4KGCC

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcC00
5B1LC 5F99A 5GT3D 3X1TA 4H9OA 2PYOD 3UTAC 1H3OA 4XZQC 4NE6A 1AOIC 2F8NG 3MGQD 1ID3D 3X1VB 3KUYC 5E5AA 1P3GB 2AROA 4J8UD 1BH8A 5GSUC 3KXBB 5CPKA 4QLCC 3REHD 1N1JA 3X1SD 3MGSD 3B6FB 2BYMA 3AZJD 4Z5TA 5AVBC 3AN2A 3KWQB 3LZ1D 1M19A 3AV2B 1P3AD 3W97A 3W99D 1P3FA 3X1TB 4H9OB 1F66D 3B0BA 4H9RA 3AZKD 1H3OB 5CPIA 3W98C 4YM6D 3AZHD 2IO5C 4WU8C 2F8NH 2YFVA 5E5AB 4X23C 2AROB 1BH8B 5CPKB 1KX4D 3VH5W 4J8VC 1M18A 4J8XD 3WKJA 1P3KC 4Z5TB 1P3LC 3AN2B 5B1MB 1U35D 5CHLB 5B40A 1M19B 3AZMC 2HIOD 3W97B 2HUEC 5CPJA 4KUDA 1P3FB 3LZ0C 2F8ND 1JFIA 5B32G 3WAAA 4H9RB 4KGCD 5CPIB 1ZLAC 2NQBA 5B2IC 2YFVB 5JA4A 1KX5C 3MNNC 5B0YC 4H9SA 4DRAA 3W96D 2CV5A 1P3OA 1M18B 3VH5A 3WKJB 5AV8A 3AZLA 2YFWA 5AV9C 3UT9A 4Z66D 3B6GC 5FUGB 3C1BA 4XUJA 3A6ND 4KUDB 5B1LA 3O62D 3LJAC 4ZUXB 1JFIB 5BNXB 5AY8C 2FJ7C 3UTAA 4XZQA 1AOIA 2CWEA 2RVQD 3KUYA 5AVCD 4WZSB 1P3BC 5CP6D 3TU4D 5B24C 4J8WD 1ULYA 5JA4B 5GSUA 4QLCA 5DNND 3AV1D 4HGAB 1P34C 2CV5B 1P3OB 3C1CD 5AVBA 5AV8B 2YFWB 2NZDD 1P3MD 3UT9B 4EO5B 3C1BB 4XUJB 5B1LB 3RELD 5BO0A 5AV5B 3AZNC 5C3IC 3UTAB 4XZQB 1M1AC 1AOIB 3W98A 3WTPD 3MGRD 3AFAC 3AZED 3MGPD 3KUYB 4G92B 4X23A 1S32D 5GSUB 1TZYD 5B2JD 4QLCB 4JJNC 1HQ3C 4J8VA 5GT3C 1P3KA 5AVBB 2PYOC 3AZMA 3MGQC 3X1VD 1P3GD 3LZ0A 1ID3C 3LELD 5BO0B 3REJD 4ZBJC 4J8UC 1ZLAA 3W98B 2IO5B 3REHC 5B2IA 3MGSC 3KWQD 3AZJC 4X23B 1KX5A 3MNNA 3LZ1C 5B0YA 1P3AC 3MVDC 3X1TD 1KX3B 3W99C 4J8VB 1P3IA 1P3KB 3AZFD 1F66C 5AV9A 3AZKC 3AZMB 3B6GA 2HUEB 4YM6C 3AZHC 3LZ0B 3LJAA 5AY8A 2FJ7A 1ZLAB 4R8PD 5JRGD 1KX4C 5B2IB 5B1MD 4J8XC 1P3BA 5B24A 1KX5B 1U35C 3MNNB 4UUZA 5B0YB 2HIOC 4WU9B 1P34A 1P3IB 3AZGD 3REID 5AV9B 4KGCC 3B6GB 5AV6A 3LJAB 3AZNA 5AY8B 2FJ7B 5F99B 1M1AA 3NQJA 3AFAA 3X1UA 3W96C 1P3BB 5B24B 1BFMA 4UUZB 5GT0D 4JJNA 3AYWD 4Z66C 5B33D 4ZUXD 1HQ3A 3A6NC 1P34B 5GT3A 3O62C 1N1JB 1WWSA 2PYOA 2BYMB 5B31G 5AV6B 5BS7C 1ID3A 2RVQC 5AVCC 3WTPE 2JSSA 5CP6C 3TU4C 3AZNB 4J8WC 4J8UA 3NQJB 3AFAB 3WA9D 3REHA 3X1UB 3AZID 3MGSA 5AV8D 3VH6W 3AZJA 3C1CC 4WNNA 4XUJD 3LZ1A 1P3AA 3MVDA 2NZDC 4JJNB 1P3MC 3W99A 1HQ3B 4YS3D 5AV5D 5GT3B 3RELC 1P3PD 1F66A 1B67A 2PYOB 3AZKA 3WTPC 3V9RA 3MGRC 3AZHA 5B40B 1ID3B 3AZEC 4H9QA 5B0ZD 3MGPC 5CPJB 5GXQD 1S32C 4ZBJB 4J8UB 3WAAB 1TZYC 5B2JC 1KX4A 3REHB 3MGSB 4J8XA 3AZJB 5DNMD 3UTBD 2NQBB 1U35A 2BYKA 3LZ1B 1EQZC 1P3AB 2HIOA 3MVDB 3W99B 1P3GC 2F8NA 5B31D 3LELC 3B0DC 1F66B 4E44A 3REJC 4KGCA 3AZLB 3AZHB 5B32D 3KWQC 4LD9D 1KX3D 3REKD 3W96A 4WU8A 3AZFC 1U35B 2BYKB 2HIOB 4Z66A 3A6NA 3NQUA 3O62A 2F8NB 1P3LA 4KGCB 4R8PC 4NE5A 5G49A 5BS7A 5JRGC 5B1MC 5AVCA 5CP6A 3TU4A 4J8WA 4WU9D 3KXBD 1P3ID 4KHAA 2F8NK 3B6FD 3W96B 4WU8B 3C1CA 3X1SC 3AZGC 3REIC 4G91C 3AV2D 2NZDA 2L5AA 1P3MA 4H9PA 4Z66B 4AWLC 3A6NB 3NQUB 3O62B 2FJ7D 5F99D 1P3LB 3WTPA 3MGRA 3AZEA 3MGPA 1A7WA 5AVCB 5E5AD 5CP6B 3TU4B 1S32A 4J8WB 2AROD 3B0CW 5CPKD 1TZYA 5GT0C 5B2JA 3AYWC 3VH6T 5B33C 4ZUXC 4KHAB 4Z5TD 3C1CB 3AN2D 5AV6D 1M19D 1EQZA 2NZDB 4H9PB 3W97D 1P3FD 3LELA 3REJA 4Z2MG 3X1UD 5CPID 4HGAC 4NE3A 3WTPB 3MGRB 3WA9C 3AZEB 3MGPB 1HTAA 5AV8C 3AZIC 3KWQA 1S32B 4EO5C 2LY8A 4XUJC 1TZYB 5B2JB 4YS3C 5AV5C 1M18D 3WKJD 3AZFA 1P3PC 5B40D 1EQZB 5CPJD 4KUDD 4G92C 4M6BA 3LELB 5B0ZC 3B0DB 4DRBA 3WAAD 4E45A 5GXQC 3REJB 4NFTA 4R8PA 5JRGA 4Z2MH 2NQBD 5B1MA 3MGQA 5DNMC 3MVDD 3UTBC 1F1EA 5C3IB 1M1AB 2CV5D 1P3OD 5B31C 5DNNC 3X1SA 3AZGA 3AZFB 3AV1C 3REIA 3AZLD 5BT1D 3UT9D 3C1BD 5B1LD 5B32C 4LD9C 3UTAD 4XZQD 1KX3C 1AOID 4R8PB 4CSRA 5JRGB 3REKC 4YM6A 3MGQB 3KUYD 5FUGA 5GSUD 1KU5A 3AYWA 5GT0A 4QLCD 1BH9A 5B33A 4ZUXA 5BNXA 4CAYA 3X1SB 3AZGB 5AVBD 5KDMA 3REIB 4G91B 3VH6A 4WNNB 4AWLB 3X1VC 4WU9C 3KXBC 3W98D 1P3IC 3WA9A 3AZKB 4CSRB 4WU8D 3AZIA 3B6FC 3V9RB 4YM6B 3B0CT 4X23D 4H9QB 4WV4B 3AV2C 3AYWB 5GT0B 1BH9B 5B33B 4YS3A 5AV5A 4J8VD 4CAYB 1KX4B 5F99C 1P3KD 3X1TC 1P3LD 1P3PA 5KDMB 4J8XB 3AZMD 5BNVA 4H9NA 3LZ0D 5B0ZA 5E5AC 5GXQA 2AROC 1ZLAD 5CPKC 3WA9B 3AZIB 5B2ID 4Z5TC 5DNMA 3UTBA 3AN2C 1Q9CA 5AV6C 3MNND 1KX5D 1M19C 5B0YD 1TAFA 3W97C 4YS3B 1P3FC 1R4VA 5B31A 5DNNA 3AV1A 1P3PB 5AV9D 3X1UC 5CPIC 3B6GD 5BNVB 5B32A 4H9NB 5B0ZB 3LJAD 4LD9A 5AY8D 3RELA 5GXQB 1KX3A 3R45A 1WWIA 3REKA 1M18C 1P3BD 3WKJC 5G49B 1EQZD 5DNMB 5B24D 3UTBB 5B40C 1TAFB 1P34D 5CPJC 4KUDC 5B31B 5DNNB 3AV1B 3WAAC 3KSYA 5B32B 1P3MB 2NQBC 1B6WA 3X1VA 1P3GA 3VH5T 4LD9B 3AZND 3RELB 4WU9A 1M1AD 3KXBA 3R45B 3AFAD 4H9SC 3REKB 3B6FA 2CV5C 1P3OC 3AZLC 3AV2A 5BT1C 4JJND 3UT9C 1HQ3D 3C1BC
