3AZGA

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAQRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgA00
5E5AB 3AFAB 1P3LC 5AY8A 5B0ZD 5KDMB 1KU5A 5GSUB 3AYWA 3W99A 5DNMB 2F8NG 3O62C 5AV6B 4YS3A 5GT0B 1P3PB 5B1LC 2FJ7D 4H9RA 3X1SC 2CV5C 5DNNB 5CPJB 4J8UA 5GT0D 5AVBA 4M6BA 5B0YB 3UT9B 1P3PD 5B24A 5F99D 5G49A 3MGRD 4X23D 4WNNB 3MGPB 5AV8B 1P34D 3RELC 2AROA 3AZHB 5B2JA 3UT9D 5B31G 1AOIC 1BH9B 3MGPD 3UTBC 5B32C 5AV8D 2PYOA 3AZHD 1F66B 3WAAD 1P3BC 3MGSC 5JA4A 5GT3C 3WTPB 4XZQA 3AZLA 2F8NA 5CPKB 3WA9A 3W96D 1F66D 1M1AB 5E5AA 2NZDB 3AFAA 5AV9C 2HIOC 1KX4C 5GSUA 1P3MA 5CPKD 5JRGC 3C1BA 5DNMA 3REID 1M1AD 5AV6A 5BNVB 5BNXB 3MGQB 4H9SC 4LD9D 5DNNA 4R8PC 1TAFA 2BYKB 3TU4B 5CPJA 5C3IC 5FUGB 5B0YA 3VH5W 3LELC 4J8XB 3AYWC 4WU9C 2YFWB 3W99C 3W98B 4WNNA 1ID3C 3MVDB 3TU4D 1P3IB 3AZHA 1P3OB 1P3LD 4H9NB 1JFIA 1BFMA 3AZKC 4WU8C 5CP6C 3NQUB 5AV5A 4J8XD 3W98D 3KSYA 3MVDD 4ZBJC 1P3OD 5B1MA 2NQBC 5B24C 5GXQC 3AZJC 1KX3C 3WTPA 4Z66B 3LZ0B 3AN2A 3WKJB 3X1SD 2CV5D 5CPKA 1S32C 5BS7A 5B2JC 1U35C 1M19B 2NZDA 1KX5C 1WWSA 4QLCB 4CAYB 4YM6B 4Z66D 3LZ1C 3B6GC 2PYOC 3AV1C 4DRBA 3RELD 1P3BB 3B0CW 4DRAA 1P3AB 1P3GB 5BNVA 5BNXA 3MGQA 4QLCD 4YM6D 3UTBD 3AZNA 4ZUXC 2IO5C 5CPIC 2BYKA 3TU4A 3B6FA 1P3BD 3MGSD 4KGCB 1P3AD 5GT3D 1P3GD 4J8WB 2YFVB 4Z2MH 1KX4B 1P3MC 3AZGA 3C1BC 3W98A 3B0DB 1HQ3C 1P3IA 3VH6A 4H9NA 1P3FB 5AV9D 2HIOD 1KX4D 3NQUA 3LJAB 5JRGD 5B31C 1F1EA 3AZFC 1P3FD 3VH5A 3X1UC 3AZMC 4J8VC 3LZ0A 3WKJA 4H9QB 1M18B 1Q9CA 1EQZB 4R8PD 4G92B 3C1CB 3R45A 1M19A 3AZIC 5AVCA 5B0ZB 4CAYA 3LELD 4WU9D 1M18D 3AV2C 1ID3D 1EQZD 5B1MC 3KUYC 4G91B 4WU8D 5CP6D 1P3AA 1KX3B 3AN2C 2FJ7B 3KWQC 3A6NC 4XUJC 2NQBD 5GXQD 4KGCA 3AZJD 1KX3D 3KXBC 4J8WA 5F99B 4E44A 3MGRB 4X23B 3REHA 5B40B 1S32D 1U35D 1P34B 4EO5B 1KX5D 3X1TB 2F8NK 3LJAA 3LZ1D 3B6GD 2BYMB 5B40D 3B6FC 4H9OB 1BH8B 3UTAB 3WAAB 4E45A 3REKC 3X1TD 4H9QA 1EQZA 4ZUXD 5CPID 3C1CA 3MNNC 4JJNC 3B0CT 3W96B 3UTAD 5B33A 3W97B 4KUDC 5B0ZA 4AWLB 1HQ3D 3REIB 1ZLAC 3X1VC 3W97D 4J8VB 2FJ7A 5KDMA 4CSRB 4KHAB 1N1JB 4LD9B 3AZFD 5B2IB 5AVCC 3VH6W 3REJC 3AZEC 5GT0A 3X1UD 1P3PA 3AZMD 4J8VD 5F99A 3MGRA 1A7WA 4X23A 1TZYC 1P3KC 4Z5TC 1P34A 2F8NH 5B2ID 3AZID 1P3LB 5AY8C 3UT9A 4XUJB 3AV2D 2BYMA 5BO0B 3MGPA 3KUYD 5AV8A 1BH8A 4YS3C 3O62B 3UTAA 3WAAA 5B1LB 4WV4B 3KWQD 3REHC 3A6ND 4XUJD 3X1SB 2CV5B 1BH9A 4HGAC 3W96A 4J8UC 1ULYA 3WTPE 3O62D 5AVBC 1F66A 3KXBD 2LY8A 5B1LD 3W97A 2AROC 3RELB 3REIA 1M1AA 2HUEC 1AOIB 1R4VA 4KHAA 1N1JA 3UTBB 5B32B 4LD9A 5B33C 5B2IA 3MGSB 4KUDB 3REKD 5GT3B 4XZQC 3AZLC 1AOID 3WA9C 3MNND 5B32D 5E5AC 3AFAC 1P3LA 4KUDD 5FUGA 2HIOB 2RVQC 5AV9B 5GSUC 4J8XA 2YFWA 5JRGB 5DNMC 5BO0A 3MVDA 5AV6C 5GT0C 1P3OA 3REJB 1ZLAD 3X1VD 4WZSB 5DNNC 3X1SA 2CV5A 5CPJC 4R8PB 2L5AA 5C3IB 5B0YC 3REJD 3UT9C 4Z66A 3LELB 3AYWB 4WU9B 3MGPC 1TZYD 3W99B 5AV8C 4Z5TD 1P3KD 1ID3B 3AZHC 4YS3B 3VH6T 3RELA 5AY8D 3AZKB 4WU8B 5CP6B 5AV5C 4QLCA 4YM6A 3AYWD 3W99D 3UTBA 4ZBJB 1F66C 4YS3D 1P3BA 3MGSA 5B24B 3VH5T 2NQBB 5GXQB 3WTPC 3AZKD 3AZJB 5GT3A 1P3GA 5CPKC 5BS7C 1S32B 5B2JB 5AVBD 2NZDC 1U35B 5B24D 5AV9A 2HIOA 4NFTA 1KX4A 2YFVA 1KX5B 3LZ1B 3B6GB 5JRGA 2PYOB 2AROD 3AV1B 5B2JD 1P3FA 3MGQC 2F8NB 3AZNC 4H9SA 2PYOD 3AV1D 4ZUXB 2IO5B 4R8PA 3TU4C 5CPIB 4H9PB 3NQJB 1WWIA 4XZQD 3AZLD 2F8ND 3AZGC 1P3MB 4J8XC 3LELA 3WA9D 3C1BB 4WU9A 1M18A 3MVDC 3W98C 1ID3A 1P3IC 1HQ3B 5E5AD 3AFAD 1P3OC 2RVQD 3AZKA 4WU8A 5CP6A 5GSUD 1P3MD 