB 2BYKA 5B1LA 5AY8A 4AWLC 2CV5D 1BFMA 5GT0C 5B0YD 3X1TB 5AY8C 5B1LC 3X1UD 2Y2LA 4WJ3C 4H9QB 5B31B 1TAFA 1M1AA 3O62D 1ZLAD 3B6FB 5CP6A 3LJAB 1AOIB 5DNNB 4NE5A 1M1AC 5CP6C 3WA9A 3X1SD 1P3IB 2FJ7D 3MGRA 2DQNC 3KUYA 4H9OA 3UTBB 1H3OB 4WU9B 3KUYC 1EQZB 2F8NB 5BS7A 2BG1A 1P3FA 4JJND 4NE6A 2Y2KA 3B0DB 5B33C 1P3FC 3VH5W 3H0LC 3C1CD 3W96D 3WAAB 5AVBB 5B2IA 5AV9A 1ID3B 5B2IC 5AV9C 3KFUG 5GT3B 5B0YA 4H9SA 3AZEB 1HTAA 5B0YC 4H9SC 3X1TD 3O62A 5B31D 3B6FD 1P3PA 3MGSA 5B0ZB 3LJAD 1KX5D 1P3LA 1B6WA 5DNND 1P3PC 1AOID 3MGSC 2FJ7A 4J8UB 3H0MC 1P3LC 5JRGA 1P3ID 1M18A 2FJ7C 3REHA 5JRGC 1M18C 4Z66A 3REHC 5E5AA 3UTBD 4Z66C 4WU9D 1EQZD 5E5AC 2F8ND 3AZHA 3NQJB 3W96A 3AZHC 3WAAD 3W96C 5AVBD 5CHLB 4G92C 1KX3B 1ID3D 1BH9B 5GT3D 5AV5B 3X1TA 5C3IC 3AZED 4NFTA 3B6FA 5BT1C 4DRBA 4AWLB 2BYMB 5GT0B 3LJAA 1AOIA 4EO5B 5DNNA 5B0ZD 5B1LB 2Y2PA 2IO5C 3W99C 1AOIC 4J8UD 1TAFB 1T3UA 1M1AB 4G91B 3UTBA 4ZBJB 1EQZA 3W98B 3UTBC 1P3MB 5B1MB 1EQZC 2Y2HA 3WAAA 3KUYB 4CSRB 5G49A 1W2EA 3WAAC 5AV8B 5B33B 4X23C 2NQBC 1KX3D 5GT3A 3EG5B 3W97B 1KU5A 3H0RC 5GT3C 5AV5D 4LD9A 3UT9C 5BNXB 4LD9C 4DQYB 4NE3A 5GT0D 5B1LD 2ZY4A 3EPJA 3AZMA 4WZSB 1M1AD 1P3PB 3MGSB 3UTAB 3AZMC 4R8PB 2YFVB 1P3LB 5BO0A 3B6GC 3W98D 1M18B 3REHB 1P3MD 5B1MD 1P3AA 5BNVB 1U35A 4Z66B 3KUYD 1P3AC 3EPLA 2AROB 3KXBA 2Y2GA 1U35C 4CAYB 1KX3A 1HQ3B 5AV8D 3AZHB 5B33D 1P3FD 3KXBC 1BH9A 3A6NC 1KX3C 3W97D 5AV5A 5AV5C 3VH6W 2BYMA 3LZ1A 2L5AA 5AVCB 2Y2MA 3LZ1C 4EO5C 1KX4B 3R45B 3AFAB 4YM6C 3F6TA 2IO5B 3W99B 3VH5T 1P3PD 3MGSD 2ZY2A 4G91C 3UTAD 5FUGB 4R8PD 1P3LD 3W98A 3B0CW 5GXQA 4ZBJC 4E44A 1P3MA 5B1MA 3W98C 5JRGD 1M18D 2XD5A 3REHD 5GXQC 1P3MC 5B1MC 4CSRA 4Z66D 5E5AD 5AV8A 2AROD 5B33A 1HQ3D 5AV8C 3AZHD 3W97A 5CPIC 2RIQA 3WTPE 4X23B 4WNNB 3W97C 2NQBB 5G49B 5BNXA 3UT9B 1ULYA 3REIC 2LY8A 4LD9B 5BT1D 1KX4D 5KDMB 3AFAD 2F8NK 3UTAA 3TU4C 3W99D 4R8PA 2YFVA 1P34A 1Q9CA 2PYOB 5DNMB 3UTAC 4R8PC 3AV2B 2ZY3A 1P34C 1F1EA 1PZRA 5B24B 3AZMB 1TZYC 4WU8A 2F2AC 5BNVA 3B6GB 5CPKA 4WU8C 2AROA 5BO0B 4QLCB 4CAYA 3LELC 1HQ3A 5CPKC 3MNNA 2Y2QA 2AROC 3NQUA 1P3AB 1HQ3C 3MNNC 1U35B 3VH5A 3C1BC 4X23D 3KXBB 2NQBD 3A6NB 5AVCA 4J8VC 3UT9D 1KX4A 4UUZA 3R45A 5AVCC 3AFAA 4LD9D 2Y2IA 1KX4C 3LZ1B 3AFAC 3W99A 2JE5A 5CPIB 5FUGA 3KWQA 4H9NB 2PYOD 4YM6B 5DNMD 2NZDA 2YFWB 3AV2D 3KWQC 3WTPA 3AZLB 3AZMD 3LZ0A 2NZDC 3MGQA 3WTPC 3B6GD 2RVQC 3LZ0C 3MGQC 5AV6A 5GSUA 4QLCD 5GXQB 5AV6C 5GSUC 1P3AD 3AL0C 4X23A 4WNNA 1U35D 2NQBA 3AZFA 3KXBD 2G5IC 3A6ND 1P3BA 3AZFC
chains in the Genus database with same CATH topology
2JSSA 3UT9A 1P3OC 1P3BC 5KDMA 1M19A 1M19C 4YS3A 3LZ1D 3REIB 2PYOA 4XUJC 5DNMA 3AZNA 4YS3C 3FDDA 3AV2A 4YM6D 2PYOC 4KGCC 5DNMC 5B24A 3TU4B 2G5HC 3AZNC 3AZLD 3AV2C 3B6GA 5B24C 1P34B 5CPJB 1P3KB 4QLCA 1TZYB 3VH6T 3AZIC 1BH8B 3A1IA 5GXQD 4QLCC 5B40A 4WU8B 5B40C 3LELB 5CPKB 3V9RB 3A6NA 1F66A 5F99C 3MNNB 3X1VA 4WV4B 2JCHA 3AYWB 3NQUB 5CPID 1P3GB 1P3KD 1F66C 3C1BB 3AZJB 3X1VC 3B0CT 3MGPA 2FFFB 3REJA 2UWXA 4J8VB 3AN2A 3MGPC 1A7WA 3REJC 3REID 4H9NA 3AN2C 4YM6A 4UUZB 4XZQA 5JA4A 2YFWA 3AZLA 4UPKA 4XZQC 3TU4D 3AV1C 3MVDB 1S32C 3AZLC 5B32B 2Y2JA 4J8WA 1P34D 3REKA 3KWQB 4J8WC 1TZYD 2NZDB 4J8XB 3REKC 3WTPB 3LZ0B 3MGQB 4WU8D 3LELD 5CPKD 5AV6B 5GSUB 4H9PB 5CPIA 1P3KA 3MNND 4KUDC 2HIOB 2ZY5A 3IP4C 3AYWD 1P3GD 1P3KC 2J8PA 3C1BD 3AZJD 3EPHA 3AZFB 4Z2MG 1P3OB 1KX5B 3VH6A 4J8VD 3REIA 2Y2NA 1P3BB 4H9RB 5AVCD 4Z5TA 1M19B 3WA9C 5B32G 3TU4A 4Z5TC 2W8SA 3MGRC 4XUJB 4YS3B 3MVDD 5CPJA 5B32D 4KGCB 3AZNB 1TZYA 3KWQD 5CPJC 2VQRA 1BH8A 2NZDD 5BS7C 4J8XD 3WTPD 1N1JA 2RVQD 