chains in the Genus database with same CATH superfamily
5B1LC 5F99A 5GT3D 3X1TA 4H9OA 2PYOD 3UTAC 1H3OA 4XZQC 4NE6A 1AOIC 2F8NG 3MGQD 1ID3D 3X1VB 3KUYC 5E5AA 1P3GB 2AROA 4J8UD 1BH8A 5GSUC 3KXBB 5CPKA 4QLCC 2W8SA 3REHD 1N1JA 3X1SD 3MGSD 3B6FB 2BYMA 3AZJD 4Z5TA 5AVBC 3AN2A 3KWQB 3LZ1D 1M19A 3AV2B 1P3AD 3H0MC 3W97A 3W99D 1P3FA 3A1IA 3X1TB 4H9OB 1F66D 3B0BA 4H9RA 3AZKD 1H3OB 5CPIA 3W98C 4YM6D 3AZHD 2IO5C 4WU8C 2F8NH 2YFVA 5E5AB 4X23C 2AROB 1BH8B 5CPKB 1KX4D 3VH5W 4J8VC 1M18A 4J8XD 3WKJA 1P3KC 4Z5TB 1P3LC 2Y2KA 3AN2B 5B1MB 1U35D 5CHLB 5B40A 1M19B 3AZMC 2HIOD 3W97B 2HUEC 5CPJA 4KUDA 1P3FB 3LZ0C 2F8ND 1JFIA 5B32G 3WAAA 4H9RB 4KGCD 5CPIB 1ZLAC 4WJ3C 2NQBA 5B2IC 2YFVB 5JA4A 1KX5C 3MNNC 5B0YC 4H9SA 4DRAA 3W96D 2CV5A 1P3OA 1M18B 3VH5A 3WKJB 5AV8A 3AZLA 2YFWA 5AV9C 3UT9A 4Z66D 3B6GC 5FUGB 3C1BA 4XUJA 3A6ND 4KUDB 2F2AC 5B1LA 3O62D 3LJAC 4ZUXB 1JFIB 5BNXB 5AY8C 2FJ7C 3UTAA 4XZQA 1AOIA 2CWEA 2RVQD 3KUYA 5AVCD 4WZSB 1P3BC 5CP6D 3TU4D 5B24C 4J8WD 1ULYA 5JA4B 5GSUA 4QLCA 5DNND 3AV1D 4HGAB 1P34C 2CV5B 1P3OB 3C1CD 5AVBA 5AV8B 2YFWB 2NZDD 1P3MD 2Y2LA 4EO5B 3UT9B 3EPJA 3C1BB 4XUJB 5B1LB 3RELD 5BO0A 2ZY2A 5AV5B 3AZNC 1PZRA 5C3IC 3UTAB 4XZQB 1M1AC 1AOIB 3W98A 3WTPD 3MGRD 3AFAC 3AZED 3MGPD 3KUYB 4G92B 4X23A 1S32D 5GSUB 1TZYD 3A1KA 5B2JD 4QLCB 4JJNC 1HQ3C 4J8VA 5GT3C 1P3KA 5AVBB 2PYOC 3KFUG 3AZMA 3MGQC 3X1VD 1P3GD 3LZ0A 1ID3C 3LELD 5BO0B 3REJD 2DF4C 4ZBJC 4J8UC 1ZLAA 3W98B 2IO5B 3REHC 2JE5A 5B2IA 3MGSC 3KWQD 3AZJC 4X23B 1KX5A 3MNNA 3LZ1C 5B0YA 1P3AC 3MVDC 3X1TD 1KX3B 3W99C 4J8VB 1P3IA 1P3KB 2ZY5A 3AZFD 1F66C 5AV9A 3AZKC 2Y2HA 3AZMB 3B6GA 2HUEB 4YM6C 3AZHC 3LZ0B 3LJAA 5AY8A 2FJ7A 2G5IC 1ZLAB 4R8PD 5JRGD 1KX4C 5B2IB 5B1MD 4J8XC 2Y2NA 1P3BA 5B24A 1KX5B 1U35C 3MNNB 4UUZA 5B0YB 2HIOC 4WU9B 1P34A 2ZM5A 1P3IB 3AZGD 3REID 5AV9B 4KGCC 3B6GB 5AV6A 3LJAB 3AZNA 5AY8B 2FJ7B 5F99B 1M1AA 3NQJA 3AFAA 3FDDA 3X1UA 3W96C 1P3BB 2XD1A 5B24B 1BFMA 4UUZB 5GT0D 2Y2GA 4JJNA 3AYWD 4Z66C 5B33D 4ZUXD 1HQ3A 3A6NC 1P34B 5GT3A 3O62C 1N1JB 1WWSA 2PYOA 2BYMB 5B31G 5AV6B 5BS7C 1ID3A 2RVQC 5AVCC 3WTPE 2JCHA 2JSSA 2Y2OA 2ZY3A 5CP6C 4J8WC 3TU4C 3AZNB 4J8UA 3NQJB 3AFAB 3WA9D 3REHA 3X1UB 3AZID 3MGSA 5AV8D 3VH6W 3AZJA 3C1CC 4WNNA 3EPLA 4XUJD 3LZ1A 1P3AA 3MVDA 2NZDC 4JJNB 1P3MC 3W99A 1HQ3B 4YS3D 5AV5D 1W2EA 3F6TA 5GT3B 3RELC 1P3PD 1F66A 1B67A 2PYOB 3AZKA 3V9RA 2BG1A 3WTPC 3MGRC 3AZHA 5B40B 1ID3B 3AZEC 4H9QA 5B0ZD 3MGPC 3EPKA 5CPJB 5GXQD 1S32C 4ZBJB 4J8UB 3WAAB 1TZYC 5B2JC 1KX4A 3REHB 3MGSB 4J8XA 3AZJB 5DNMD 3UTBD 2NQBB 1U35A 2BYKA 3LZ1B 1EQZC 1P3AB 2HIOA 3MVDB 3W99B 1P3GC 2F8NA 5B31D 3LELC 3B0DC 1F66B 4E44A 3REJC 4KGCA 3AZLB 3AZHB 5B32D 3KWQC 4LD9D 1KX3D 3REKD 3W96A 4WU8A 3AZFC 1U35B 2BYKB 2HIOB 4Z66A 3A6NA 3NQUA 3O62A 1Z2CB 2F8NB 1P3LA 1T3UA 4KGCB 4R8PC 4NE5A 5G49A 5BS7A 5JRGC 5B1MC 2UWXA 5AVCA 5CP6A 3TU4A 4J8WA 4WU9D 3KXBD 1P3ID 4KHAA 2F8NK 3B6FD 3W96B 4WU8B 3C1CA 3X1SC 3AZGC 3REIC 4G91C 3AV2D 2NZDA 2L5AA 1P3MA 4H9PA 4Z66B 4AWLC 3A6NB 3NQUB 3O62B 2FJ7D 5F99D 1P3LB 3WTPA 3MGRA 2ZY4A 3AZEA 3MGPA 1A7WA 5AVCB 5E5AD 5CP6B 3TU4B 1S32A 4J8WB 3AL0C 2AROD 3B0CW 5CPKD 1TZYA 5GT0C 5B2JA 3AYWC 3VH6T 5B33C 4ZUXC 4KHAB 4Z5TD 3C1CB 3AN2D 5AV6D 2Y2PA 1M19D 1EQZA 2NZDB 4H9PB 3W97D 1P3FD 3LELA 3REJA 4Z2MG 3X1UD 5CPID 4HGAC 4NE3A 3WTPB 3MGRB 3WA9C 3H0RC 3AZEB 3MGPB 1HTAA 5AV8C 3AZIC 3KWQA 1S32B 4EO5C 2LY8A 2Y2QA 4XUJC 1TZYB 5B2JB 4YS3C 5AV5C 1M18D 3WKJD 3AZFA 1P3PC 5B40D 1EQZB 2XD5A 5CPJD 4KUDD 4G92C 4M6BA 3LELB 5B0ZC 3B0DB 4DRBA 3WAAD 4E45A 5GXQC 3REJB 4NFTA 4R8PA 5JRGA 4Z2MH 2NQBD 5B1MA 3MGQA 5DNMC 3MVDD 3UTBC 1F1EA 5C3IB 1M1AB 2CV5D 1P3OD 5B31C 5DNNC 3X1SA 3AZGA 3AZFB 3AV1C 3REIA 3AZLD 5BT1D 3UT9D 3C1BD 5B1LD 5B32C 4LD9C 3UTAD 2Y2MA 4XZQD 1KX3C 1AOID 4R8PB 4CSRA 5JRGB 3REKC 2FFFB 4YM6A 3MGQB 3KUYD 2G5HC 5FUGA 5GSUD 1KU5A 3AYWA 5GT0A 4QLCD 3IP4C 1BH9A 5B33A 4ZUXA 4DQYB 5BNXA 4CAYA 3X1SB 3AZGB 5AVBD 5KDMA 3REIB 4G91B 3VH6A 4WNNB 4AWLB 3EG5B 3X1VC 4WU9C 2Y2IA 3KXBC 4UPKA 3W98D 1P3IC 3WA9A 3AZKB 4CSRB 3P5JB 4WU8D 3AZIA 3B6FC 3V9RB 4YM6B 3B0CT 4X23D 4H9QB 4WV4B 3AV2C 3AYWB 5GT0B 1BH9B 2VQRA 5B33B 4YS3A 5AV5A 4J8VD 4CAYB 1KX4B 5F99C 1P3KD 3X1TC 1P3LD 1P3PA 5KDMB 4J8XB 3AZMD 2RIQA 5BNVA 4H9NA 3LZ0D 5B0ZA 5E5AC 5GXQA 2AROC 1ZLAD 5CPKC 3WA9B 2Y2JA 3AZIB 5B2ID 4Z5TC 5DNMA 3UTBA 3AN2C 1Q9CA 5AV6C 3MNND 1KX5D 1M19C 5B0YD 1TAFA 3W97C 4YS3B 1P3FC 1R4VA 5B31A 5DNNA 3AV1A 1P3PB 5AV9D 3X1UC 5CPIC 3B6GD 5BNVB 5B32A 4H9NB 3EPHA 5B0ZB 3LJAD 4LD9A 5AY8D 3RELA 5GXQB 1KX3A 3R45A 1WWIA 3REKA 1M18C 1P3BD 3WKJC 5G49B 1EQZD 5DNMB 5B24D 3UTBB 5B40C 1TAFB 1P34D 5CPJC 4KUDC 5B31B 5DNNB 3AV1B 3WAAC 3C1BC 3KSYA 5B32B 1P3MB 2NQBC 1B6WA 3X1VA 1P3GA 3VH5T 4LD9B 3H0LC 3AZND 3RELB 4WU9A 1M1AD 3KXBA 3R45B 3AFAD 2J8PA 4H9SC 3REKB 3B6FA 2CV5C 1P3OC 3AZLC 3AV2A 5BT1C 4JJND 3UT9C 1HQ3D 2DQNC