3C1BD 5DNMD 1TAFB 5AV6D 5B31B 3AZFB 2NQBA 5GXQA 3AZJA 1KX3A 3X1UB 4NE6A 4Z66C 3LZ0C 3AZMB 3V9RB 3WKJC 5DNND 5CPJD 1S32A 1M19C 1JFIB 5B0YD 1U35A 5B31D 3AZIB 5AV5B 4QLCC 4YM6C 1KX5A 3LZ1A 3B6GA 3AV2B 5B40A 3AV1A 5B1MB 3KUYB 1P3AC 1P3GC 3B0BA 5AV5D 3AN2B 3KWQB 3X1TA 3A6NB 4ZUXA 5B1MD 5CPIA 4H9PA 4H9OA 4KGCC 3NQJA 3WTPD 4J8WC 3KXBB 3AN2D 2JSSA 3B0DC 4UUZB 1HQ3A 2NZDD 1P3FC 4Z2MG 3LJAC 3AZNB 3B6FB 5B31A 3AZFA 3MGQD 5BT1C 3AZGB 3X1UA 3REKB 3AZMA 4J8VA 3V9RA 1M18C 3AZND 1EQZC 4CSRA 4G92C 3C1CC 3B6FD 3MNNB 4JJNB 3AZIA 3AZGD 5B0ZC 2CWEA 3AV2A 1P3ID 3KUYA 4JJND 4G91C 2FJ7C 1ZLAB 5B32G 3X1VB 3KWQA 4NE5A 3A6NA 4XUJA 3R45B 3O62A 5AVCB 3AZEB 1P3PC 3KXBA 5B1LA 5F99C 3LZ0D 3WKJD 3MGRC 4X23C 5B40C 4UUZA 1H3OB 1TZYB 1P34C 4Z5TB 1P3KB 5CHLB 1M19D 4EO5C 5AVCD 3AZED 5AY8B 3X1TC 3UTAC 3WAAC 1B6WA 3REKA 3REHB 4H9RB 1AOIA 3W96C 4HGAB 3MNNA 5B32A 1HTAA 4J8UB 4JJNA 4KGCD 5AVBB 4J8WD 3W97C 5G49B 4KUDA 3REHD 1B67A 4AWLC 2AROB 4J8UD 3REIC 1M1AC 1ZLAA 3X1VA 3LJAD 2HUEB 4LD9C 5B33B 5B2IC 5JA4B 5BT1D 3REJA 3AZEA 4XZQB 3AZLB 3WA9B 3C1CD 1H3OA 1TZYA 1P3KA 4Z5TA 4NE3A 5B33D
chains in the Genus database with same CATH superfamily
5E5AB 3AFAB 1P3LC 5AY8A 5B0ZD 5KDMB 1KU5A 5GSUB 3AYWA 3W99A 5DNMB 2F8NG 3O62C 5AV6B 4YS3A 5GT0B 2XD5A 1P3PB 5B1LC 2FJ7D 4H9RA 3X1SC 2CV5C 2JE5A 5DNNB 5CPJB 4J8UA 5GT0D 5AVBA 4M6BA 5B0YB 3UT9B 1P3PD 5B24A 2RIQA 5F99D 1PZRA 5G49A 3MGRD 4X23D 3P5JB 4WNNB 3MGPB 2ZY2A 5AV8B 1P34D 3EPHA 3RELC 2AROA 3AZHB 5B2JA 3UT9D 5B31G 1AOIC 1BH9B 3MGPD 3UTBC 5B32C 5AV8D 2PYOA 3AZHD 1F66B 3WAAD 1P3BC 3MGSC 5JA4A 5GT3C 3WTPB 2Y2IA 4XZQA 3AZLA 2F8NA 5CPKB 3WA9A 3W96D 2BG1A 1F66D 1M1AB 5E5AA 2NZDB 3AFAA 5AV9C 2HIOC 1KX4C 5GSUA 1P3MA 5CPKD 5JRGC 2Y2LA 3C1BA 5DNMA 3REID 1M1AD 5AV6A 5BNVB 5BNXB 3MGQB 4H9SC 4LD9D 2Y2GA 5DNNA 4R8PC 1TAFA 2BYKB 1T3UA 3TU4B 5CPJA 5C3IC 5FUGB 5B0YA 3VH5W 3LELC 4J8XB 3AYWC 4WU9C 2YFWB 3W99C 3W98B 4WNNA 1ID3C 3MVDB 2Y2KA 3TU4D 1P3IB 2UWXA 3AZHA 1P3OB 1P3LD 4H9NB 1JFIA 1BFMA 3AZKC 4WU8C 5CP6C 3NQUB 5AV5A 4J8XD 3W98D 3KSYA 3MVDD 4ZBJC 1P3OD 2Y2JA 5B1MA 2NQBC 5B24C 5GXQC 3AZJC 1KX3C 3WTPA 4Z66B 3LZ0B 3AN2A 3WKJB 3X1SD 2CV5D 5CPKA 1S32C 3A1IA 5BS7A 5B2JC 1U35C 1M19B 2NZDA 3FDDA 1KX5C 1WWSA 4QLCB 4CAYB 4YM6B 4Z66D 3LZ1C 3B6GC 2PYOC 3AV1C 4DRBA 3RELD 1P3BB 3B0CW 4DRAA 3EPKA 1P3AB 1P3GB 5BNVA 5BNXA 3MGQA 4QLCD 4YM6D 3UTBD 3AZNA 4ZUXC 2IO5C 5CPIC 2BYKA 3TU4A 3B6FA 1P3BD 3MGSD 4KGCB 1P3AD 5GT3D 1P3GD 3EG5B 2YFVB 4Z2MH 4J8WB 1KX4B 1P3MC 3AZGA 3C1BC 3W98A 3H0RC 3B0DB 1HQ3C 1P3IA 3VH6A 4H9NA 1P3FB 5AV9D 2HIOD 1KX4D 3NQUA 3LJAB 2Y2OA 5JRGD 5B31C 1F1EA 3AZFC 1P3FD 3VH5A 3X1UC 3AZMC 4J8VC 3LZ0A 3WKJA 4H9QB 1M18B 1Q9CA 1EQZB 4R8PD 4G92B 3C1CB 3AL0C 3R45A 1M19A 3AZIC 5AVCA 5B0ZB 4CAYA 3LELD 4WU9D 1M18D 2DF4C 3AV2C 1ID3D 1EQZD 5B1MC 3KUYC 4G91B 4WU8D 5CP6D 1P3AA 1KX3B 3AN2C 2FJ7B 3KWQC 3A6NC 4WJ3C 4XUJC 2Y2PA 2NQBD 5GXQD 4KGCA 3AZJD 1KX3D 3KXBC 4J8WA 5F99B 4E44A 3MGRB 4X23B 3REHA 5B40B 1S32D 1U35D 1P34B 4EO5B 1KX5D 3X1TB 2F8NK 3LJAA 3LZ1D 3B6GD 2BYMB 5B40D 3B6FC 4H9OB 1BH8B 3UTAB 3WAAB 2G5HC 4E45A 3REKC 3X1TD 4H9QA 1EQZA 4ZUXD 5CPID 3C1CA 3MNNC 4JJNC 3B0CT 3W96B 3UTAD 5B33A 3W97B 4KUDC 5B0ZA 4AWLB 1HQ3D 3REIB 1ZLAC 3X1VC 3W97D 4J8VB 2FJ7A 5KDMA 4CSRB 4KHAB 1N1JB 4LD9B 3AZFD 5B2IB 5AVCC 3VH6W 3REJC 3AZEC 5GT0A 3X1UD 1P3PA 3AZMD 4J8VD 5F99A 3MGRA 1A7WA 4X23A 1TZYC 1P3KC 4Z5TC 3F6TA 1P34A 2F8NH 5B2ID 3AZID 