3LZ0D 3MGQD 3LELA 3AZIB 3KSYA 3V9RA 5AV6D 5GSUD 2CV5A 3AYWA 5B40B 5B31G 3AZKB 1P3GA 3WKJB 4E45A 3X1UA 1B67A 2HIOD 3C1BA 3AZJA 2CV5C 3AYWC 1P3GC 1ZLAA 5F99B 3X1UC 3AZJC 2CWEA 3B0BA 3O62C 4J8VA 3AZFD 3AZGB 1JFIA 1F66B 1ZLAC 3X1VB 1P3OD 3X1SA 1P3BD 3X1SC 5B2JB 3MGPB 1M19D 3REJB 4ZUXB 3EPKA 2F8NG 4KHAB 3MVDA 3AN2B 4XUJD 5B32A 4YS3D 3MVDC 4JJNA 5B32C 3AZND 4KGCD 4XZQB 3AV1B 5JA4B 4J8XA 1S32B 4JJNC 3C1CA 5B24D 4HGAC 4J8XC 4J8WB 3C1CC 2HUEC 2Y2OA 3REKB 3AZID 4H9PA 2HIOA 5B40D 3AZKD 3WKJD 2HIOC 4H9QA 5B31A 3RELB 3X1TC 5F99D 4KUDB 5B31C 1P3OA 1KX5A 3B6FC 3AZGD 2BYKB 5AY8B 1F66D 3X1VD 4M6BA 4H9RA 3LJAC 1KX5C 5DNNC 1P3IA 5B2JD 1P3IC 1Z2CB 5CP6B 3MGPD 4XUJA 4ZUXD 3REJD 1H3OA 3AN2D 2DF4C 4WU9A 3WA9B 2F8NA 4KGCA 4Z5TB 2ZM5A 3MGRB 4WU9C 4XZQD 1WWIA 3AV1D 1S32D 4H9OB 3B0DC 5AVBA 3P5JB 3AZIA 4J8WD 5AVBC 3REKD 1P3FB 1ID3A 4Z2MH 3AZKA 1ID3C 3WKJA 3AZEA 1N1JB 3AZKC 3WKJC 5B2IB 5F99A 5AV9B 3AZEC 3RELD 3AZGA 5B0ZA 2CV5B 4KUDD 5B0YB 5AY8D 3AZGC 5B0ZC 3X1UB 4J8UA 1R4VA 3O62B 5B2JA 1ZLAB 4J8UC 4ZUXA 4KHAA 5B2JC 5CP6D 1JFIB 4ZUXC 3X1SB 2FJ7B 3WA9D 4Z5TD 5JRGB 3AV1A 3NQJA 3MGRD 1S32A 2XD1A 5E5AB 5CPJD 3A1KA 4JJNB 4HGAB 4DRAA 3C1CB 3W96B 2HUEB 4G92B 3RELA 5B2ID 5AV9D 1WWSA 4KUDA 5GT0A 3RELC 2F8NH 5C3IB 2BYKA 5B1LA 5AY8A 4AWLC 2CV5D 1BFMA 5GT0C 5B0YD 3X1TB 5AY8C 5B1LC 3X1UD 2Y2LA 4WJ3C 4H9QB 5B31B 1TAFA 1M1AA 3O62D 1ZLAD 3B6FB 5CP6A 3LJAB 1AOIB 5DNNB 4NE5A 1M1AC 5CP6C 3WA9A 3X1SD 1P3IB 2FJ7D 3MGRA 2DQNC 3KUYA 4H9OA 3UTBB 1H3OB 4WU9B 3KUYC 1EQZB 2F8NB 5BS7A 2BG1A 1P3FA 4JJND 4NE6A 2Y2KA 3B0DB 5B33C 1P3FC 3VH5W 3H0LC 3C1CD 3W96D 3WAAB 5AVBB 5B2IA 5AV9A 1ID3B 5B2IC 5AV9C 3KFUG 5GT3B 5B0YA 4H9SA 3AZEB 1HTAA 5B0YC 4H9SC 3X1TD 3O62A 5B31D 3B6FD 1P3PA 3MGSA 5B0ZB 3LJAD 1KX5D 1P3LA 1B6WA 5DNND 1P3PC 1AOID 3MGSC 2FJ7A 4J8UB 3H0MC 1P3LC 5JRGA 1P3ID 1M18A 2FJ7C 3REHA 5JRGC 1M18C 4Z66A 3REHC 5E5AA 3UTBD 4Z66C 4WU9D 1EQZD 5E5AC 2F8ND 3AZHA 3NQJB 3W96A 3AZHC 3WAAD 3W96C 5AVBD 5CHLB 4G92C 1KX3B 1ID3D 1BH9B 5GT3D 5AV5B 3X1TA 5C3IC 3AZED 4NFTA 3B6FA 5BT1C 4DRBA 4AWLB 2BYMB 5GT0B 3LJAA 1AOIA 4EO5B 5DNNA 5B0ZD 5B1LB 2Y2PA 2IO5C 3W99C 1AOIC 4J8UD 1TAFB 1T3UA 1M1AB 4G91B 3UTBA 4ZBJB 1EQZA 3W98B 3UTBC 1P3MB 5B1MB 1EQZC 2Y2HA 3WAAA 3KUYB 4CSRB 5G49A 1W2EA 3WAAC 5AV8B 5B33B 4X23C 2NQBC 1KX3D 5GT3A 3EG5B 3W97B 1KU5A 3H0RC 5GT3C 5AV5D 4LD9A 3UT9C 5BNXB 4LD9C 4DQYB 4NE3A 5GT0D 5B1LD 2ZY4A 3EPJA 3AZMA 4WZSB 1M1AD 1P3PB 3MGSB 3UTAB 3AZMC 4R8PB 2YFVB 1P3LB 5BO0A 3B6GC 3W98D 1M18B 3REHB 1P3MD 5B1MD 1P3AA 5BNVB 1U35A 4Z66B 3KUYD 1P3AC 3EPLA 2AROB 3KXBA 2Y2GA 1U35C 4CAYB 1KX3A 1HQ3B 5AV8D 3AZHB 5B33D 1P3FD 3KXBC 1BH9A 3A6NC 1KX3C 3W97D 5AV5A 5AV5C 3VH6W 2BYMA 3LZ1A 2L5AA 5AVCB 2Y2MA 3LZ1C 4EO5C 1KX4B 3R45B 3AFAB 4YM6C 3F6TA 2IO5B 3W99B 3VH5T 1P3PD 3MGSD 2ZY2A 4G91C 3UTAD 5FUGB 4R8PD 1P3LD 3W98A 3B0CW 5GXQA 4ZBJC 4E44A 1P3MA 5B1MA 3W98C 5JRGD 1M18D 2XD5A 3REHD 5GXQC 1P3MC 5B1MC 4CSRA 4Z66D 5E5AD 5AV8A 2AROD 5B33A 1HQ3D 5AV8C 3AZHD 3W97A 5CPIC 2RIQA 3WTPE 4X23B 4WNNB 3W97C 2NQBB 5G49B 5BNXA 3UT9B 1ULYA 3REIC 2LY8A 4LD9B 5BT1D 1KX4D 5KDMB 3AFAD 2F8NK 3UTAA 3TU4C 3W99D 4R8PA 2YFVA 1P34A 1Q9CA 2PYOB 5DNMB 3UTAC 4R8PC 3AV2B 2ZY3A 1P34C 1F1EA 1PZRA 5B24B 3AZMB 1TZYC 4WU8A 2F2AC 5BNVA 3B6GB 5CPKA 4WU8C 2AROA 5BO0B 4QLCB 4CAYA 3LELC 1HQ3A 5CPKC 3MNNA 2Y2QA 2AROC 3NQUA 1P3AB 1HQ3C 3MNNC 1U35B 3VH5A 3C1BC 4X23D 3KXBB 2NQBD 3A6NB 5AVCA 4J8VC 3UT9D 1KX4A 4UUZA 3R45A 5AVCC 3AFAA 4LD9D 2Y2IA 1KX4C 3LZ1B 3AFAC 3W99A 2JE5A 5CPIB 5FUGA 3KWQA 4H9NB 2PYOD 4YM6B 5DNMD 2NZDA 