chains in the Genus database with same CATH topology
5B1LC 5F99A 5GT3D 3X1TA 4H9OA 2PYOD 3UTAC 1H3OA 4XZQC 4NE6A 1AOIC 2F8NG 3MGQD 1ID3D 3X1VB 3KUYC 5E5AA 1P3GB 2AROA 4J8UD 1BH8A 5GSUC 3KXBB 5CPKA 4QLCC 2W8SA 3REHD 1N1JA 3X1SD 3MGSD 3B6FB 2BYMA 3AZJD 4Z5TA 5AVBC 3AN2A 3KWQB 3LZ1D 1M19A 3AV2B 1P3AD 3H0MC 3W97A 3W99D 1P3FA 3A1IA 3X1TB 4H9OB 1F66D 3B0BA 4H9RA 3AZKD 1H3OB 5CPIA 3W98C 4YM6D 3AZHD 2IO5C 4WU8C 2F8NH 2YFVA 5E5AB 4X23C 2AROB 1BH8B 5CPKB 1KX4D 3VH5W 4J8VC 1M18A 4J8XD 3WKJA 1P3KC 4Z5TB 1P3LC 2Y2KA 3AN2B 5B1MB 1U35D 5CHLB 5B40A 1M19B 3AZMC 2HIOD 3W97B 2HUEC 5CPJA 4KUDA 1P3FB 3LZ0C 2F8ND 1JFIA 5B32G 3WAAA 4H9RB 4KGCD 5CPIB 1ZLAC 4WJ3C 2NQBA 5B2IC 2YFVB 5JA4A 1KX5C 3MNNC 5B0YC 4H9SA 4DRAA 3W96D 2CV5A 1P3OA 1M18B 3VH5A 3WKJB 5AV8A 3AZLA 2YFWA 5AV9C 3UT9A 4Z66D 3B6GC 5FUGB 3C1BA 4XUJA 3A6ND 4KUDB 2F2AC 5B1LA 3O62D 3LJAC 4ZUXB 1JFIB 5BNXB 5AY8C 2FJ7C 3UTAA 4XZQA 1AOIA 2CWEA 2RVQD 3KUYA 5AVCD 4WZSB 1P3BC 5CP6D 3TU4D 5B24C 4J8WD 1ULYA 5JA4B 5GSUA 4QLCA 5DNND 3AV1D 4HGAB 1P34C 2CV5B 1P3OB 3C1CD 5AVBA 5AV8B 2YFWB 2NZDD 1P3MD 2Y2LA 4EO5B 3UT9B 3EPJA 3C1BB 4XUJB 5B1LB 3RELD 5BO0A 2ZY2A 5AV5B 3AZNC 1PZRA 5C3IC 3UTAB 4XZQB 1M1AC 1AOIB 3W98A 3WTPD 3MGRD 3AFAC 3AZED 3MGPD 3KUYB 4G92B 4X23A 1S32D 5GSUB 1TZYD 3A1KA 5B2JD 4QLCB 4JJNC 1HQ3C 4J8VA 5GT3C 1P3KA 5AVBB 2PYOC 3KFUG 3AZMA 3MGQC 3X1VD 1P3GD 3LZ0A 1ID3C 3LELD 5BO0B 3REJD 2DF4C 4ZBJC 4J8UC 1ZLAA 3W98B 2IO5B 3REHC 2JE5A 5B2IA 3MGSC 3KWQD 3AZJC 4X23B 1KX5A 3MNNA 3LZ1C 5B0YA 1P3AC 3MVDC 3X1TD 1KX3B 3W99C 4J8VB 1P3IA 1P3KB 2ZY5A 3AZFD 1F66C 5AV9A 3AZKC 2Y2HA 3AZMB 3B6GA 2HUEB 4YM6C 3AZHC 3LZ0B 3LJAA 5AY8A 2FJ7A 2G5IC 1ZLAB 4R8PD 5JRGD 1KX4C 5B2IB 5B1MD 4J8XC 2Y2NA 1P3BA 5B24A 1KX5B 1U35C 3MNNB 4UUZA 5B0YB 2HIOC 4WU9B 1P34A 2ZM5A 1P3IB 3AZGD 3REID 5AV9B 4KGCC 3B6GB 5AV6A 3LJAB 3AZNA 5AY8B 2FJ7B 5F99B 1M1AA 3NQJA 3AFAA 3FDDA 3X1UA 3W96C 1P3BB 2XD1A 5B24B 1BFMA 4UUZB 5GT0D 2Y2GA 4JJNA 3AYWD 4Z66C 5B33D 4ZUXD 1HQ3A 3A6NC 1P34B 5GT3A 3O62C 1N1JB 1WWSA 2PYOA 2BYMB 5B31G 5AV6B 5BS7C 1ID3A 2RVQC 5AVCC 3WTPE 2JCHA 2JSSA 2Y2OA 2ZY3A 5CP6C 4J8WC 3TU4C 3AZNB 4J8UA 3NQJB 3AFAB 3WA9D 3REHA 3X1UB 3AZID 3MGSA 5AV8D 3VH6W 3AZJA 3C1CC 4WNNA 3EPLA 4XUJD 3LZ1A 1P3AA 3MVDA 2NZDC 4JJNB 1P3MC 3W99A 1HQ3B 4YS3D 5AV5D 1W2EA 3F6TA 5GT3B 3RELC 1P3PD 1F66A 1B67A 2PYOB 3AZKA 3V9RA 2BG1A 3WTPC 3MGRC 3AZHA 5B40B 1ID3B 3AZEC 4H9QA 5B0ZD 3MGPC 3EPKA 5CPJB 5GXQD 1S32C 4ZBJB 4J8UB 3WAAB 1TZYC 5B2JC 1KX4A 3REHB 3MGSB 4J8XA 3AZJB 5DNMD 3UTBD 2NQBB 1U35A 2BYKA 3LZ1B 1EQZC 1P3AB 2HIOA 3MVDB 3W99B 1P3GC 2F8NA 5B31D 3LELC 3B0DC 1F66B 4E44A 3REJC 4KGCA 3AZLB 3AZHB 5B32D 3KWQC 4LD9D 1KX3D 3REKD 3W96A 4WU8A 3AZFC 1U35B 2BYKB 2HIOB 4Z66A 3A6NA 3NQUA 3O62A 1Z2CB 2F8NB 1P3LA 1T3UA 4KGCB 4R8PC 4NE5A 5G49A 5BS7A 5JRGC 5B1MC 2UWXA 5AVCA 5CP6A 3TU4A 4J8WA 4WU9D 3KXBD 1P3ID 4KHAA 2F8NK 3B6FD 3W96B 4WU8B 3C1CA 3X1SC 3AZGC 3REIC 4G91C 3AV2D 2NZDA 2L5AA 1P3MA 4H9PA 4Z66B 4AWLC 3A6NB 3NQUB 3O62B 2FJ7D 5F99D 1P3LB 3WTPA 3MGRA 2ZY4A 3AZEA 3MGPA 1A7WA 5AVCB 5E5AD 5CP6B 3TU4B 1S32A 4J8WB 3AL0C 2AROD 3B0CW 5CPKD 1TZYA 5GT0C 5B2JA 3AYWC 3VH6T 5B33C 4ZUXC 4KHAB 4Z5TD 3C1CB 3AN2D 5AV6D 2Y2PA 1M19D 1EQZA 2NZDB 4H9PB 3W97D 1P3FD 3LELA 3REJA 4Z2MG 3X1UD 5CPID 4HGAC 4NE3A 3WTPB 3MGRB 3WA9C 3H0RC 3AZEB 3MGPB 1HTAA 5AV8C 3AZIC 3KWQA 1S32B 4EO5C 2LY8A 2Y2QA 4XUJC 1TZYB 5B2JB 4YS3C 5AV5C 1M18D 3WKJD 3AZFA 1P3PC 5B40D 1EQZB 2XD5A 5CPJD 4KUDD 4G92C 4M6BA 3LELB 5B0ZC 3B0DB 4DRBA 3WAAD 4E45A 5GXQC 3REJB 4NFTA 4R8PA 5JRGA 4Z2MH 2NQBD 5B1MA 3MGQA 5DNMC 3MVDD 3UTBC 1F1EA 5C3IB 1M1AB 2CV5D 1P3OD 5B31C 5DNNC 3X1SA 3AZGA 3AZFB 3AV1C 3REIA 3AZLD 5BT1D 3UT9D 3C1BD 5B1LD 5B32C 4LD9C 3UTAD 2Y2MA 4XZQD 1KX3C 1AOID 4R8PB 4CSRA 5JRGB 3REKC 2FFFB 4YM6A 3MGQB 3KUYD 2G5HC 5FUGA 5GSUD 1KU5A 3AYWA 5GT0A 4QLCD 3IP4C 1BH9A 5B33A 4ZUXA 4DQYB 5BNXA 4CAYA 3X1SB 3AZGB 5AVBD 5KDMA 3REIB 4G91B 