1P3LB 4DQYB 5AY8C 3UT9A 4XUJB 3AV2D 2BYMA 5BO0B 3MGPA 3KUYD 5AV8A 1BH8A 4YS3C 3O62B 3UTAA 3WAAA 5B1LB 4WV4B 3KWQD 3REHC 3A6ND 4XUJD 3X1SB 2CV5B 1BH9A 4HGAC 3H0LC 3W96A 4J8UC 1ULYA 3WTPE 3O62D 5AVBC 1F66A 3EPLA 3KXBD 2LY8A 5B1LD 3W97A 2VQRA 2AROC 3RELB 3REIA 1M1AA 2ZY4A 2HUEC 1AOIB 1R4VA 4KHAA 1N1JA 3UTBB 5B32B 4LD9A 5B33C 5B2IA 3MGSB 2J8PA 3REKD 4KUDB 3IP4C 4XZQC 5GT3B 3AZLC 2Y2NA 1AOID 3WA9C 3MNND 5B32D 5E5AC 3AFAC 1P3LA 4KUDD 5FUGA 2HIOB 2RVQC 5AV9B 5GSUC 3KFUG 4J8XA 2YFWA 5JRGB 5DNMC 5BO0A 3MVDA 5AV6C 5GT0C 1P3OA 3REJB 1ZLAD 3X1VD 2G5IC 4WZSB 5DNNC 3X1SA 2CV5A 5CPJC 4R8PB 2L5AA 5C3IB 5B0YC 3REJD 3UT9C 4Z66A 3LELB 3AYWB 4WU9B 3MGPC 1TZYD 3W99B 5AV8C 4Z5TD 1P3KD 1ID3B 3AZHC 4YS3B 3VH6T 3RELA 5AY8D 3AZKB 4WU8B 5CP6B 5AV5C 2Y2QA 4QLCA 4YM6A 3AYWD 3W99D 2JCHA 3UTBA 4ZBJB 1F66C 4YS3D 1P3BA 3MGSA 5B24B 3VH5T 2NQBB 5GXQB 3WTPC 3AZKD 3AZJB 5GT3A 1P3GA 5CPKC 5BS7C 1S32B 5B2JB 5AVBD 2NZDC 1U35B 5B24D 5AV9A 2HIOA 1Z2CB 4NFTA 1KX4A 2YFVA 1KX5B 3LZ1B 3B6GB 5JRGA 2PYOB 2AROD 3AV1B 5B2JD 1P3FA 3MGQC 2F8NB 3AZNC 4H9SA 2PYOD 3AV1D 4ZUXB 2IO5B 4R8PA 3TU4C 5CPIB 4H9PB 3NQJB 1WWIA 3A1KA 4XZQD 3AZLD 2F8ND 3AZGC 1P3MB 4J8XC 3LELA 3WA9D 3C1BB 4WU9A 1M18A 3MVDC 3W98C 1ID3A 1P3IC 1HQ3B 5E5AD 3AFAD 1P3OC 2RVQD 3AZKA 4WU8A 5CP6A 5GSUD 1P3MD 3C1BD 5DNMD 1TAFB 5AV6D 5B31B 3AZFB 2DQNC 2NQBA 5GXQA 3AZJA 1KX3A 3X1UB 4NE6A 4Z66C 3LZ0C 3AZMB 3V9RB 3WKJC 5DNND 5CPJD 1S32A 1M19C 1JFIB 5B0YD 1U35A 5B31D 3AZIB 5AV5B 4QLCC 2XD1A 4YM6C 1KX5A 3LZ1A 3B6GA 3AV2B 5B40A 3AV1A 5B1MB 3KUYB 1P3AC 2ZM5A 1P3GC 3EPJA 3B0BA 5AV5D 3AN2B 3KWQB 3X1TA 3A6NB 4ZUXA 5B1MD 5CPIA 1W2EA 4H9OA 4H9PA 4KGCC 3NQJA 3WTPD 4J8WC 3KXBB 3AN2D 2JSSA 3B0DC 4UUZB 1HQ3A 2NZDD 2FFFB 1P3FC 4Z2MG 3LJAC 2F2AC 3AZNB 3B6FB 5B31A 3AZFA 3MGQD 5BT1C 3AZGB 3X1UA 3REKB 3AZMA 4J8VA 3V9RA 1M18C 3AZND 1EQZC 4CSRA 4G92C 3C1CC 3B6FD 3MNNB 4JJNB 3AZIA 3AZGD 5B0ZC 2CWEA 2ZY3A 3AV2A 1P3ID 3KUYA 4JJND 4G91C 2Y2HA 2FJ7C 1ZLAB 5B32G 3X1VB 2W8SA 3KWQA 4NE5A 3A6NA 4XUJA 3R45B 2ZY5A 3H0MC 3O62A 5AVCB 3AZEB 1P3PC 3KXBA 5B1LA 5F99C 3LZ0D 3WKJD 3MGRC 4X23C 5B40C 4UUZA 1H3OB 1TZYB 1P34C 4Z5TB 1P3KB 5CHLB 1M19D 4EO5C 5AVCD 3AZED 5AY8B 3X1TC 2Y2MA 3UTAC 3WAAC 1B6WA 3REKA 3REHB 4H9RB 1AOIA 3W96C 4HGAB 3MNNA 5B32A 1HTAA 4J8UB 4JJNA 4KGCD 5AVBB 4J8WD 3W97C 5G49B 4KUDA 3REHD 1B67A 4AWLC 2AROB 4J8UD 3REIC 1M1AC 1ZLAA 3X1VA 3LJAD 4UPKA 2HUEB 4LD9C 5B33B 5B2IC 5JA4B 5BT1D 3REJA 3AZEA 4XZQB 3AZLB 3WA9B 3C1CD 1H3OA 1TZYA 1P3KA 4Z5TA 4NE3A 5B33D
chains in the Genus database with same CATH topology
5E5AB 3AFAB 1P3LC 5AY8A 5B0ZD 5KDMB 1KU5A 5GSUB 3AYWA 3W99A 5DNMB 2F8NG 3O62C 5AV6B 4YS3A 5GT0B 2XD5A 1P3PB 5B1LC 2FJ7D 4H9RA 3X1SC 2CV5C 2JE5A 5DNNB 5CPJB 4J8UA 5GT0D 5AVBA 4M6BA 5B0YB 3UT9B 1P3PD 5B24A 2RIQA 5F99D 1PZRA 5G49A 3MGRD 4X23D 3P5JB 4WNNB 3MGPB 2ZY2A 5AV8B 1P34D 3EPHA 3RELC 2AROA 3AZHB 5B2JA 3UT9D 5B31G 1AOIC 1BH9B 3MGPD 3UTBC 5B32C 5AV8D 2PYOA 3AZHD 1F66B 3WAAD 1P3BC 3MGSC 5JA4A 5GT3C 3WTPB 2Y2IA 4XZQA 3AZLA 2F8NA 5CPKB 3WA9A 3W96D 2BG1A 1F66D 1M1AB 5E5AA 2NZDB 3AFAA 5AV9C 2HIOC 1KX4C 5GSUA 1P3MA 5CPKD 5JRGC 2Y2LA 3C1BA 5DNMA 3REID 1M1AD 5AV6A 5BNVB 5BNXB 3MGQB 4H9SC 4LD9D 2Y2GA 5DNNA 4R8PC 1TAFA 2BYKB 1T3UA 3TU4B 5CPJA 5C3IC 5FUGB 5B0YA 3VH5W 3LELC 4J8XB 3AYWC 4WU9C 2YFWB 3W99C 3W98B 4WNNA 1ID3C 3MVDB 2Y2KA 3TU4D 1P3IB 2UWXA 3AZHA 1P3OB 1P3LD 4H9NB 1JFIA 1BFMA 3AZKC 4WU8C 5CP6C 