2YFWB 3AV2D 3KWQC 3WTPA 3AZLB 3AZMD 3LZ0A 2NZDC 3MGQA 3WTPC 3B6GD 2RVQC 3LZ0C 3MGQC 5AV6A 5GSUA 4QLCD 5GXQB 5AV6C 5GSUC 1P3AD 3AL0C 4X23A 4WNNA 1U35D 2NQBA 3AZFA 3KXBD 2G5IC 3A6ND 1P3BA 3AZFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSS A;  3UT9 A;  1P3O C;  1P3B C;  5KDM A;  1M19 A;  1M19 C;  4YS3 A;  3LZ1 D;  3REI B;  2PYO A;  4XUJ C;  5DNM A;  3AZN A;  4YS3 C;  3AV2 A;  4YM6 D;  2PYO C;  4KGC C;  5DNM C;  5B24 A;  3TU4 B;  3AZN C;  3AZL D;  3AV2 C;  3B6G A;  5B24 C;  1P34 B;  5CPJ B;  1P3K B;  4QLC A;  1TZY B;  3VH6 T;  3AZI C;  1BH8 B;  5GXQ D;  4QLC C;  5B40 A;  4WU8 B;  5B40 C;  3LEL B;  5CPK B;  3V9R B;  3A6N A;  1F66 A;  5F99 C;  3MNN B;  3X1V A;  4WV4 B;  3AYW B;  5CPI D;  3NQU B;  1P3G B;  1P3K D;  1F66 C;  3C1B B;  3AZJ B;  3X1V C;  3B0C T;  3MGP A;  3REJ A;  4J8V B;  3AN2 A;  3MGP C;  1A7W A;  3REJ C;  3REI D;  4H9N A;  3AN2 C;  4YM6 A;  4UUZ B;  4XZQ A;  5JA4 A;  2YFW A;  3AZL A;  3TU4 D;  4XZQ C;  3AV1 C;  3MVD B;  1S32 C;  3AZL C;  5B32 B;  4J8W A;  1P34 D;  3REK A;  3KWQ B;  4J8W C;  1TZY D;  2NZD B;  4J8X B;  3REK C;  3WTP B;  3LZ0 B;  3MGQ B;  4WU8 D;  3LEL D;  5CPK D;  5AV6 B;  5GSU B;  4H9P B;  5CPI A;  1P3K A;  3MNN D;  4KUD C;  2HIO B;  3AYW D;  1P3G D;  1P3K C;  3C1B D;  3AZJ D;  3AZF B;  4Z2M G;  1P3O B;  1KX5 B;  3VH6 A;  4J8V D;  3REI A;  1P3B B;  4H9R B;  5AVC D;  4Z5T A;  1M19 B;  3WA9 C;  5B32 G;  3TU4 A;  4Z5T C;  3MGR C;  4XUJ B;  4YS3 B;  3MVD D;  5CPJ A;  5B32 D;  4KGC B;  3AZN B;  1TZY A;  3KWQ D;  5CPJ C;  1BH8 A;  2NZD D;  5BS7 C;  4J8X D;  3WTP D;  1N1J A;  2RVQ D;  3LZ0 D;  3MGQ D;  3LEL A;  3AZI B;  3KSY A;  3V9R A;  5AV6 D;  5GSU D;  2CV5 A;  3AYW A;  5B40 B;  5B31 G;  3AZK B;  1P3G A;  3WKJ B;  4E45 A;  3X1U A;  1B67 A;  2HIO D;  3C1B A;  3AZJ A;  2CV5 C;  3AYW C;  1P3G C;  1ZLA A;  5F99 B;  3X1U C;  3AZJ C;  2CWE A;  3B0B A;  3O62 C;  4J8V A;  3AZF D;  3AZG B;  1JFI A;  1F66 B;  1ZLA C;  3X1V B;  1P3O D;  3X1S A;  1P3B D;  3X1S C;  5B2J B;  3MGP B;  1M19 D;  3REJ B;  4ZUX B;  2F8N G;  4KHA B;  3MVD A;  3AN2 B;  4XUJ D;  5B32 A;  4YS3 D;  3MVD C;  4JJN A;  5B32 C;  3AZN D;  4KGC D;  4XZQ B;  3AV1 B;  5JA4 B;  4J8X A;  1S32 B;  4JJN C;  3C1C A;  5B24 D;  4HGA C;  4J8X C;  4J8W B;  3C1C C;  2HUE C;  3AZI D;  3REK B;  4H9P A;  2HIO A;  5B40 D;  3AZK D;  3WKJ D;  2HIO C;  4H9Q A;  5B31 A;  3REL B;  3X1T C;  5F99 D;  4KUD B;  5B31 C;  1P3O A;  1KX5 A;  3B6F C;  3AZG D;  2BYK B;  5AY8 B;  1F66 D;  3X1V D;  4M6B A;  4H9R A;  3LJA C;  1KX5 C;  5DNN C;  1P3I A;  5B2J D;  1P3I C;  5CP6 B;  3MGP D;  4XUJ A;  4ZUX D;  3REJ D;  1H3O A;  3AN2 D;  4WU9 A;  3WA9 B;  2F8N A;  4KGC A;  4Z5T B;  3MGR B;  4WU9 C;  4XZQ D;  1WWI A;  3AV1 D;  1S32 D;  4H9O B;  3B0D C;  5AVB A;  3AZI A;  4J8W D;  5AVB C;  3REK D;  1P3F B;  1ID3 A;  4Z2M H;  3AZK A;  1ID3 C;  3WKJ A;  3AZE A;  1N1J B;  3AZK C;  3WKJ C;  5B2I B;  5F99 A;  5AV9 B;  3AZE C;  3REL D;  3AZG A;  5B0Z A;  2CV5 B;  4KUD D;  5B0Y B;  5AY8 D;  3AZG C;  5B0Z C;  3X1U B;  4J8U A;  1R4V A;  3O62 B;  5B2J A;  1ZLA B;  4J8U C;  4ZUX A;  4KHA A;  5B2J C;  5CP6 D;  1JFI B;  4ZUX C;  3X1S B;  2FJ7 B;  3WA9 D;  4Z5T D;  5JRG B;  3AV1 A;  3NQJ A;  3MGR D;  1S32 A;  5E5A B;  5CPJ D;  4JJN B;  4HGA B;  4DRA A;  3C1C B;  3W96 B;  2HUE B;  4G92 B;  3REL A;  5B2I D;  5AV9 D;  1WWS A;  4KUD A;  5GT0 A;  3REL C;  2F8N H;  5C3I B;  2BYK A;  5B1L A;  5AY8 A;  4AWL C;  2CV5 D;  1BFM A;  5GT0 C;  5B0Y D;  3X1T B;  5AY8 C;  5B1L C;  3X1U