3VH6A 4WNNB 4AWLB 3EG5B 3X1VC 4WU9C 2Y2IA 3KXBC 4UPKA 3W98D 1P3IC 3WA9A 3AZKB 4CSRB 3P5JB 4WU8D 3AZIA 3B6FC 3V9RB 4YM6B 3B0CT 4X23D 4H9QB 4WV4B 3AV2C 3AYWB 5GT0B 1BH9B 2VQRA 5B33B 4YS3A 5AV5A 4J8VD 4CAYB 1KX4B 5F99C 1P3KD 3X1TC 1P3LD 1P3PA 5KDMB 4J8XB 3AZMD 2RIQA 5BNVA 4H9NA 3LZ0D 5B0ZA 5E5AC 5GXQA 2AROC 1ZLAD 5CPKC 3WA9B 2Y2JA 3AZIB 5B2ID 4Z5TC 5DNMA 3UTBA 3AN2C 1Q9CA 5AV6C 3MNND 1KX5D 1M19C 5B0YD 1TAFA 3W97C 4YS3B 1P3FC 1R4VA 5B31A 5DNNA 3AV1A 1P3PB 5AV9D 3X1UC 5CPIC 3B6GD 5BNVB 5B32A 4H9NB 3EPHA 5B0ZB 3LJAD 4LD9A 5AY8D 3RELA 5GXQB 1KX3A 3R45A 1WWIA 3REKA 1M18C 1P3BD 3WKJC 5G49B 1EQZD 5DNMB 5B24D 3UTBB 5B40C 1TAFB 1P34D 5CPJC 4KUDC 5B31B 5DNNB 3AV1B 3WAAC 3C1BC 3KSYA 5B32B 1P3MB 2NQBC 1B6WA 3X1VA 1P3GA 3VH5T 4LD9B 3H0LC 3AZND 3RELB 4WU9A 1M1AD 3KXBA 3R45B 3AFAD 2J8PA 4H9SC 3REKB 3B6FA 2CV5C 1P3OC 3AZLC 3AV2A 5BT1C 4JJND 3UT9C 1HQ3D 2DQNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L C;  5F99 A;  5GT3 D;  3X1T A;  4H9O A;  2PYO D;  3UTA C;  1H3O A;  4XZQ C;  4NE6 A;  1AOI C;  2F8N G;  3MGQ D;  1ID3 D;  3X1V B;  3KUY C;  5E5A A;  1P3G B;  2ARO A;  4J8U D;  1BH8 A;  5GSU C;  3KXB B;  5CPK A;  4QLC C;  3REH D;  1N1J A;  3X1S D;  3MGS D;  3B6F B;  2BYM A;  3AZJ D;  4Z5T A;  5AVB C;  3AN2 A;  3KWQ B;  3LZ1 D;  1M19 A;  3AV2 B;  1P3A D;  3W97 A;  3W99 D;  1P3F A;  3X1T B;  4H9O B;  1F66 D;  3B0B A;  4H9R A;  3AZK D;  1H3O B;  5CPI A;  3W98 C;  4YM6 D;  3AZH D;  2IO5 C;  4WU8 C;  2F8N H;  2YFV A;  5E5A B;  4X23 C;  2ARO B;  1BH8 B;  5CPK B;  1KX4 D;  3VH5 W;  4J8V C;  1M18 A;  4J8X D;  3WKJ A;  1P3K C;  4Z5T B;  1P3L C;  3AN2 B;  5B1M B;  1U35 D;  5CHL B;  5B40 A;  1M19 B;  3AZM C;  2HIO D;  3W97 B;  2HUE C;  5CPJ A;  4KUD A;  1P3F B;  3LZ0 C;  2F8N D;  1JFI A;  5B32 G;  3WAA A;  4H9R B;  4KGC D;  5CPI B;  1ZLA C;  2NQB A;  5B2I C;  2YFV B;  5JA4 A;  1KX5 C;  3MNN C;  5B0Y C;  4H9S A;  4DRA A;  3W96 D;  2CV5 A;  1P3O A;  1M18 B;  3VH5 A;  3WKJ B;  5AV8 A;  3AZL A;  2YFW A;  5AV9 C;  3UT9 A;  4Z66 D;  3B6G C;  5FUG B;  3C1B A;  4XUJ A;  3A6N D;  4KUD B;  5B1L A;  3O62 D;  3LJA C;  4ZUX B;  1JFI B;  5BNX B;  5AY8 C;  2FJ7 C;  3UTA A;  4XZQ A;  1AOI A;  2CWE A;  2RVQ D;  3KUY A;  5AVC D;  4WZS B;  1P3B C;  5CP6 D;  3TU4 D;  5B24 C;  4J8W D;  1ULY A;  5JA4 B;  5GSU A;  4QLC A;  5DNN D;  3AV1 D;  4HGA B;  1P34 C;  2CV5 B;  1P3O B;  3C1C D;  5AVB A;  5AV8 B;  2YFW B;  2NZD D;  1P3M D;  3UT9 B;  4EO5 B;  3C1B B;  4XUJ B;  5B1L B;  3REL D;  5BO0 A;  5AV5 B;  3AZN C;  5C3I C;  3UTA B;  4XZQ B;  1M1A C;  1AOI B;  3W98 A;  3WTP D;  3MGR D;  3AFA C;  3AZE D;  3MGP D;  3KUY B;  4G92 B;  4X23 A;  1S32 D;  5GSU B;  1TZY D;  5B2J D;  4QLC B;  4JJN C;  1HQ3 C;  4J8V A;  5GT3 C;  1P3K A;  5AVB B;  2PYO C;  3AZM A;  3MGQ C;  3X1V D;  1P3G D;  3LZ0 A;  1ID3 C;  3LEL D;  5BO0 B;  3REJ D;  4ZBJ C;  4J8U C;  1ZLA A;  3W98 B;  2IO5 B;  3REH C;  5B2I A;  3MGS C;  3KWQ D;  3AZJ C;  4X23 B;  1KX5 A;  3MNN A;  3LZ1 C;  5B0Y A;  1P3A C;  3MVD C;  3X1T D;  1KX3 B;  3W99 C;  4J8V B;  1P3I A;  1P3K B;  3AZF D;  1F66 C;  5AV9 A;  3AZK C;  3AZM B;  3B6G A;  2HUE B;  4YM6 C;  3AZH C;  3LZ0 B;  3LJA A;  5AY8 A;  2FJ7 A;  1ZLA B;  4R8P D;  5JRG D;  1KX4 C;  5B2I B;  5B1M D;  4J8X C;  1P3B A;  5B24 A;  1KX5 B;  1U35 C;  3MNN B;  4UUZ A;  5B0Y B;  2HIO C;  4WU9 B;  1P34 A;  1P3I B;  3AZG D;  3REI D;  5AV9 B;  4KGC C;  3B6G B;  5AV6 A;  3LJA B;  3AZN A;  5AY8 B;  2FJ7 B;  5F99 B;  1M1A A;  3NQJ A;  3AFA A;  3X1U A;  3W96 C;  1P3B B;  5B24 B;  1BFM A;  4UUZ B;  5GT0 D;  4JJN A;  3AYW D;  4Z66 C;  5B33 D;  4ZUX D;  1HQ3 A;  3A6N C;  1P34 B;  5GT3 A;  3O62 C;  1N1J B;  1WWS A;  2PYO A;  2BYM B;  5B31 G;  5AV6 B;  5BS7 C;  1ID3 A;  2RVQ C;  5AVC C;  3WTP E;  2JSS A;  5CP6 C;  3TU4 C;  3AZN B;  4J8W C;  4J8U A;  3NQJ B;  3AFA B;  3WA9 D;  3REH A;  3X1U B;  3AZI D;  3MGS A;  5AV8 D;  3VH6 W;  3AZJ A;  3C1C C;  4WNN A;  4XUJ D;  3LZ1 A;  1P3A A;  3MVD A;  2NZD C;  4JJN B;  1P3M C;  3W99 A;  1HQ3 B;  4YS3 D;  5AV5 D;  5GT3 B;  3REL C;  1P3P D;  1F66 A;  1B67 A;  2PYO B;  3AZK A;  3WTP C;  3V9R A;  3MGR C;  3AZH A;  5B40 B;  1ID3 B;  3AZE C;  4H9Q A;  5B0Z D;  3MGP C;  5CPJ B;  5GXQ D;  1S32 C;  4ZBJ B;  4J8U B;  3WAA B;  1TZY C;  5B2J C;  1KX4 A;  3REH B;  3MGS B;  4J8X A;  3AZJ B;  5DNM D;  3UTB D;  2NQB B;  1U35 A;  2BYK A;  3LZ1 