3NQUB 5AV5A 4J8XD 3W98D 3KSYA 3MVDD 4ZBJC 1P3OD 2Y2JA 5B1MA 2NQBC 5B24C 5GXQC 3AZJC 1KX3C 3WTPA 4Z66B 3LZ0B 3AN2A 3WKJB 3X1SD 2CV5D 5CPKA 1S32C 3A1IA 5BS7A 5B2JC 1U35C 1M19B 2NZDA 3FDDA 1KX5C 1WWSA 4QLCB 4CAYB 4YM6B 4Z66D 3LZ1C 3B6GC 2PYOC 3AV1C 4DRBA 3RELD 1P3BB 3B0CW 4DRAA 3EPKA 1P3AB 1P3GB 5BNVA 5BNXA 3MGQA 4QLCD 4YM6D 3UTBD 3AZNA 4ZUXC 2IO5C 5CPIC 2BYKA 3TU4A 3B6FA 1P3BD 3MGSD 4KGCB 1P3AD 5GT3D 1P3GD 3EG5B 2YFVB 4Z2MH 4J8WB 1KX4B 1P3MC 3AZGA 3C1BC 3W98A 3H0RC 3B0DB 1HQ3C 1P3IA 3VH6A 4H9NA 1P3FB 5AV9D 2HIOD 1KX4D 3NQUA 3LJAB 2Y2OA 5JRGD 5B31C 1F1EA 3AZFC 1P3FD 3VH5A 3X1UC 3AZMC 4J8VC 3LZ0A 3WKJA 4H9QB 1M18B 1Q9CA 1EQZB 4R8PD 4G92B 3C1CB 3AL0C 3R45A 1M19A 3AZIC 5AVCA 5B0ZB 4CAYA 3LELD 4WU9D 1M18D 2DF4C 3AV2C 1ID3D 1EQZD 5B1MC 3KUYC 4G91B 4WU8D 5CP6D 1P3AA 1KX3B 3AN2C 2FJ7B 3KWQC 3A6NC 4WJ3C 4XUJC 2Y2PA 2NQBD 5GXQD 4KGCA 3AZJD 1KX3D 3KXBC 4J8WA 5F99B 4E44A 3MGRB 4X23B 3REHA 5B40B 1S32D 1U35D 1P34B 4EO5B 1KX5D 3X1TB 2F8NK 3LJAA 3LZ1D 3B6GD 2BYMB 5B40D 3B6FC 4H9OB 1BH8B 3UTAB 3WAAB 2G5HC 4E45A 3REKC 3X1TD 4H9QA 1EQZA 4ZUXD 5CPID 3C1CA 3MNNC 4JJNC 3B0CT 3W96B 3UTAD 5B33A 3W97B 4KUDC 5B0ZA 4AWLB 1HQ3D 3REIB 1ZLAC 3X1VC 3W97D 4J8VB 2FJ7A 5KDMA 4CSRB 4KHAB 1N1JB 4LD9B 3AZFD 5B2IB 5AVCC 3VH6W 3REJC 3AZEC 5GT0A 3X1UD 1P3PA 3AZMD 4J8VD 5F99A 3MGRA 1A7WA 4X23A 1TZYC 1P3KC 4Z5TC 3F6TA 1P34A 2F8NH 5B2ID 3AZID 1P3LB 4DQYB 5AY8C 3UT9A 4XUJB 3AV2D 2BYMA 5BO0B 3MGPA 3KUYD 5AV8A 1BH8A 4YS3C 3O62B 3UTAA 3WAAA 5B1LB 4WV4B 3KWQD 3REHC 3A6ND 4XUJD 3X1SB 2CV5B 1BH9A 4HGAC 3H0LC 3W96A 4J8UC 1ULYA 3WTPE 3O62D 5AVBC 1F66A 3EPLA 3KXBD 2LY8A 5B1LD 3W97A 2VQRA 2AROC 3RELB 3REIA 1M1AA 2ZY4A 2HUEC 1AOIB 1R4VA 4KHAA 1N1JA 3UTBB 5B32B 4LD9A 5B33C 5B2IA 3MGSB 2J8PA 3REKD 4KUDB 3IP4C 4XZQC 5GT3B 3AZLC 2Y2NA 1AOID 3WA9C 3MNND 5B32D 5E5AC 3AFAC 1P3LA 4KUDD 5FUGA 2HIOB 2RVQC 5AV9B 5GSUC 3KFUG 4J8XA 2YFWA 5JRGB 5DNMC 5BO0A 3MVDA 5AV6C 5GT0C 1P3OA 3REJB 1ZLAD 3X1VD 2G5IC 4WZSB 5DNNC 3X1SA 2CV5A 5CPJC 4R8PB 2L5AA 5C3IB 5B0YC 3REJD 3UT9C 4Z66A 3LELB 3AYWB 4WU9B 3MGPC 1TZYD 3W99B 5AV8C 4Z5TD 1P3KD 1ID3B 3AZHC 4YS3B 3VH6T 3RELA 5AY8D 3AZKB 4WU8B 5CP6B 5AV5C 2Y2QA 4QLCA 4YM6A 3AYWD 3W99D 2JCHA 3UTBA 4ZBJB 1F66C 4YS3D 1P3BA 3MGSA 5B24B 3VH5T 2NQBB 5GXQB 3WTPC 3AZKD 3AZJB 5GT3A 1P3GA 5CPKC 5BS7C 1S32B 5B2JB 5AVBD 2NZDC 1U35B 5B24D 5AV9A 2HIOA 1Z2CB 4NFTA 1KX4A 2YFVA 1KX5B 3LZ1B 3B6GB 5JRGA 2PYOB 2AROD 3AV1B 5B2JD 1P3FA 3MGQC 2F8NB 3AZNC 4H9SA 2PYOD 3AV1D 4ZUXB 2IO5B 4R8PA 3TU4C 5CPIB 4H9PB 3NQJB 1WWIA 3A1KA 4XZQD 3AZLD 2F8ND 3AZGC 1P3MB 4J8XC 3LELA 3WA9D 3C1BB 4WU9A 1M18A 3MVDC 3W98C 1ID3A 1P3IC 1HQ3B 5E5AD 3AFAD 1P3OC 2RVQD 3AZKA 4WU8A 5CP6A 5GSUD 1P3MD 3C1BD 5DNMD 1TAFB 5AV6D 5B31B 3AZFB 2DQNC 2NQBA 5GXQA 3AZJA 1KX3A 3X1UB 4NE6A 4Z66C 3LZ0C 3AZMB 3V9RB 3WKJC 5DNND 5CPJD 1S32A 1M19C 1JFIB 5B0YD 1U35A 5B31D 3AZIB 5AV5B 4QLCC 2XD1A 4YM6C 1KX5A 3LZ1A 3B6GA 3AV2B 5B40A 3AV1A 5B1MB 3KUYB 1P3AC 2ZM5A 1P3GC 3EPJA 3B0BA 5AV5D 3AN2B 3KWQB 3X1TA 3A6NB 4ZUXA 5B1MD 5CPIA 1W2EA 4H9OA 4H9PA 4KGCC 3NQJA 3WTPD 4J8WC 3KXBB 3AN2D 2JSSA 3B0DC 4UUZB 1HQ3A 2NZDD 2FFFB 1P3FC 4Z2MG 3LJAC 2F2AC 3AZNB 3B6FB 5B31A 3AZFA 3MGQD 5BT1C 3AZGB 3X1UA 3REKB 3AZMA 4J8VA 3V9RA 1M18C 3AZND 1EQZC 4CSRA 4G92C 3C1CC 3B6FD 3MNNB 4JJNB 3AZIA 3AZGD 5B0ZC 2CWEA 2ZY3A 3AV2A 1P3ID 3KUYA 4JJND 4G91C 2Y2HA 2FJ7C 1ZLAB 5B32G 3X1VB 2W8SA 3KWQA 4NE5A 3A6NA 4XUJA 3R45B 