D;  4H9Q B;  5B31 B;  1TAF A;  1M1A A;  3O62 D;  1ZLA D;  3B6F B;  5CP6 A;  3LJA B;  1AOI B;  5DNN B;  4NE5 A;  1M1A C;  5CP6 C;  3WA9 A;  3X1S D;  1P3I B;  2FJ7 D;  3MGR A;  3KUY A;  4H9O A;  3UTB B;  1H3O B;  4WU9 B;  3KUY C;  1EQZ B;  2F8N B;  5BS7 A;  1P3F A;  4JJN D;  4NE6 A;  3B0D B;  5B33 C;  1P3F C;  3VH5 W;  3WAA B;  3C1C D;  3W96 D;  5AVB B;  5B2I A;  5AV9 A;  1ID3 B;  5B2I C;  5AV9 C;  5GT3 B;  5B0Y A;  4H9S A;  3AZE B;  1HTA A;  5B0Y C;  4H9S C;  3X1T D;  3O62 A;  5B31 D;  3B6F D;  1P3P A;  3MGS A;  5B0Z B;  3LJA D;  1KX5 D;  1P3L A;  1B6W A;  5DNN D;  1P3P C;  1AOI D;  3MGS C;  2FJ7 A;  4J8U B;  1P3L C;  5JRG A;  1P3I D;  1M18 A;  2FJ7 C;  3REH A;  5JRG C;  1M18 C;  4Z66 A;  3REH C;  5E5A A;  3UTB D;  4Z66 C;  4WU9 D;  1EQZ D;  5E5A C;  2F8N D;  3AZH A;  3NQJ B;  3W96 A;  3AZH C;  3WAA D;  3W96 C;  5AVB D;  5CHL B;  4G92 C;  1KX3 B;  1ID3 D;  1BH9 B;  5GT3 D;  5AV5 B;  3X1T A;  5C3I C;  3AZE D;  4NFT A;  3B6F A;  5BT1 C;  4DRB A;  4AWL B;  2BYM B;  5GT0 B;  3LJA A;  1AOI A;  4EO5 B;  5DNN A;  5B0Z D;  5B1L B;  2IO5 C;  3W99 C;  1AOI C;  4J8U D;  1TAF B;  1M1A B;  4G91 B;  3UTB A;  4ZBJ B;  1EQZ A;  3W98 B;  3UTB C;  1P3M B;  5B1M B;  1EQZ C;  3WAA A;  3KUY B;  4CSR B;  5G49 A;  3WAA C;  5AV8 B;  5B33 B;  4X23 C;  2NQB C;  1KX3 D;  5GT3 A;  3W97 B;  1KU5 A;  5GT3 C;  5AV5 D;  4LD9 A;  3UT9 C;  5BNX B;  4LD9 C;  4NE3 A;  5GT0 D;  5B1L D;  3AZM A;  4WZS B;  1M1A D;  1P3P B;  3MGS B;  3UTA B;  3AZM C;  4R8P B;  2YFV B;  1P3L B;  5BO0 A;  3B6G C;  3W98 D;  1M18 B;  3REH B;  1P3M D;  5B1M D;  1P3A A;  5BNV B;  1U35 A;  4Z66 B;  3KUY D;  1P3A C;  2ARO B;  3KXB A;  1U35 C;  4CAY B;  1KX3 A;  1HQ3 B;  5AV8 D;  3AZH B;  5B33 D;  1P3F D;  3KXB C;  1BH9 A;  3A6N C;  1KX3 C;  3W97 D;  5AV5 A;  5AV5 C;  3VH6 W;  2BYM A;  3LZ1 A;  2L5A A;  5AVC B;  3LZ1 C;  4EO5 C;  1KX4 B;  3R45 B;  3AFA B;  4YM6 C;  2IO5 B;  3W99 B;  3VH5 T;  1P3P D;  3MGS D;  4G91 C;  3UTA D;  5FUG B;  4R8P D;  1P3L D;  3W98 A;  3B0C W;  5GXQ A;  4ZBJ C;  4E44 A;  1P3M A;  5B1M A;  3W98 C;  5JRG D;  1M18 D;  3REH D;  5GXQ C;  1P3M C;  5B1M C;  4CSR A;  4Z66 D;  5E5A D;  5AV8 A;  2ARO D;  5B33 A;  1HQ3 D;  5AV8 C;  3AZH D;  3W97 A;  5CPI C;  3WTP E;  4X23 B;  4WNN B;  3W97 C;  2NQB B;  5G49 B;  5BNX A;  3UT9 B;  1ULY A;  3REI C;  2LY8 A;  4LD9 B;  5BT1 D;  1KX4 D;  5KDM B;  3AFA D;  2F8N K;  3UTA A;  3TU4 C;  3W99 D;  4R8P A;  2YFV A;  1P34 A;  1Q9C A;  2PYO B;  5DNM B;  3UTA C;  4R8P C;  3AV2 B;  1P34 C;  1F1E A;  5B24 B;  3AZM B;  1TZY C;  4WU8 A;  5BNV A;  3B6G B;  5CPK A;  4WU8 C;  2ARO A;  5BO0 B;  4QLC B;  4CAY A;  3LEL C;  1HQ3 A;  5CPK C;  3MNN A;  2ARO C;  3NQU A;  1P3A B;  1HQ3 C;  3MNN C;  1U35 B;  3VH5 A;  3C1B C;  4X23 D;  3KXB B;  2NQB D;  3A6N B;  5AVC A;  4J8V C;  3UT9 D;  1KX4 A;  4UUZ A;  3R45 A;  5AVC C;  3AFA A;  4LD9 D;  1KX4 C;  3LZ1 B;  3AFA C;  3W99 A;  5FUG A;  3KWQ A;  4H9N B;  2PYO D;  4YM6 B;  5DNM D;  2NZD A;  2YFW B;  3AV2 D;  3KWQ C;  3WTP A;  3AZL B;  3AZM D;  3LZ0 A;  2NZD C;  3MGQ A;  3WTP C;  3B6G D;  2RVQ C;  3LZ0 C;  3MGQ C;  5AV6 A;  5GSU A;  4QLC D;  5GXQ B;  5AV6 C;  5GSU C;  1P3A D;  4X23 A;  4WNN A;  1U35 D;  2NQB A;  3AZF A;  3KXB D;  5CPI B;  3A6N D;  1P3B A;  3AZF C; 
#chains in the Genus database with same CATH topology