B;  1EQZ C;  1P3A B;  2HIO A;  3MVD B;  3W99 B;  1P3G C;  2F8N A;  5B31 D;  3LEL C;  3B0D C;  1F66 B;  4E44 A;  3REJ C;  4KGC A;  3AZL B;  3AZH B;  5B32 D;  3KWQ C;  4LD9 D;  1KX3 D;  3REK D;  3W96 A;  4WU8 A;  3AZF C;  1U35 B;  2BYK B;  2HIO B;  4Z66 A;  3A6N A;  3NQU A;  3O62 A;  2F8N B;  1P3L A;  4KGC B;  4R8P C;  4NE5 A;  5G49 A;  5BS7 A;  5JRG C;  5B1M C;  5AVC A;  5CP6 A;  3TU4 A;  4J8W A;  4WU9 D;  3KXB D;  1P3I D;  4KHA A;  2F8N K;  3B6F D;  3W96 B;  4WU8 B;  3C1C A;  3X1S C;  3AZG C;  3REI C;  4G91 C;  3AV2 D;  2NZD A;  2L5A A;  1P3M A;  4H9P A;  4Z66 B;  4AWL C;  3A6N B;  3NQU B;  3O62 B;  2FJ7 D;  5F99 D;  1P3L B;  3WTP A;  3MGR A;  3AZE A;  3MGP A;  1A7W A;  5AVC B;  5E5A D;  5CP6 B;  3TU4 B;  1S32 A;  4J8W B;  2ARO D;  3B0C W;  5CPK D;  1TZY A;  5GT0 C;  5B2J A;  3AYW C;  3VH6 T;  5B33 C;  4ZUX C;  4KHA B;  4Z5T D;  3C1C B;  3AN2 D;  5AV6 D;  1M19 D;  1EQZ A;  2NZD B;  4H9P B;  3W97 D;  1P3F D;  3LEL A;  3REJ A;  4Z2M G;  3X1U D;  5CPI D;  4HGA C;  4NE3 A;  3WTP B;  3MGR B;  3WA9 C;  3AZE B;  3MGP B;  1HTA A;  5AV8 C;  3AZI C;  3KWQ A;  1S32 B;  4EO5 C;  2LY8 A;  4XUJ C;  1TZY B;  5B2J B;  4YS3 C;  5AV5 C;  1M18 D;  3WKJ D;  3AZF A;  1P3P C;  5B40 D;  1EQZ B;  5CPJ D;  4KUD D;  4G92 C;  4M6B A;  3LEL B;  5B0Z C;  3B0D B;  4DRB A;  3WAA D;  4E45 A;  5GXQ C;  3REJ B;  4NFT A;  4R8P A;  5JRG A;  4Z2M H;  2NQB D;  5B1M A;  3MGQ A;  5DNM C;  3MVD D;  3UTB C;  1F1E A;  5C3I B;  1M1A B;  2CV5 D;  1P3O D;  5B31 C;  5DNN C;  3X1S A;  3AZG A;  3AZF B;  3AV1 C;  3REI A;  3AZL D;  5BT1 D;  3UT9 D;  3C1B D;  5B1L D;  5B32 C;  4LD9 C;  3UTA D;  4XZQ D;  1KX3 C;  1AOI D;  4R8P B;  4CSR A;  5JRG B;  3REK C;  4YM6 A;  3MGQ B;  3KUY D;  5FUG A;  5GSU D;  1KU5 A;  3AYW A;  5GT0 A;  4QLC D;  1BH9 A;  5B33 A;  4ZUX A;  5BNX A;  4CAY A;  3X1S B;  3AZG B;  5AVB D;  5KDM A;  3REI B;  4G91 B;  3VH6 A;  4WNN B;  4AWL B;  3X1V C;  4WU9 C;  3KXB C;  3W98 D;  1P3I C;  3WA9 A;  3AZK B;  4CSR B;  4WU8 D;  3AZI A;  3B6F C;  3V9R B;  4YM6 B;  3B0C T;  4X23 D;  4H9Q B;  4WV4 B;  3AV2 C;  3AYW B;  5GT0 B;  1BH9 B;  5B33 B;  4YS3 A;  5AV5 A;  4J8V D;  4CAY B;  1KX4 B;  5F99 C;  1P3K D;  3X1T C;  1P3L D;  1P3P A;  5KDM B;  4J8X B;  3AZM D;  5BNV A;  4H9N A;  3LZ0 D;  5B0Z A;  5E5A C;  5GXQ A;  2ARO C;  1ZLA D;  5CPK C;  3WA9 B;  3AZI B;  5B2I D;  4Z5T C;  5DNM A;  3UTB A;  3AN2 C;  1Q9C A;  5AV6 C;  3MNN D;  1KX5 D;  1M19 C;  5B0Y D;  1TAF A;  3W97 C;  4YS3 B;  1P3F C;  1R4V A;  5B31 A;  5DNN A;  3AV1 A;  1P3P B;  5AV9 D;  3X1U C;  5CPI C;  3B6G D;  5BNV B;  5B32 A;  4H9N B;  5B0Z B;  3LJA D;  4LD9 A;  5AY8 D;  3REL A;  5GXQ B;  1KX3 A;  3R45 A;  1WWI A;  3REK A;  1M18 C;  1P3B D;  3WKJ C;  5G49 B;  1EQZ D;  5DNM B;  5B24 D;  3UTB B;  5B40 C;  1TAF B;  1P34 D;  5CPJ C;  4KUD C;  5B31 B;  5DNN B;  3AV1 B;  3WAA C;  3KSY A;  5B32 B;  1P3M B;  2NQB C;  1B6W A;  3X1V A;  1P3G A;  3VH5 T;  4LD9 B;  3AZN D;  3REL B;  4WU9 A;  1M1A D;  3KXB A;  3R45 B;  3AFA D;  4H9S C;  3REK B;  3B6F A;  2CV5 C;  1P3O C;  3AZL C;  3AV2 A;  5BT1 C;  4JJN D;  3UT9 C;  1HQ3 D;  3C1B C; 
#chains in the Genus database with same CATH topology
 5B1L C;  5F99 A;  5GT3 D;  3X1T A;  4H9O A;  2PYO D;  3UTA C;  1H3O A;  4XZQ C;  4NE6 A;  1AOI C;  2F8N G;  3MGQ D;  1ID3 D;  3X1V B;  3KUY C;  5E5A A;  1P3G B;  2ARO A;  4J8U D;  1BH8 A;  5GSU C;  3KXB B;  5CPK A;  4QLC C;  2W8S A;  3REH D;  1N1J A;  3X1S D;  3MGS D;  3B6F B;  2BYM A;  3AZJ D;  4Z5T A;  5AVB C;  3AN2 A;  3KWQ B;  3LZ1 D;  1M19 A;  3AV2 B;  1P3A D;  3H0M C;  3W97 A;  3W99 D;  1P3F A;  3A1I A;  3X1T B;  4H9O B;  1F66 D;  3B0B A;  4H9R A;  3AZK D;  1H3O B;  5CPI A;  3W98 C;  4YM6 D;  3AZH D;  2IO5 C;  4WU8 C;  2F8N H;  2YFV A;  5E5A B;  4X23 C;  2ARO B;  1BH8 B;  5CPK B;  1KX4 D;  3VH5 W;  4J8V C;  1M18 A;  4J8X D;  3WKJ A;  1P3K C;  4Z5T B;  1P3L C;  2Y2K A;  3AN2 B;  5B1M B;  1U35 D;  5CHL B;  5B40 A;  1M19 B;  3AZM C;  2HIO D;  3W97 B;  2HUE C;  5CPJ A;  4KUD A;  1P3F B;  3LZ0 C;  2F8N D;  1JFI A;  5B32 G;  3WAA A;  4H9R B;  4KGC D;  5CPI B;  1ZLA C;  4WJ3 C;  2NQB A;  5B2I C;  2YFV B;  5JA4 A;  1KX5 C;  3MNN C;  5B0Y C;  4H9S A;  4DRA A;  3W96 D;  2CV5 A;  1P3O A;  1M18 B;  3VH5 A;  3WKJ B;  5AV8 A;  3AZL A;  2YFW A;  5AV9 C;  3UT9 A;  4Z66 D;  3B6G C;  5FUG B;  3C1B A;  4XUJ A;  