2ZY5A 3H0MC 3O62A 5AVCB 3AZEB 1P3PC 3KXBA 5B1LA 5F99C 3LZ0D 3WKJD 3MGRC 4X23C 5B40C 4UUZA 1H3OB 1TZYB 1P34C 4Z5TB 1P3KB 5CHLB 1M19D 4EO5C 5AVCD 3AZED 5AY8B 3X1TC 2Y2MA 3UTAC 3WAAC 1B6WA 3REKA 3REHB 4H9RB 1AOIA 3W96C 4HGAB 3MNNA 5B32A 1HTAA 4J8UB 4JJNA 4KGCD 5AVBB 4J8WD 3W97C 5G49B 4KUDA 3REHD 1B67A 4AWLC 2AROB 4J8UD 3REIC 1M1AC 1ZLAA 3X1VA 3LJAD 4UPKA 2HUEB 4LD9C 5B33B 5B2IC 5JA4B 5BT1D 3REJA 3AZEA 4XZQB 3AZLB 3WA9B 3C1CD 1H3OA 1TZYA 1P3KA 4Z5TA 4NE3A 5B33D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A B;  3AFA B;  1P3L C;  5AY8 A;  5B0Z D;  5KDM B;  1KU5 A;  5GSU B;  3AYW A;  3W99 A;  5DNM B;  2F8N G;  3O62 C;  5AV6 B;  4YS3 A;  5GT0 B;  1P3P B;  5B1L C;  2FJ7 D;  4H9R A;  3X1S C;  2CV5 C;  5DNN B;  5CPJ B;  4J8U A;  5GT0 D;  5AVB A;  4M6B A;  5B0Y B;  3UT9 B;  1P3P D;  5B24 A;  5F99 D;  5G49 A;  3MGR D;  4X23 D;  4WNN B;  3MGP B;  5AV8 B;  1P34 D;  3REL C;  2ARO A;  3AZH B;  5B2J A;  3UT9 D;  5B31 G;  1AOI C;  1BH9 B;  3MGP D;  3UTB C;  5B32 C;  5AV8 D;  2PYO A;  3AZH D;  1F66 B;  3WAA D;  1P3B C;  3MGS C;  5JA4 A;  5GT3 C;  3WTP B;  4XZQ A;  3AZL A;  2F8N A;  5CPK B;  3WA9 A;  3W96 D;  1F66 D;  1M1A B;  5E5A A;  2NZD B;  3AFA A;  5AV9 C;  2HIO C;  1KX4 C;  5GSU A;  1P3M A;  5CPK D;  5JRG C;  3C1B A;  5DNM A;  3REI D;  1M1A D;  5AV6 A;  5BNV B;  5BNX B;  3MGQ B;  4H9S C;  4LD9 D;  5DNN A;  4R8P C;  1TAF A;  2BYK B;  3TU4 B;  5CPJ A;  5C3I C;  5FUG B;  5B0Y A;  3VH5 W;  3LEL C;  4J8X B;  3AYW C;  4WU9 C;  2YFW B;  3W99 C;  3W98 B;  4WNN A;  1ID3 C;  3MVD B;  3TU4 D;  1P3I B;  3AZH A;  1P3O B;  1P3L D;  4H9N B;  1JFI A;  1BFM A;  3AZK C;  4WU8 C;  5CP6 C;  3NQU B;  5AV5 A;  4J8X D;  3W98 D;  3KSY A;  3MVD D;  4ZBJ C;  1P3O D;  5B1M A;  2NQB C;  5B24 C;  5GXQ C;  3AZJ C;  1KX3 C;  3WTP A;  4Z66 B;  3LZ0 B;  3AN2 A;  3WKJ B;  3X1S D;  2CV5 D;  5CPK A;  1S32 C;  5BS7 A;  5B2J C;  1U35 C;  1M19 B;  2NZD A;  1KX5 C;  1WWS A;  4QLC B;  4CAY B;  4YM6 B;  4Z66 D;  3LZ1 C;  3B6G C;  2PYO C;  3AV1 C;  4DRB A;  3REL D;  1P3B B;  3B0C W;  4DRA A;  1P3A B;  1P3G B;  5BNV A;  5BNX A;  3MGQ A;  4QLC D;  4YM6 D;  3UTB D;  3AZN A;  4ZUX C;  2IO5 C;  5CPI C;  2BYK A;  3TU4 A;  3B6F A;  1P3B D;  3MGS D;  4KGC B;  1P3A D;  5GT3 D;  1P3G D;  4J8W B;  2YFV B;  4Z2M H;  1KX4 B;  1P3M C;  3AZG A;  3C1B C;  3W98 A;  3B0D B;  1HQ3 C;  1P3I A;  3VH6 A;  4H9N A;  1P3F B;  5AV9 D;  2HIO D;  1KX4 D;  3NQU A;  3LJA B;  5JRG D;  5B31 C;  1F1E A;  3AZF C;  1P3F D;  3VH5 A;  3X1U C;  3AZM C;  4J8V C;  3LZ0 A;  3WKJ A;  4H9Q B;  1M18 B;  1Q9C A;  1EQZ B;  4R8P D;  4G92 B;  3C1C B;  3R45 A;  1M19 A;  3AZI C;  5AVC A;  5B0Z B;  4CAY A;  3LEL D;  4WU9 D;  1M18 D;  3AV2 C;  1ID3 D;  1EQZ D;  5B1M C;  3KUY C;  4G91 B;  4WU8 D;  5CP6 D;  1P3A A;  1KX3 B;  3AN2 C;  2FJ7 B;  3KWQ C;  3A6N C;  4XUJ C;  2NQB D;  5GXQ D;  4KGC A;  3AZJ D;  1KX3 D;  3KXB C;  4J8W A;  5F99 B;  4E44 A;  3MGR B;  4X23 B;  3REH A;  5B40 B;  1S32 D;  1U35 D;  1P34 B;  4EO5 B;  1KX5 D;  3X1T B;  2F8N K;  3LJA A;  3LZ1 D;  3B6G D;  2BYM B;  5B40 D;  3B6F C;  4H9O B;  1BH8 B;  3UTA B;  3WAA B;  4E45 A;  3REK C;  3X1T D;  4H9Q A;  1EQZ A;  4ZUX D;  5CPI D;  3C1C A;  3MNN C;  4JJN C;  3B0C T;  3W96 B;  3UTA D;  5B33 A;  3W97 B;  4KUD C;  5B0Z A;  4AWL B;  1HQ3 D;  3REI B;  1ZLA C;  3X1V C;  3W97 D;  4J8V B;  2FJ7 A;  5KDM A;  4CSR B;  4KHA B;  