 2JSS A;  3UT9 A;  1P3O C;  1P3B C;  5KDM A;  1M19 A;  1M19 C;  4YS3 A;  3LZ1 D;  3REI B;  2PYO A;  4XUJ C;  5DNM A;  3AZN A;  4YS3 C;  3FDD A;  3AV2 A;  4YM6 D;  2PYO C;  4KGC C;  5DNM C;  5B24 A;  3TU4 B;  2G5H C;  3AZN C;  3AZL D;  3AV2 C;  3B6G A;  5B24 C;  1P34 B;  5CPJ B;  1P3K B;  4QLC A;  1TZY B;  3VH6 T;  3AZI C;  1BH8 B;  3A1I A;  5GXQ D;  4QLC C;  5B40 A;  4WU8 B;  5B40 C;  3LEL B;  5CPK B;  3V9R B;  3A6N A;  1F66 A;  5F99 C;  3MNN B;  3X1V A;  4WV4 B;  2JCH A;  3AYW B;  3NQU B;  5CPI D;  1P3G B;  1P3K D;  1F66 C;  3C1B B;  3AZJ B;  3X1V C;  3B0C T;  3MGP A;  2FFF B;  3REJ A;  2UWX A;  4J8V B;  3AN2 A;  3MGP C;  1A7W A;  3REJ C;  3REI D;  4H9N A;  3AN2 C;  4YM6 A;  4UUZ B;  4XZQ A;  5JA4 A;  2YFW A;  3AZL A;  4UPK A;  4XZQ C;  3TU4 D;  3AV1 C;  3MVD B;  1S32 C;  3AZL C;  5B32 B;  2Y2J A;  4J8W A;  1P34 D;  3REK A;  3KWQ B;  4J8W C;  1TZY D;  2NZD B;  4J8X B;  3REK C;  3WTP B;  3LZ0 B;  3MGQ B;  4WU8 D;  3LEL D;  5CPK D;  5AV6 B;  5GSU B;  4H9P B;  5CPI A;  1P3K A;  3MNN D;  4KUD C;  2HIO B;  2ZY5 A;  3IP4 C;  3AYW D;  1P3G D;  1P3K C;  2J8P A;  3C1B D;  3AZJ D;  3EPH A;  3AZF B;  4Z2M G;  1P3O B;  1KX5 B;  3VH6 A;  4J8V D;  3REI A;  2Y2N A;  1P3B B;  4H9R B;  5AVC D;  4Z5T A;  1M19 B;  3WA9 C;  5B32 G;  3TU4 A;  4Z5T C;  2W8S A;  3MGR C;  4XUJ B;  4YS3 B;  3MVD D;  5CPJ A;  5B32 D;  4KGC B;  3AZN B;  1TZY A;  3KWQ D;  5CPJ C;  2VQR A;  1BH8 A;  2NZD D;  5BS7 C;  4J8X D;  3WTP D;  1N1J A;  2RVQ D;  3LZ0 D;  3MGQ D;  3LEL A;  3AZI B;  3KSY A;  3V9R A;  5AV6 D;  5GSU D;  2CV5 A;  3AYW A;  5B40 B;  5B31 G;  3AZK B;  1P3G A;  3WKJ B;  4E45 A;  3X1U A;  1B67 A;  2HIO D;  3C1B A;  3AZJ A;  2CV5 C;  3AYW C;  1P3G C;  1ZLA A;  5F99 B;  3X1U C;  3AZJ C;  2CWE A;  3B0B A;  3O62 C;  4J8V A;  3AZF D;  3AZG B;  1JFI A;  1F66 B;  1ZLA C;  3X1V B;  1P3O D;  3X1S A;  1P3B D;  3X1S C;  5B2J B;  3MGP B;  1M19 D;  3REJ B;  4ZUX B;  3EPK A;  2F8N G;  4KHA B;  3MVD A;  3AN2 B;  4XUJ D;  5B32 A;  4YS3 D;  3MVD C;  4JJN A;  5B32 C;  3AZN D;  4KGC D;  4XZQ B;  3AV1 B;  5JA4 B;  4J8X A;  1S32 B;  4JJN C;  3C1C A;  5B24 D;  4HGA C;  4J8X C;  4J8W B;  3C1C C;  2HUE C;  2Y2O A;  3REK B;  3AZI D;  4H9P A;  2HIO A;  5B40 D;  3AZK D;  3WKJ D;  2HIO C;  4H9Q A;  5B31 A;  3REL B;  3X1T C;  5F99 D;  4KUD B;  5B31 C;  1P3O A;  1KX5 A;  3B6F C;  3AZG D;  2BYK B;  5AY8 B;  1F66 D;  3X1V D;  4M6B A;  4H9R A;  3LJA C;  1KX5 C;  5DNN C;  1P3I A;  5B2J D;  1P3I C;  1Z2C B;  5CP6 B;  3MGP D;  4XUJ A;  4ZUX D;  3REJ D;  1H3O A;  3AN2 D;  2DF4 C;  4WU9 A;  3WA9 B;  2F8N A;  4KGC A;  4Z5T B;  2ZM5 A;  3MGR B;  4WU9 C;  4XZQ D;  1WWI A;  3AV1 D;  1S32 D;  4H9O B;  3B0D C;  5AVB A;  3P5J B;  3AZI A;  4J8W D;  5AVB C;  3REK D;  1P3F B;  1ID3 A;  4Z2M H;  3AZK A;  1ID3 C;  3WKJ A;  3AZE A;  1N1J B;  3AZK C;  3WKJ C;  5B2I B;  5F99 A;  5AV9 B;  3AZE C;  3REL D;  3AZG A;  5B0Z A;  2CV5 B;  4KUD D;  5B0Y B;  5AY8 D;  3AZG C;  5B0Z C;  3X1U B;  4J8U A;  1R4V A;  3O62 B;  5B2J A;  1ZLA B;  4J8U C;  4ZUX A;  4KHA A;  5B2J C;  5CP6 D;  1JFI B;  4ZUX C;  3X1S B;  2FJ7 B;  3WA9 D;  4Z5T D;  5JRG B;  3AV1 A;  3NQJ A;  3MGR D;  1S32 A;  2XD1 A;  5E5A B;  5CPJ D;  3A1K A;  4JJN B;  4HGA B;  4DRA A;  3C1C B;  3W96 B;  2HUE B;  4G92 B;  3REL A;  5B2I D;  5AV9 D;  1WWS A;  4KUD A;  5GT0 A;  3REL C;  2F8N H;  5C3I B;  2BYK A;  5B1L A;  5AY8 A;  4AWL C;  2CV5 D;  1BFM A;  5GT0 C;  5B0Y D;  3X1T B;  5AY8 C;  5B1L C;  3X1U D;  2Y2L A;  4WJ3 C;  4H9Q B;  5B31 B;  1TAF A;  1M1A A;  3O62 D;  1ZLA D;  3B6F B;  5CP6 A;  3LJA B;  1AOI B;  5DNN B;  4NE5 A;  1M1A C;  5CP6 C;  3WA9 A;  3X1S D;  1P3I B;  2FJ7 D;  3MGR A;  2DQN C;  