3A6N D;  4KUD B;  2F2A C;  5B1L A;  3O62 D;  3LJA C;  4ZUX B;  1JFI B;  5BNX B;  5AY8 C;  2FJ7 C;  3UTA A;  4XZQ A;  1AOI A;  2CWE A;  2RVQ D;  3KUY A;  5AVC D;  4WZS B;  1P3B C;  5CP6 D;  3TU4 D;  5B24 C;  4J8W D;  1ULY A;  5JA4 B;  5GSU A;  4QLC A;  5DNN D;  3AV1 D;  4HGA B;  1P34 C;  2CV5 B;  1P3O B;  3C1C D;  5AVB A;  5AV8 B;  2YFW B;  2NZD D;  1P3M D;  2Y2L A;  4EO5 B;  3UT9 B;  3EPJ A;  3C1B B;  4XUJ B;  5B1L B;  3REL D;  5BO0 A;  2ZY2 A;  5AV5 B;  3AZN C;  1PZR A;  5C3I C;  3UTA B;  4XZQ B;  1M1A C;  1AOI B;  3W98 A;  3WTP D;  3MGR D;  3AFA C;  3AZE D;  3MGP D;  3KUY B;  4G92 B;  4X23 A;  1S32 D;  5GSU B;  1TZY D;  3A1K A;  5B2J D;  4QLC B;  4JJN C;  1HQ3 C;  4J8V A;  5GT3 C;  1P3K A;  5AVB B;  2PYO C;  3KFU G;  3AZM A;  3MGQ C;  3X1V D;  1P3G D;  3LZ0 A;  1ID3 C;  3LEL D;  5BO0 B;  3REJ D;  2DF4 C;  4ZBJ C;  4J8U C;  1ZLA A;  3W98 B;  2IO5 B;  3REH C;  2JE5 A;  5B2I A;  3MGS C;  3KWQ D;  3AZJ C;  4X23 B;  1KX5 A;  3MNN A;  3LZ1 C;  5B0Y A;  1P3A C;  3MVD C;  3X1T D;  1KX3 B;  3W99 C;  4J8V B;  1P3I A;  1P3K B;  2ZY5 A;  3AZF D;  1F66 C;  5AV9 A;  3AZK C;  2Y2H A;  3AZM B;  3B6G A;  2HUE B;  4YM6 C;  3AZH C;  3LZ0 B;  3LJA A;  5AY8 A;  2FJ7 A;  2G5I C;  1ZLA B;  4R8P D;  5JRG D;  1KX4 C;  5B2I B;  5B1M D;  4J8X C;  2Y2N A;  1P3B A;  5B24 A;  1KX5 B;  1U35 C;  3MNN B;  4UUZ A;  5B0Y B;  2HIO C;  4WU9 B;  1P34 A;  2ZM5 A;  1P3I B;  3AZG D;  3REI D;  5AV9 B;  4KGC C;  3B6G B;  5AV6 A;  3LJA B;  3AZN A;  5AY8 B;  2FJ7 B;  5F99 B;  1M1A A;  3NQJ A;  3AFA A;  3FDD A;  3X1U A;  3W96 C;  1P3B B;  2XD1 A;  5B24 B;  1BFM A;  4UUZ B;  5GT0 D;  2Y2G A;  4JJN A;  3AYW D;  4Z66 C;  5B33 D;  4ZUX D;  1HQ3 A;  3A6N C;  1P34 B;  5GT3 A;  3O62 C;  1N1J B;  1WWS A;  2PYO A;  2BYM B;  5B31 G;  5AV6 B;  5BS7 C;  1ID3 A;  2RVQ C;  5AVC C;  3WTP E;  2JCH A;  2JSS A;  2Y2O A;  2ZY3 A;  5CP6 C;  4J8W C;  3TU4 C;  3AZN B;  4J8U A;  3NQJ B;  3AFA B;  3WA9 D;  3REH A;  3X1U B;  3AZI D;  3MGS A;  5AV8 D;  3VH6 W;  3AZJ A;  3C1C C;  4WNN A;  3EPL A;  4XUJ D;  3LZ1 A;  1P3A A;  3MVD A;  2NZD C;  4JJN B;  1P3M C;  3W99 A;  1HQ3 B;  4YS3 D;  5AV5 D;  1W2E A;  3F6T A;  5GT3 B;  3REL C;  1P3P D;  1F66 A;  1B67 A;  2PYO B;  3AZK A;  3V9R A;  2BG1 A;  3WTP C;  3MGR C;  3AZH A;  5B40 B;  1ID3 B;  3AZE C;  4H9Q A;  5B0Z D;  3MGP C;  3EPK A;  5CPJ B;  5GXQ D;  1S32 C;  4ZBJ B;  4J8U B;  3WAA B;  1TZY C;  5B2J C;  1KX4 A;  3REH B;  3MGS B;  4J8X A;  3AZJ B;  5DNM D;  3UTB D;  2NQB B;  1U35 A;  2BYK A;  3LZ1 B;  1EQZ C;  1P3A B;  2HIO A;  3MVD B;  3W99 B;  1P3G C;  2F8N A;  5B31 D;  3LEL C;  3B0D C;  1F66 B;  4E44 A;  3REJ C;  4KGC A;  3AZL B;  3AZH B;  5B32 D;  3KWQ C;  4LD9 D;  1KX3 D;  3REK D;  3W96 A;  4WU8 A;  3AZF C;  1U35 B;  2BYK B;  2HIO B;  4Z66 A;  3A6N A;  3NQU A;  3O62 A;  1Z2C B;  2F8N B;  1P3L A;  1T3U A;  4KGC B;  4R8P C;  4NE5 A;  5G49 A;  5BS7 A;  5JRG C;  5B1M C;  2UWX A;  5AVC A;  5CP6 A;  3TU4 A;  4J8W A;  4WU9 D;  3KXB D;  1P3I D;  4KHA A;  2F8N K;  3B6F D;  3W96 B;  4WU8 B;  3C1C A;  3X1S C;  3AZG C;  3REI C;  4G91 C;  3AV2 D;  2NZD A;  2L5A A;  1P3M A;  4H9P A;  4Z66 B;  4AWL C;  3A6N B;  3NQU B;  3O62 B;  2FJ7 D;  5F99 D;  1P3L B;  3WTP A;  3MGR A;  2ZY4 A;  3AZE A;  3MGP A;  1A7W A;  5AVC B;  5E5A D;  5CP6 B;  3TU4 B;  1S32 A;  4J8W B;  3AL0 C;  2ARO D;  3B0C W;  5CPK D;  1TZY A;  5GT0 C;  5B2J A;  3AYW C;  3VH6 T;  5B33 C;  4ZUX C;  4KHA B;  4Z5T D;  3C1C B;  3AN2 D;  5AV6 D;  2Y2P A;  1M19 D;  1EQZ A;  2NZD B;  4H9P B;  3W97 D;  1P3F D;  3LEL A;  3REJ A;  4Z2M G;  3X1U D;  5CPI D;  4HGA C;  4NE3 A;  3WTP B;  3MGR B;  3WA9 C;  3H0R C;  3AZE B;  3MGP B;  1HTA A;  5AV8 C;  3AZI C;  3KWQ A;  1S32 B;  4EO5 C;  2LY8 A;  2Y2Q A;  4XUJ C;  1TZY B;  5B2J B;  4YS3 C;  5AV5 C;  1M18 D;  3WKJ D;  3AZF A;  1P3P C;  5B40 D;  1EQZ B;  2XD5 A;  5CPJ D;  4KUD D;  4G92 C;  4M6B A;  3LEL B;  5B0Z C;  3B0D B;  4DRB A;  3WAA D;  4E45 A;  5GXQ C;  3REJ B;  4NFT A;  4R8P A;  5JRG A;  4Z2M H;  2NQB D;  5B1M A;  3MGQ A;  5DNM C;  3MVD D;  3UTB C;  1F1E A;  5C3I B;  1M1A B;  2CV5 D;  1P3O D;  5B31 C;  5DNN C;  3X1S A;  3AZG A;  3AZF B;  3AV1 C;  3REI A;  3AZL D;  5BT1 D;  3UT9 D;  3C1B D;  5B1L D;  5B32 C;  4LD9 C;  3UTA D;  2Y2M A;  4XZQ D;  1KX3 C;  1AOI D;  4R8P B;  4CSR A;  5JRG B;  3REK C;  2FFF B;  4YM6 A;  3MGQ B;  3KUY D;  2G5H C;  5FUG A;  5GSU D;  1KU5 A;  3AYW A;  5GT0 A;  4QLC D;  3IP4 C;  1BH9 A;  5B33 A;  4ZUX A;  4DQY B;  5BNX A;  4CAY A;  3X1S B;  3AZG B;  5AVB D;  5KDM A;  3REI B;  4G91 B;  3VH6 A;  4WNN B;  4AWL B;  3EG5 B;  3X1V C;  4WU9 C;  2Y2I A;  3KXB C;  4UPK A;  3W98 D;  1P3I C;  3WA9 A;  3AZK B;  4CSR B;  3P5J B;  4WU8 D;  3AZI A;  3B6F C;  3V9R B;  4YM6 B;  3B0C T;  4X23 D;  4H9Q B;  4WV4 B;  3AV2 C;  3AYW B;  5GT0 B;  1BH9 B;  2VQR A;  5B33 B;  4YS3 A;  5AV5 A;  4J8V D;  4CAY B;  1KX4 B;  5F99 C;  1P3K D;  3X1T C;  1P3L D;  1P3P A;  5KDM B;  4J8X B;  3AZM D;  2RIQ A;  5BNV A;  4H9N A;  3LZ0 D;  5B0Z A;  5E5A C;  5GXQ A;  2ARO C;  1ZLA D;  5CPK C;  3WA9 B;  2Y2J A;  3AZI B;  5B2I D;  4Z5T C;  5DNM A;  3UTB A;  3AN2 C;  1Q9C A;  5AV6 C;  3MNN D;  1KX5 D;  1M19 C;  5B0Y D;  1TAF A;  3W97 C;  4YS3 B;  1P3F C;  1R4V A;  5B31 A;  5DNN A;  3AV1 A;  1P3P B;  5AV9 D;  3X1U C;  5CPI C;  3B6G D;  5BNV B;  5B32 A;  4H9N B;  3EPH A;  5B0Z B;  3LJA D;  4LD9 A;  5AY8 D;  3REL A;  5GXQ B;  1KX3 A;  3R45 A;  1WWI A;  3REK A;  1M18 C;  1P3B D;  3WKJ C;  5G49 B;  1EQZ D;  5DNM B;  5B24 D;  3UTB B;  5B40 C;  1TAF B;  1P34 D;  5CPJ C;  4KUD C;  5B31 B;  5DNN B;  3AV1 B;  3WAA C;  3C1B C;  3KSY A;  5B32 B;  1P3M B;  2NQB C;  1B6W A;  3X1V A;  1P3G A;  3VH5 T;  4LD9 B;  3H0L C;  3AZN D;  3REL B;  4WU9 A;  1M1A D;  3KXB A;  3R45 B;  3AFA D;  2J8P A;  4H9S C;  3REK B;  3B6F A;  2CV5 C;  1P3O C;  3AZL C;  3AV2 A;  5BT1 C;  4JJN D;  3UT9 C;  1HQ3 D;  2DQN C; 
#chains in the Genus database with same CATH homology
 5B1L C;  5F99 A;  5GT3 D;  3X1T A;  4H9O A;  2PYO D;  3UTA C;  1H3O A;  4XZQ C;  4NE6 A;  1AOI C;  2F8N G;  3MGQ D;  1ID3 D;  3X1V B;  3KUY C;  5E5A A;  1P3G B;  2ARO A;  4J8U D;  1BH8 A;  5GSU C;  3KXB B;  5CPK A;  4QLC C;  2W8S A;  3REH D;  1N1J A;  3X1S D;  3MGS D;  3B6F B;  2BYM A;  3AZJ D;  4Z5T A;  5AVB C;  3AN2 A;  3KWQ B;  3LZ1 D;  1M19 A;  3AV2 B;  1P3A D;  3H0M C;  3W97 A;  3W99 D;  1P3F A;  3A1I A;  3X1T B;  4H9O B;  1F66 D;  3B0B A;  4H9R A;  3AZK D;  1H3O B;  5CPI A;  3W98 C;  4YM6 D;  3AZH D;  2IO5 C;  4WU8 C;  2F8N H;  2YFV A;  5E5A B;  4X23 C;  2ARO B;  1BH8 B;  5CPK B;  1KX4 D;  3VH5 W;  4J8V C;  1M18 A;  4J8X D;  3WKJ A;  1P3K C;  4Z5T B;  1P3L C;  2Y2K A;  3AN2 B;  5B1M B;  1U35 D;  5CHL B;  5B40 A;  1M19 B;  3AZM C;  2HIO D;  3W97 B;  2HUE C;  5CPJ A;  4KUD A;  1P3F B;  3LZ0 C;  2F8N D;  1JFI A;  5B32 G;  3WAA A;  4H9R B;  4KGC D;  5CPI B;  1ZLA C;  4WJ3 C;  2NQB A;  5B2I C;  2YFV B;  5JA4 A;  1KX5 C;  3MNN C;  5B0Y C;  4H9S A;  4DRA A;  3W96 D;  2CV5 A;  1P3O A;  1M18 B;  3VH5 A;  3WKJ B;  5AV8 A;  3AZL A;  2YFW A;  5AV9 C;  3UT9 A;  4Z66 D;  3B6G C;  5FUG B;  3C1B A;  4XUJ A;  3A6N D;  4KUD B;  2F2A C;  5B1L A;  3O62 D;  3LJA C;  4ZUX B;  1JFI B;  5BNX B;  5AY8 C;  2FJ7 C;  3UTA A;  4XZQ A;  1AOI A;  2CWE A;  2RVQ D;  3KUY A;  5AVC D;  4WZS B;  1P3B C;  5CP6 D;  3TU4 D;  5B24 C;  4J8W D;  1ULY A;  5JA4 B;  5GSU A;  4QLC A;  5DNN D;  3AV1 D;  4HGA B;  1P34 C;  2CV5 B;  1P3O B;  3C1C D;  5AVB A;  5AV8 B;  2YFW B;  2NZD D;  1P3M D;  2Y2L A;  4EO5 B;  3UT9 B;  3EPJ A;  3C1B B;  4XUJ B;  5B1L B;  3REL D;  5BO0 A;  2ZY2 A;  5AV5 B;  3AZN C;  1PZR A;  5C3I C;  3UTA B;  4XZQ B;  1M1A C;  1AOI B;  3W98 A;  3WTP D;  3MGR D;  3AFA C;  3AZE D;  3MGP D;  3KUY B;  4G92 B;  4X23 A;  1S32 D;  5GSU B;  1TZY D;  3A1K A;  5B2J D;  4QLC B;  4JJN C;  1HQ3 C;  4J8V A;  5GT3 C;  1P3K A;  5AVB B;  2PYO C;  3KFU G;  3AZM A;  3MGQ C;  3X1V D;  1P3G D;  3LZ0 A;  1ID3 C;  3LEL D;  5BO0 B;  3REJ D;  2DF4 C;  4ZBJ C;  4J8U C;  1ZLA A;  3W98 B;  2IO5 B;  3REH C;  2JE5 A;  5B2I A;  3MGS C;  3KWQ D;  3AZJ C;  4X23 B;  1KX5 A;  3MNN A;  3LZ1 C;  5B0Y A;  1P3A C;  3MVD C;  3X1T D;  1KX3 B;  3W99 C;  4J8V B;  1P3I A;  1P3K B;  2ZY5 A;  3AZF D;  1F66 C;  5AV9 A;  3AZK C;  2Y2H A;  3AZM B;  3B6G A;  2HUE B;  4YM6 C;  3AZH C;  3LZ0 B;  3LJA A;  5AY8 A;  2FJ7 A;  2G5I C;  1ZLA B;  4R8P D;  5JRG D;  1KX4 C;  5B2I B;  5B1M D;  4J8X C;  2Y2N A;  1P3B A;  5B24 A;  1KX5 B;  1U35 C;  3MNN B;  4UUZ A;  5B0Y B;  2HIO C;  4WU9 B;  1P34 A;  2ZM5 A;  1P3I B;  3AZG D;  3REI D;  5AV9 B;  4KGC C;  3B6G B;  5AV6 A;  3LJA B;  3AZN A;  5AY8 B;  2FJ7 B;  5F99 B;  1M1A A;  3NQJ A;  3AFA A;  3FDD A;  3X1U A;  3W96 C;  1P3B B;  