1N1J B;  4LD9 B;  3AZF D;  5B2I B;  5AVC C;  3VH6 W;  3REJ C;  3AZE C;  5GT0 A;  3X1U D;  1P3P A;  3AZM D;  4J8V D;  5F99 A;  3MGR A;  1A7W A;  4X23 A;  1TZY C;  1P3K C;  4Z5T C;  1P34 A;  2F8N H;  5B2I D;  3AZI D;  1P3L B;  5AY8 C;  3UT9 A;  4XUJ B;  3AV2 D;  2BYM A;  5BO0 B;  3MGP A;  3KUY D;  5AV8 A;  1BH8 A;  4YS3 C;  3O62 B;  3UTA A;  3WAA A;  5B1L B;  4WV4 B;  3KWQ D;  3REH C;  3A6N D;  4XUJ D;  3X1S B;  2CV5 B;  1BH9 A;  4HGA C;  3W96 A;  4J8U C;  1ULY A;  3WTP E;  3O62 D;  5AVB C;  1F66 A;  3KXB D;  2LY8 A;  5B1L D;  3W97 A;  2ARO C;  3REL B;  3REI A;  1M1A A;  2HUE C;  1AOI B;  1R4V A;  4KHA A;  1N1J A;  3UTB B;  5B32 B;  4LD9 A;  5B33 C;  5B2I A;  3MGS B;  4KUD B;  3REK D;  5GT3 B;  4XZQ C;  3AZL C;  1AOI D;  3WA9 C;  3MNN D;  5B32 D;  5E5A C;  3AFA C;  1P3L A;  4KUD D;  5FUG A;  2HIO B;  2RVQ C;  5AV9 B;  5GSU C;  4J8X A;  2YFW A;  5JRG B;  5DNM C;  5BO0 A;  3MVD A;  5AV6 C;  5GT0 C;  1P3O A;  3REJ B;  1ZLA D;  3X1V D;  4WZS B;  5DNN C;  3X1S A;  2CV5 A;  5CPJ C;  4R8P B;  2L5A A;  5C3I B;  5B0Y C;  3REJ D;  3UT9 C;  4Z66 A;  3LEL B;  3AYW B;  4WU9 B;  3MGP C;  1TZY D;  3W99 B;  5AV8 C;  4Z5T D;  1P3K D;  1ID3 B;  3AZH C;  4YS3 B;  3VH6 T;  3REL A;  5AY8 D;  3AZK B;  4WU8 B;  5CP6 B;  5AV5 C;  4QLC A;  4YM6 A;  3AYW D;  3W99 D;  3UTB A;  4ZBJ B;  1F66 C;  4YS3 D;  1P3B A;  3MGS A;  5B24 B;  3VH5 T;  2NQB B;  5GXQ B;  3WTP C;  3AZK D;  3AZJ B;  5GT3 A;  1P3G A;  5CPK C;  5BS7 C;  1S32 B;  5B2J B;  5AVB D;  2NZD C;  1U35 B;  5B24 D;  5AV9 A;  2HIO A;  4NFT A;  1KX4 A;  2YFV A;  1KX5 B;  3LZ1 B;  3B6G B;  5JRG A;  2PYO B;  2ARO D;  3AV1 B;  5B2J D;  1P3F A;  3MGQ C;  2F8N B;  3AZN C;  4H9S A;  2PYO D;  3AV1 D;  4ZUX B;  2IO5 B;  4R8P A;  3TU4 C;  5CPI B;  4H9P B;  3NQJ B;  1WWI A;  4XZQ D;  3AZL D;  2F8N D;  3AZG C;  1P3M B;  4J8X C;  3LEL A;  3WA9 D;  3C1B B;  4WU9 A;  1M18 A;  3MVD C;  3W98 C;  1ID3 A;  1P3I C;  1HQ3 B;  5E5A D;  3AFA D;  1P3O C;  2RVQ D;  3AZK A;  4WU8 A;  5CP6 A;  5GSU D;  1P3M D;  3C1B D;  5DNM D;  1TAF B;  5AV6 D;  5B31 B;  3AZF B;  2NQB A;  5GXQ A;  3AZJ A;  1KX3 A;  3X1U B;  4NE6 A;  4Z66 C;  3LZ0 C;  3AZM B;  3V9R B;  3WKJ C;  5DNN D;  5CPJ D;  1S32 A;  1M19 C;  1JFI B;  5B0Y D;  1U35 A;  5B31 D;  3AZI B;  5AV5 B;  4QLC C;  4YM6 C;  1KX5 A;  3LZ1 A;  3B6G A;  3AV2 B;  5B40 A;  3AV1 A;  5B1M B;  3KUY B;  1P3A C;  1P3G C;  3B0B A;  5AV5 D;  3AN2 B;  3KWQ B;  3X1T A;  3A6N B;  4ZUX A;  5B1M D;  5CPI A;  4H9P A;  4H9O A;  4KGC C;  3NQJ A;  3WTP D;  4J8W C;  3KXB B;  3AN2 D;  2JSS A;  3B0D C;  4UUZ B;  1HQ3 A;  2NZD D;  1P3F C;  4Z2M G;  3LJA C;  3AZN B;  3B6F B;  5B31 A;  3AZF A;  3MGQ D;  5BT1 C;  3AZG B;  3X1U A;  3REK B;  3AZM A;  4J8V A;  3V9R A;  1M18 C;  3AZN D;  1EQZ C;  4CSR A;  4G92 C;  3C1C C;  3B6F D;  3MNN B;  4JJN B;  3AZI A;  3AZG D;  5B0Z C;  2CWE A;  3AV2 A;  1P3I D;  3KUY A;  4JJN D;  4G91 C;  2FJ7 C;  1ZLA B;  5B32 G;  3X1V B;  3KWQ A;  4NE5 A;  3A6N A;  4XUJ A;  3R45 B;  3O62 A;  5AVC B;  3AZE B;  1P3P C;  3KXB A;  5B1L A;  5F99 C;  3LZ0 D;  3WKJ D;  3MGR C;  4X23 C;  5B40 C;  4UUZ A;  1H3O B;  1TZY B;  1P34 C;  4Z5T B;  1P3K B;  5CHL B;  1M19 D;  4EO5 C;  5AVC D;  3AZE D;  5AY8 B;  3X1T C;  3UTA C;  3WAA C;  1B6W A;  3REK A;  3REH B;  4H9R B;  1AOI A;  3W96 C;  4HGA B;  3MNN A;  5B32 A;  1HTA A;  4J8U B;  4JJN A;  4KGC D;  5AVB B;  4J8W D;  3W97 C;  5G49 B;  4KUD A;  3REH D;  1B67 A;  4AWL C;  2ARO B;  4J8U D;  3REI C;  1M1A C;  1ZLA A;  3X1V A;  3LJA D;  2HUE B;  4LD9 C;  5B33 B;  5B2I C;  5JA4 B;  5BT1 D;  3REJ A;  3AZE A;  4XZQ B;  3AZL B;  3WA9 B;  3C1C D;  1H3O A;  1TZY A;  1P3K A;  4Z5T A;  4NE3 A;  5B33 D; 
#chains in the Genus database with same CATH topology
 5E5A B;  3AFA B;  1P3L C;  5AY8 A;  5B0Z D;  5KDM B;  1KU5 A;  5GSU B;  3AYW A;  3W99 A;  5DNM B;  2F8N G;  3O62 C;  5AV6 B;  4YS3 A;  5GT0 B;  2XD5 A;  1P3P B;  5B1L C;  2FJ7 D;  4H9R A;  3X1S C;  2CV5 C;  2JE5 A;  5DNN B;  5CPJ B;  4J8U A;  5GT0 D;  5AVB A;  4M6B A;  5B0Y B;  3UT9 B;  1P3P D;  5B24 A;  2RIQ A;  5F99 D;  1PZR A;  5G49 A;  3MGR D;  4X23 D;  3P5J B;  4WNN B;  3MGP B;  2ZY2 A;  5AV8 B;  1P34 D;  3EPH A;  3REL C;  2ARO A;  3AZH B;  5B2J A;  3UT9 D;  5B31 G;  1AOI C;  1BH9 B;  3MGP D;  3UTB C;  5B32 C;  5AV8 D;  2PYO A;  3AZH D;  1F66 B;  3WAA D;  1P3B C;  3MGS C;  5JA4 A;  5GT3 C;  3WTP B;  2Y2I A;  4XZQ A;  3AZL A;  2F8N A;  5CPK B;  3WA9 A;  3W96 D;  2BG1 A;  1F66 D;  1M1A B;  5E5A A;  2NZD B;  3AFA A;  5AV9 C;  2HIO C;  1KX4 C;  5GSU A;  1P3M A;  5CPK D;  5JRG C;  2Y2L A;  3C1B A;  5DNM A;  3REI D;  1M1A D;  5AV6 A;  5BNV B;  5BNX B;  3MGQ B;  4H9S C;  4LD9 D;  2Y2G A;  5DNN A;  4R8P C;  1TAF A;  2BYK B;  1T3U A;  3TU4 B;  5CPJ A;  5C3I C;  5FUG B;  5B0Y A;  3VH5 W;  3LEL C;  4J8X B;  3AYW C;  4WU9 C;  2YFW B;  3W99 C;  3W98 B;  4WNN A;  1ID3 C;  3MVD B;  2Y2K A;  3TU4 D;  1P3I B;  2UWX A;  3AZH A;  1P3O B;  1P3L D;  4H9N B;  1JFI A;  1BFM A;  3AZK C;  4WU8 C;  5CP6 C;  3NQU B;  5AV5 A;  4J8X D;  3W98 D;  3KSY A;  3MVD D;  4ZBJ C;  1P3O D;  2Y2J A;  5B1M A;  2NQB C;  5B24 C;  5GXQ C;  3AZJ C;  1KX3 C;  3WTP A;  4Z66 B;  3LZ0 B;  3AN2 A;  3WKJ B;  3X1S D;  2CV5 D;  5CPK A;  1S32 C;  3A1I A;  5BS7 A;  5B2J C;  1U35 C;  1M19 B;  2NZD A;  3FDD A;  1KX5 C;  1WWS A;  4QLC B;  4CAY B;  4YM6 B;  4Z66 D;  3LZ1 C;  3B6G C;  2PYO C;  3AV1 C;  4DRB A;  3REL D;  1P3B B;  3B0C W;  4DRA A;  3EPK A;  1P3A B;  1P3G B;  5BNV A;  5BNX A;  3MGQ A;  4QLC D;  4YM6 D;  3UTB D;  3AZN A;  4ZUX C;  2IO5 C;  5CPI C;  2BYK A;  3TU4 A;  3B6F A;  1P3B D;  3MGS D;  4KGC B;  1P3A D;  5GT3 D;  1P3G D;  3EG5 B;  2YFV B;  4Z2M H;  4J8W B;  1KX4 B;  1P3M C;  3AZG A;  3C1B C;  3W98 A;  3H0R C;  3B0D B;  1HQ3 C;  1P3I A;  3VH6 A;  4H9N A;  1P3F B;  5AV9 D;  2HIO D;  1KX4 D;  3NQU A;  3LJA B;  2Y2O A;  5JRG D;  5B31 C;  1F1E A;  3AZF C;  1P3F D;  3VH5 A;  3X1U C;  3AZM C;  4J8V C;  3LZ0 A;  3WKJ A;  4H9Q B;  1M18 B;  1Q9C A;  1EQZ B;  4R8P D;  4G92 B;  3C1C B;  3AL0 C;  3R45 A;  1M19 A;  3AZI C;  5AVC A;  5B0Z B;  4CAY A;  3LEL D;  4WU9 D;  1M18 D;  2DF4 C;  3AV2 C;  1ID3 D;  1EQZ D;  5B1M C;  3KUY C;  4G91 B;  4WU8 D;  5CP6 D;  1P3A A;  1KX3 B;  3AN2 C;  2FJ7 B;  3KWQ C;  3A6N C;  4WJ3 C;  4XUJ C;  2Y2P A;  2NQB D;  5GXQ D;  4KGC A;  3AZJ D;  1KX3 D;  3KXB C;  4J8W A;  5F99 B;  4E44 A;  3MGR B;  4X23 B;  3REH A;  5B40 B;  1S32 D;  1U35 D;  1P34 B;  4EO5 B;  1KX5 D;  3X1T B;  2F8N K;  3LJA A;  3LZ1 D;  3B6G D;  2BYM B;  5B40 D;  3B6F C;  4H9O B;  1BH8 B;  3UTA B;  3WAA B;  2G5H C;  4E45 A;  3REK C;  3X1T D;  4H9Q A;  1EQZ A;  4ZUX D;  5CPI D;  3C1C A;  3MNN C;  4JJN C;  3B0C T;  3W96 B;  3UTA D;  5B33 A;  3W97 B;  4KUD C;  5B0Z A;  4AWL B;  1HQ3 D;  3REI