3KUY A;  4H9O A;  3UTB B;  1H3O B;  4WU9 B;  3KUY C;  1EQZ B;  2F8N B;  5BS7 A;  2BG1 A;  1P3F A;  4JJN D;  4NE6 A;  2Y2K A;  3B0D B;  5B33 C;  1P3F C;  3VH5 W;  3H0L C;  3C1C D;  3W96 D;  3WAA B;  5AVB B;  5B2I A;  5AV9 A;  1ID3 B;  5B2I C;  5AV9 C;  3KFU G;  5GT3 B;  5B0Y A;  4H9S A;  3AZE B;  1HTA A;  5B0Y C;  4H9S C;  3X1T D;  3O62 A;  5B31 D;  3B6F D;  1P3P A;  3MGS A;  5B0Z B;  3LJA D;  1KX5 D;  1P3L A;  1B6W A;  5DNN D;  1P3P C;  1AOI D;  3MGS C;  2FJ7 A;  4J8U B;  3H0M C;  1P3L C;  5JRG A;  1P3I D;  1M18 A;  2FJ7 C;  3REH A;  5JRG C;  1M18 C;  4Z66 A;  3REH C;  5E5A A;  3UTB D;  4Z66 C;  4WU9 D;  1EQZ D;  5E5A C;  2F8N D;  3AZH A;  3NQJ B;  3W96 A;  3AZH C;  3WAA D;  3W96 C;  5AVB D;  5CHL B;  4G92 C;  1KX3 B;  1ID3 D;  1BH9 B;  5GT3 D;  5AV5 B;  3X1T A;  5C3I C;  3AZE D;  4NFT A;  3B6F A;  5BT1 C;  4DRB A;  4AWL B;  2BYM B;  5GT0 B;  3LJA A;  1AOI A;  4EO5 B;  5DNN A;  5B0Z D;  5B1L B;  2Y2P A;  2IO5 C;  3W99 C;  1AOI C;  4J8U D;  1TAF B;  1T3U A;  1M1A B;  4G91 B;  3UTB A;  4ZBJ B;  1EQZ A;  3W98 B;  3UTB C;  1P3M B;  5B1M B;  1EQZ C;  2Y2H A;  3WAA A;  3KUY B;  4CSR B;  5G49 A;  1W2E A;  3WAA C;  5AV8 B;  5B33 B;  4X23 C;  2NQB C;  1KX3 D;  5GT3 A;  3EG5 B;  3W97 B;  1KU5 A;  3H0R C;  5GT3 C;  5AV5 D;  4LD9 A;  3UT9 C;  5BNX B;  4LD9 C;  4DQY B;  4NE3 A;  5GT0 D;  5B1L D;  2ZY4 A;  3EPJ A;  3AZM A;  4WZS B;  1M1A D;  1P3P B;  3MGS B;  3UTA B;  3AZM C;  4R8P B;  2YFV B;  1P3L B;  5BO0 A;  3B6G C;  3W98 D;  1M18 B;  3REH B;  1P3M D;  5B1M D;  1P3A A;  5BNV B;  1U35 A;  4Z66 B;  3KUY D;  1P3A C;  3EPL A;  2ARO B;  3KXB A;  2Y2G A;  1U35 C;  4CAY B;  1KX3 A;  1HQ3 B;  5AV8 D;  3AZH B;  5B33 D;  1P3F D;  3KXB C;  1BH9 A;  3A6N C;  1KX3 C;  3W97 D;  5AV5 A;  5AV5 C;  3VH6 W;  2BYM A;  3LZ1 A;  2L5A A;  5AVC B;  2Y2M A;  3LZ1 C;  4EO5 C;  1KX4 B;  3R45 B;  3AFA B;  4YM6 C;  3F6T A;  2IO5 B;  3W99 B;  3VH5 T;  1P3P D;  3MGS D;  2ZY2 A;  4G91 C;  3UTA D;  5FUG B;  4R8P D;  1P3L D;  3W98 A;  3B0C W;  5GXQ A;  4ZBJ C;  4E44 A;  1P3M A;  5B1M A;  3W98 C;  5JRG D;  1M18 D;  2XD5 A;  3REH D;  5GXQ C;  1P3M C;  5B1M C;  4CSR A;  4Z66 D;  5E5A D;  5AV8 A;  2ARO D;  5B33 A;  1HQ3 D;  5AV8 C;  3AZH D;  3W97 A;  5CPI C;  2RIQ A;  3WTP E;  4X23 B;  4WNN B;  3W97 C;  2NQB B;  5G49 B;  5BNX A;  3UT9 B;  1ULY A;  3REI C;  2LY8 A;  4LD9 B;  5BT1 D;  1KX4 D;  5KDM B;  3AFA D;  2F8N K;  3UTA A;  3TU4 C;  3W99 D;  4R8P A;  2YFV A;  1P34 A;  1Q9C A;  2PYO B;  5DNM B;  3UTA C;  4R8P C;  3AV2 B;  2ZY3 A;  1P34 C;  1F1E A;  1PZR A;  5B24 B;  3AZM B;  1TZY C;  4WU8 A;  2F2A C;  5BNV A;  3B6G B;  5CPK A;  4WU8 C;  2ARO A;  5BO0 B;  4QLC B;  4CAY A;  3LEL C;  1HQ3 A;  5CPK C;  3MNN A;  2Y2Q A;  2ARO C;  3NQU A;  1P3A B;  1HQ3 C;  3MNN C;  1U35 B;  3VH5 A;  3C1B C;  4X23 D;  3KXB B;  2NQB D;  3A6N B;  5AVC A;  4J8V C;  3UT9 D;  1KX4 A;  4UUZ A;  3R45 A;  5AVC C;  3AFA A;  4LD9 D;  2Y2I A;  1KX4 C;  3LZ1 B;  3AFA C;  3W99 A;  2JE5 A;  5CPI B;  5FUG A;  3KWQ A;  4H9N B;  2PYO D;  4YM6 B;  5DNM D;  2NZD A;  2YFW B;  3AV2 D;  3KWQ C;  3WTP A;  3AZL B;  3AZM D;  3LZ0 A;  2NZD C;  3MGQ A;  3WTP C;  3B6G D;  2RVQ C;  3LZ0 C;  3MGQ C;  5AV6 A;  5GSU A;  4QLC D;  5GXQ B;  5AV6 C;  5GSU C;  1P3A D;  3AL0 C;  4X23 A;  4WNN A;  1U35 D;  2NQB A;  3AZF A;  3KXB D;  2G5I C;  3A6N D;  1P3B A;  3AZF C; 
#chains in the Genus database with same CATH homology