2XD1 A;  5B24 B;  1BFM A;  4UUZ B;  5GT0 D;  2Y2G A;  4JJN A;  3AYW D;  4Z66 C;  5B33 D;  4ZUX D;  1HQ3 A;  3A6N C;  1P34 B;  5GT3 A;  3O62 C;  1N1J B;  1WWS A;  2PYO A;  2BYM B;  5B31 G;  5AV6 B;  5BS7 C;  1ID3 A;  2RVQ C;  5AVC C;  3WTP E;  2JCH A;  2JSS A;  2Y2O A;  2ZY3 A;  5CP6 C;  4J8W C;  3TU4 C;  3AZN B;  4J8U A;  3NQJ B;  3AFA B;  3WA9 D;  3REH A;  3X1U B;  3AZI D;  3MGS A;  5AV8 D;  3VH6 W;  3AZJ A;  3C1C C;  4WNN A;  3EPL A;  4XUJ D;  3LZ1 A;  1P3A A;  3MVD A;  2NZD C;  4JJN B;  1P3M C;  3W99 A;  1HQ3 B;  4YS3 D;  5AV5 D;  1W2E A;  3F6T A;  5GT3 B;  3REL C;  1P3P D;  1F66 A;  1B67 A;  2PYO B;  3AZK A;  3V9R A;  2BG1 A;  3WTP C;  3MGR C;  3AZH A;  5B40 B;  1ID3 B;  3AZE C;  4H9Q A;  5B0Z D;  3MGP C;  3EPK A;  5CPJ B;  5GXQ D;  1S32 C;  4ZBJ B;  4J8U B;  3WAA B;  1TZY C;  5B2J C;  1KX4 A;  3REH B;  3MGS B;  4J8X A;  3AZJ B;  5DNM D;  3UTB D;  2NQB B;  1U35 A;  2BYK A;  3LZ1 B;  1EQZ C;  1P3A B;  2HIO A;  3MVD B;  3W99 B;  1P3G C;  2F8N A;  5B31 D;  3LEL C;  3B0D C;  1F66 B;  4E44 A;  3REJ C;  4KGC A;  3AZL B;  3AZH B;  5B32 D;  3KWQ C;  4LD9 D;  1KX3 D;  3REK D;  3W96 A;  4WU8 A;  3AZF C;  1U35 B;  2BYK B;  2HIO B;  4Z66 A;  3A6N A;  3NQU A;  3O62 A;  1Z2C B;  2F8N B;  1P3L A;  1T3U A;  4KGC B;  4R8P C;  4NE5 A;  5G49 A;  5BS7 A;  5JRG C;  5B1M C;  2UWX A;  5AVC A;  5CP6 A;  3TU4 A;  4J8W A;  4WU9 D;  3KXB D;  1P3I D;  4KHA A;  2F8N K;  3B6F D;  3W96 B;  4WU8 B;  3C1C A;  3X1S C;  3AZG C;  3REI C;  4G91 C;  3AV2 D;  2NZD A;  2L5A A;  1P3M A;  4H9P A;  4Z66 B;  4AWL C;  3A6N B;  3NQU B;  3O62 B;  2FJ7 D;  5F99 D;  1P3L B;  3WTP A;  3MGR A;  2ZY4 A;  3AZE A;  3MGP A;  1A7W A;  5AVC B;  5E5A D;  5CP6 B;  3TU4 B;  1S32 A;  4J8W B;  3AL0 C;  2ARO D;  3B0C W;  5CPK D;  1TZY A;  5GT0 C;  5B2J A;  3AYW C;  3VH6 T;  5B33 C;  4ZUX C;  4KHA B;  4Z5T D;  3C1C B;  3AN2 D;  5AV6 D;  2Y2P A;  1M19 D;  1EQZ A;  2NZD B;  4H9P B;  3W97 D;  1P3F D;  3LEL A;  3REJ A;  4Z2M G;  3X1U D;  5CPI D;  4HGA C;  4NE3 A;  3WTP B;  3MGR B;  3WA9 C;  3H0R C;  3AZE B;  3MGP B;  1HTA A;  5AV8 C;  3AZI C;  3KWQ A;  1S32 B;  4EO5 C;  2LY8 A;  2Y2Q A;  4XUJ C;  1TZY B;  5B2J B;  4YS3 C;  5AV5 C;  1M18 D;  3WKJ D;  3AZF A;  1P3P C;  5B40 D;  1EQZ B;  2XD5 A;  5CPJ D;  4KUD D;  4G92 C;  4M6B A;  3LEL B;  5B0Z C;  3B0D B;  4DRB A;  3WAA D;  4E45 A;  5GXQ C;  3REJ B;  4NFT A;  4R8P A;  5JRG A;  4Z2M H;  2NQB D;  5B1M A;  3MGQ A;  5DNM C;  3MVD D;  3UTB C;  1F1E A;  5C3I B;  1M1A B;  2CV5 D;  1P3O D;  5B31 C;  5DNN C;  3X1S A;  3AZG A;  3AZF B;  3AV1 C;  3REI A;  3AZL D;  5BT1 D;  3UT9 D;  3C1B D;  5B1L D;  5B32 C;  4LD9 C;  3UTA D;  2Y2M A;  4XZQ D;  1KX3 C;  1AOI D;  4R8P B;  4CSR A;  5JRG B;  3REK C;  2FFF B;  4YM6 A;  3MGQ B;  3KUY D;  2G5H C;  5FUG A;  5GSU D;  1KU5 A;  3AYW A;  5GT0 A;  4QLC D;  3IP4 C;  1BH9 A;  5B33 A;  4ZUX A;  4DQY B;  5BNX A;  4CAY A;  3X1S B;  3AZG B;  5AVB D;  5KDM A;  3REI B;  4G91 B;  3VH6 A;  4WNN B;  4AWL B;  3EG5 B;  3X1V C;  4WU9 C;  2Y2I A;  3KXB C;  4UPK A;  3W98 D;  1P3I C;  3WA9 A;  3AZK B;  4CSR B;  3P5J B;  4WU8 D;  3AZI A;  3B6F C;  3V9R B;  4YM6 B;  3B0C T;  4X23 D;  4H9Q B;  4WV4 B;  3AV2 C;  3AYW B;  5GT0 B;  1BH9 B;  2VQR A;  5B33 B;  4YS3 A;  5AV5 A;  4J8V D;  4CAY B;  1KX4 B;  5F99 C;  1P3K D;  3X1T C;  1P3L D;  1P3P A;  5KDM B;  4J8X B;  3AZM D;  2RIQ A;  5BNV A;  4H9N A;  3LZ0 D;  5B0Z A;  5E5A C;  5GXQ A;  2ARO C;  1ZLA D;  5CPK C;  3WA9 B;  2Y2J A;  3AZI B;  5B2I D;  4Z5T C;  5DNM A;  3UTB A;  3AN2 C;  1Q9C A;  5AV6 C;  3MNN D;  1KX5 D;  1M19 C;  5B0Y D;  1TAF A;  3W97 C;  4YS3 B;  1P3F C;  1R4V A;  5B31 A;  5DNN A;  3AV1 A;  1P3P B;  5AV9 D;  3X1U C;  5CPI C;  3B6G D;  5BNV B;  5B32 A;  4H9N B;  3EPH A;  5B0Z B;  3LJA D;  4LD9 A;  5AY8 D;  3REL A;  5GXQ B;  1KX3 A;  3R45 A;  1WWI A;  3REK A;  1M18 C;  1P3B D;  3WKJ C;  5G49 B;  1EQZ D;  5DNM B;  5B24 D;  3UTB B;  5B40 C;  1TAF B;  1P34 D;  5CPJ C;  4KUD C;  5B31 B;  5DNN B;  3AV1 B;  3WAA C;  3C1B C;  3KSY A;  5B32 B;  1P3M B;  2NQB C;  1B6W A;  3X1V A;  1P3G A;  3VH5 T;  4LD9 B;  3H0L C;  3AZN D;  3REL B;  4WU9 A;  1M1A D;  3KXB A;  3R45 B;  3AFA D;  2J8P A;  4H9S C;  3REK B;  3B6F A;  2CV5 C;  1P3O C;  3AZL C;  3AV2 A;  5BT1 C;  4JJN D;  3UT9 C;  1HQ3 D;  2DQN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...