 2JSS A;  3UT9 A;  1P3O C;  1P3B C;  5KDM A;  1M19 A;  1M19 C;  4YS3 A;  3LZ1 D;  3REI B;  2PYO A;  4XUJ C;  5DNM A;  3AZN A;  4YS3 C;  3FDD A;  3AV2 A;  4YM6 D;  2PYO C;  4KGC C;  5DNM C;  5B24 A;  3TU4 B;  2G5H C;  3AZN C;  3AZL D;  3AV2 C;  3B6G A;  5B24 C;  1P34 B;  5CPJ B;  1P3K B;  4QLC A;  1TZY B;  3VH6 T;  3AZI C;  1BH8 B;  3A1I A;  5GXQ D;  4QLC C;  5B40 A;  4WU8 B;  5B40 C;  3LEL B;  5CPK B;  3V9R B;  3A6N A;  1F66 A;  5F99 C;  3MNN B;  3X1V A;  4WV4 B;  2JCH A;  3AYW B;  3NQU B;  5CPI D;  1P3G B;  1P3K D;  1F66 C;  3C1B B;  3AZJ B;  3X1V C;  3B0C T;  3MGP A;  2FFF B;  3REJ A;  2UWX A;  4J8V B;  3AN2 A;  3MGP C;  1A7W A;  3REJ C;  3REI D;  4H9N A;  3AN2 C;  4YM6 A;  4UUZ B;  4XZQ A;  5JA4 A;  2YFW A;  3AZL A;  4UPK A;  4XZQ C;  3TU4 D;  3AV1 C;  3MVD B;  1S32 C;  3AZL C;  5B32 B;  2Y2J A;  4J8W A;  1P34 D;  3REK A;  3KWQ B;  4J8W C;  1TZY D;  2NZD B;  4J8X B;  3REK C;  3WTP B;  3LZ0 B;  3MGQ B;  4WU8 D;  3LEL D;  5CPK D;  5AV6 B;  5GSU B;  4H9P B;  5CPI A;  1P3K A;  3MNN D;  4KUD C;  2HIO B;  2ZY5 A;  3IP4 C;  3AYW D;  1P3G D;  1P3K C;  2J8P A;  3C1B D;  3AZJ D;  3EPH A;  3AZF B;  4Z2M G;  1P3O B;  1KX5 B;  3VH6 A;  4J8V D;  3REI A;  2Y2N A;  1P3B B;  4H9R B;  5AVC D;  4Z5T A;  1M19 B;  3WA9 C;  5B32 G;  3TU4 A;  4Z5T C;  2W8S A;  3MGR C;  4XUJ B;  4YS3 B;  3MVD D;  5CPJ A;  5B32 D;  4KGC B;  3AZN B;  1TZY A;  3KWQ D;  5CPJ C;  2VQR A;  1BH8 A;  2NZD D;  5BS7 C;  4J8X D;  3WTP D;  1N1J A;  2RVQ D;  3LZ0 D;  3MGQ D;  3LEL A;  3AZI B;  3KSY A;  3V9R A;  5AV6 D;  5GSU D;  2CV5 A;  3AYW A;  5B40 B;  5B31 G;  3AZK B;  1P3G A;  3WKJ B;  4E45 A;  3X1U A;  1B67 A;  2HIO D;  3C1B A;  3AZJ A;  2CV5 C;  3AYW C;  1P3G C;  1ZLA A;  5F99 B;  3X1U C;  3AZJ C;  2CWE A;  3B0B A;  3O62 C;  4J8V A;  3AZF D;  3AZG B;  1JFI A;  1F66 B;  1ZLA C;  3X1V B;  1P3O D;  3X1S A;  1P3B D;  3X1S C;  5B2J B;  3MGP B;  1M19 D;  3REJ B;  4ZUX B;  3EPK A;  2F8N G;  4KHA B;  3MVD A;  3AN2 B;  4XUJ D;  5B32 A;  4YS3 D;  3MVD C;  4JJN A;  5B32 C;  3AZN D;  4KGC D;  4XZQ B;  3AV1 B;  5JA4 B;  4J8X A;  1S32 B;  4JJN C;  3C1C A;  5B24 D;  4HGA C;  4J8X C;  4J8W B;  3C1C C;  2HUE C;  2Y2O A;  3REK B;  3AZI D;  4H9P A;  2HIO A;  5B40 D;  3AZK D;  3WKJ D;  2HIO C;  4H9Q A;  5B31 A;  3REL B;  3X1T C;  5F99 D;  4KUD B;  5B31 C;  1P3O A;  1KX5 A;  3B6F C;  3AZG D;  2BYK B;  5AY8 B;  1F66 D;  3X1V D;  4M6B A;  4H9R A;  3LJA C;  1KX5 C;  5DNN C;  1P3I A;  5B2J D;  1P3I C;  1Z2C B;  5CP6 B;  3MGP D;  4XUJ A;  4ZUX D;  3REJ D;  1H3O A;  3AN2 D;  2DF4 C;  4WU9 A;  3WA9 B;  2F8N A;  4KGC A;  4Z5T B;  2ZM5 A;  3MGR B;  4WU9 C;  4XZQ D;  1WWI A;  3AV1 D;  1S32 D;  4H9O B;  3B0D C;  5AVB A;  3P5J B;  3AZI A;  4J8W D;  5AVB C;  3REK D;  1P3F B;  1ID3 A;  4Z2M H;  3AZK A;  1ID3 C;  3WKJ A;  3AZE A;  1N1J B;  3AZK C;  3WKJ C;  5B2I B;  5F99 A;  5AV9 B;  3AZE C;  3REL D;  3AZG A;  5B0Z A;  2CV5 B;  4KUD D;  5B0Y B;  5AY8 D;  3AZG C;  5B0Z C;  3X1U B;  4J8U A;  1R4V A;  3O62 B;  5B2J A;  1ZLA B;  4J8U C;  4ZUX A;  4KHA A;  5B2J C;  5CP6 D;  1JFI B;  4ZUX C;  3X1S B;  2FJ7 B;  3WA9 D;  4Z5T D;  5JRG B;  3AV1 A;  3NQJ A;  3MGR D;  1S32 A;  2XD1 A;  5E5A B;  5CPJ D;  3A1K A;  4JJN B;  4HGA B;  4DRA A;  3C1C B;  3W96 B;  2HUE B;  4G92 B;  3REL A;  5B2I D;  5AV9 D;  1WWS A;  4KUD A;  5GT0 A;  3REL C;  2F8N H;  5C3I B;  2BYK A;  5B1L A;  5AY8 A;  4AWL C;  2CV5 D;  1BFM A;  5GT0 C;  5B0Y D;  3X1T B;  5AY8 C;  5B1L C;  3X1U D;  2Y2L A;  4WJ3 C;  4H9Q B;  5B31 B;  1TAF A;  1M1A A;  3O62 D;  1ZLA D;  3B6F B;  5CP6 A;  3LJA B;  1AOI B;  5DNN B;  4NE5 A;  1M1A C;  5CP6 C;  3WA9 A;  3X1S D;  1P3I B;  2FJ7 D;  3MGR A;  2DQN C;  3KUY A;  4H9O A;  3UTB B;  1H3O B;  4WU9 B;  3KUY C;  1EQZ B;  2F8N B;  5BS7 A;  2BG1 A;  1P3F A;  4JJN D;  4NE6 A;  2Y2K A;  3B0D B;  5B33 C;  1P3F C;  3VH5 W;  3H0L C;  3C1C D;  3W96 D;  3WAA B;  5AVB B;  5B2I A;  5AV9 A;  1ID3 B;  5B2I C;  5AV9 C;  3KFU G;  5GT3 B;  5B0Y A;  4H9S A;  3AZE B;  1HTA A;  5B0Y C;  4H9S C;  3X1T D;  3O62 A;  5B31 D;  3B6F D;  1P3P A;  3MGS A;  5B0Z B;  3LJA D;  1KX5 D;  1P3L A;  1B6W A;  5DNN D;  1P3P C;  1AOI D;  3MGS C;  2FJ7 A;  4J8U B;  3H0M C;  1P3L C;  5JRG A;  1P3I D;  1M18 A;  2FJ7 C;  3REH A;  5JRG C;  1M18 C;  4Z66 A;  3REH C;  5E5A A;  3UTB D;  4Z66 C;  4WU9 D;  1EQZ D;  5E5A C;  2F8N D;  3AZH A;  3NQJ B;  3W96 A;  3AZH C;  3WAA D;  3W96 C;  5AVB D;  5CHL B;  4G92 C;  1KX3 B;  1ID3 D;  1BH9 B;  5GT3 D;  5AV5 B;  3X1T A;  5C3I C;  3AZE D;  4NFT A;  3B6F A;  5BT1 C;  4DRB A;  4AWL B;  2BYM B;  5GT0 B;  3LJA A;  1AOI A;  4EO5 B;  5DNN A;  5B0Z D;  5B1L B;  2Y2P A;  2IO5 C;  3W99 C;  1AOI C;  4J8U D;  1TAF B;  1T3U A;  1M1A B;  4G91 B;  3UTB A;  4ZBJ B;  1EQZ A;  3W98 B;  3UTB C;  1P3M B;  5B1M B;  1EQZ C;  2Y2H A;  3WAA A;  3KUY B;  4CSR B;  5G49 A;  1W2E A;  3WAA C;  5AV8 B;  5B33 B;  4X23 C;  2NQB C;  1KX3 D;  5GT3 A;  3EG5 B;  3W97 B;  1KU5 A;  3H0R C;  5GT3 C;  5AV5 D;  4LD9 A;  3UT9 C;  5BNX B;  4LD9 C;  4DQY B;  4NE3 A;  5GT0 D;  5B1L D;  2ZY4 A;  3EPJ A;  3AZM A;  4WZS B;  1M1A D;  1P3P B;  3MGS B;  3UTA B;  3AZM C;  4R8P B;  2YFV B;  1P3L B;  5BO0 A;  3B6G C;  3W98 D;  1M18 B;  3REH B;  1P3M D;  5B1M D;  1P3A A;  5BNV B;  1U35 A;  4Z66 B;  3KUY D;  1P3A C;  3EPL A;  2ARO B;  3KXB A;  2Y2G A;  1U35 C;  4CAY B;  1KX3 A;  1HQ3 B;  5AV8 D;  3AZH B;  5B33 D;  1P3F D;  3KXB C;  1BH9 A;  3A6N C;  1KX3 C;  3W97 D;  5AV5 A;  5AV5 C;  3VH6 W;  2BYM A;  3LZ1 A;  2L5A A;  5AVC B;  2Y2M A;  3LZ1 C;  4EO5 C;  1KX4 B;  3R45 B;  3AFA B;  4YM6 C;  3F6T A;  2IO5 B;  3W99 B;  3VH5 T;  1P3P D;  3MGS D;  2ZY2 A;  4G91 C;  3UTA D;  5FUG B;  4R8P D;  1P3L D;  3W98 A;  3B0C W;  5GXQ A;  4ZBJ C;  4E44 A;  1P3M A;  5B1M A;  3W98 C;  5JRG D;  1M18 D;  2XD5 A;  3REH D;  5GXQ C;  1P3M C;  5B1M C;  4CSR A;  4Z66 D;  5E5A D;  5AV8 A;  2ARO D;  5B33 A;  1HQ3 D;  5AV8 C;  3AZH D;  3W97 A;  5CPI C;  2RIQ A;  3WTP E;  4X23 B;  4WNN B;  3W97 C;  2NQB B;  5G49 B;  5BNX A;  3UT9 B;  1ULY A;  3REI C;  2LY8 A;  4LD9 B;  5BT1 D;  1KX4 D;  5KDM B;  3AFA D;  2F8N K;  3UTA A;  3TU4 C;  3W99 D;  4R8P A;  2YFV A;  1P34 A;  1Q9C A;  2PYO B;  5DNM B;  3UTA C;  4R8P C;  3AV2 B;  2ZY3 A;  1P34 C;  1F1E A;  1PZR A;  5B24 B;  3AZM B;  1TZY C;  4WU8 A;  2F2A C;  5BNV A;  3B6G B;  5CPK A;  4WU8 C;  2ARO A;  5BO0 B;  4QLC B;  4CAY A;  3LEL C;  1HQ3 A;  5CPK C;  3MNN A;  2Y2Q A;  2ARO C;  3NQU A;  1P3A B;  1HQ3 C;  3MNN C;  1U35 B;  3VH5 A;  3C1B C;  4X23 D;  3KXB B;  2NQB D;  3A6N B;  5AVC A;  4J8V C;  3UT9 D;  1KX4 A;  4UUZ A;  3R45 A;  5AVC C;  3AFA A;  4LD9 D;  2Y2I A;  1KX4 C;  3LZ1 B;  3AFA C;  3W99 A;  2JE5 A;  5CPI B;  5FUG A;  3KWQ A;  4H9N B;  2PYO D;  4YM6 B;  5DNM D;  2NZD A;  2YFW B;  3AV2 D;  3KWQ C;  3WTP A;  3AZL B;  3AZM D;  3LZ0 A;  2NZD C;  3MGQ A;  3WTP C;  3B6G D;  2RVQ C;  3LZ0 C;  3MGQ C;  5AV6 A;  5GSU A;  4QLC D;  5GXQ B;  5AV6 C;  5GSU C;  1P3A D;  3AL0 C;  4X23 A;  4WNN A;  1U35 D;  2NQB A;  3AZF A;  3KXB D;  2G5I C;  3A6N D;  1P3B A;  3AZF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...