B;  1ZLA C;  3X1V C;  3W97 D;  4J8V B;  2FJ7 A;  5KDM A;  4CSR B;  4KHA B;  1N1J B;  4LD9 B;  3AZF D;  5B2I B;  5AVC C;  3VH6 W;  3REJ C;  3AZE C;  5GT0 A;  3X1U D;  1P3P A;  3AZM D;  4J8V D;  5F99 A;  3MGR A;  1A7W A;  4X23 A;  1TZY C;  1P3K C;  4Z5T C;  3F6T A;  1P34 A;  2F8N H;  5B2I D;  3AZI D;  1P3L B;  4DQY B;  5AY8 C;  3UT9 A;  4XUJ B;  3AV2 D;  2BYM A;  5BO0 B;  3MGP A;  3KUY D;  5AV8 A;  1BH8 A;  4YS3 C;  3O62 B;  3UTA A;  3WAA A;  5B1L B;  4WV4 B;  3KWQ D;  3REH C;  3A6N D;  4XUJ D;  3X1S B;  2CV5 B;  1BH9 A;  4HGA C;  3H0L C;  3W96 A;  4J8U C;  1ULY A;  3WTP E;  3O62 D;  5AVB C;  1F66 A;  3EPL A;  3KXB D;  2LY8 A;  5B1L D;  3W97 A;  2VQR A;  2ARO C;  3REL B;  3REI A;  1M1A A;  2ZY4 A;  2HUE C;  1AOI B;  1R4V A;  4KHA A;  1N1J A;  3UTB B;  5B32 B;  4LD9 A;  5B33 C;  5B2I A;  3MGS B;  2J8P A;  3REK D;  4KUD B;  3IP4 C;  4XZQ C;  5GT3 B;  3AZL C;  2Y2N A;  1AOI D;  3WA9 C;  3MNN D;  5B32 D;  5E5A C;  3AFA C;  1P3L A;  4KUD D;  5FUG A;  2HIO B;  2RVQ C;  5AV9 B;  5GSU C;  3KFU G;  4J8X A;  2YFW A;  5JRG B;  5DNM C;  5BO0 A;  3MVD A;  5AV6 C;  5GT0 C;  1P3O A;  3REJ B;  1ZLA D;  3X1V D;  2G5I C;  4WZS B;  5DNN C;  3X1S A;  2CV5 A;  5CPJ C;  4R8P B;  2L5A A;  5C3I B;  5B0Y C;  3REJ D;  3UT9 C;  4Z66 A;  3LEL B;  3AYW B;  4WU9 B;  3MGP C;  1TZY D;  3W99 B;  5AV8 C;  4Z5T D;  1P3K D;  1ID3 B;  3AZH C;  4YS3 B;  3VH6 T;  3REL A;  5AY8 D;  3AZK B;  4WU8 B;  5CP6 B;  5AV5 C;  2Y2Q A;  4QLC A;  4YM6 A;  3AYW D;  3W99 D;  2JCH A;  3UTB A;  4ZBJ B;  1F66 C;  4YS3 D;  1P3B A;  3MGS A;  5B24 B;  3VH5 T;  2NQB B;  5GXQ B;  3WTP C;  3AZK D;  3AZJ B;  5GT3 A;  1P3G A;  5CPK C;  5BS7 C;  1S32 B;  5B2J B;  5AVB D;  2NZD C;  1U35 B;  5B24 D;  5AV9 A;  2HIO A;  1Z2C B;  4NFT A;  1KX4 A;  2YFV A;  1KX5 B;  3LZ1 B;  3B6G B;  5JRG A;  2PYO B;  2ARO D;  3AV1 B;  5B2J D;  1P3F A;  3MGQ C;  2F8N B;  3AZN C;  4H9S A;  2PYO D;  3AV1 D;  4ZUX B;  2IO5 B;  4R8P A;  3TU4 C;  5CPI B;  4H9P B;  3NQJ B;  1WWI A;  3A1K A;  4XZQ D;  3AZL D;  2F8N D;  3AZG C;  1P3M B;  4J8X C;  3LEL A;  3WA9 D;  3C1B B;  4WU9 A;  1M18 A;  3MVD C;  3W98 C;  1ID3 A;  1P3I C;  1HQ3 B;  5E5A D;  3AFA D;  1P3O C;  2RVQ D;  3AZK A;  4WU8 A;  5CP6 A;  5GSU D;  1P3M D;  3C1B D;  5DNM D;  1TAF B;  5AV6 D;  5B31 B;  3AZF B;  2DQN C;  2NQB A;  5GXQ A;  3AZJ A;  1KX3 A;  3X1U B;  4NE6 A;  4Z66 C;  3LZ0 C;  3AZM B;  3V9R B;  3WKJ C;  5DNN D;  5CPJ D;  1S32 A;  1M19 C;  1JFI B;  5B0Y D;  1U35 A;  5B31 D;  3AZI B;  5AV5 B;  4QLC C;  2XD1 A;  4YM6 C;  1KX5 A;  3LZ1 A;  3B6G A;  3AV2 B;  5B40 A;  3AV1 A;  5B1M B;  3KUY B;  1P3A C;  2ZM5 A;  1P3G C;  3EPJ A;  3B0B A;  5AV5 D;  3AN2 B;  3KWQ B;  3X1T A;  3A6N B;  4ZUX A;  5B1M D;  5CPI A;  1W2E A;  4H9O A;  4H9P A;  4KGC C;  3NQJ A;  3WTP D;  4J8W C;  3KXB B;  3AN2 D;  2JSS A;  3B0D C;  4UUZ B;  1HQ3 A;  2NZD D;  2FFF B;  1P3F C;  4Z2M G;  3LJA C;  2F2A C;  3AZN B;  3B6F B;  5B31 A;  3AZF A;  3MGQ D;  5BT1 C;  3AZG B;  3X1U A;  3REK B;  3AZM A;  4J8V A;  3V9R A;  1M18 C;  3AZN D;  1EQZ C;  4CSR A;  4G92 C;  3C1C C;  3B6F D;  3MNN B;  4JJN B;  3AZI A;  3AZG D;  5B0Z C;  2CWE A;  2ZY3 A;  3AV2 A;  1P3I D;  3KUY A;  4JJN D;  4G91 C;  2Y2H A;  2FJ7 C;  1ZLA B;  5B32 G;  3X1V B;  2W8S A;  3KWQ A;  4NE5 A;  3A6N A;  4XUJ A;  3R45 B;  2ZY5 A;  3H0M C;  3O62 A;  5AVC B;  3AZE B;  1P3P C;  3KXB A;  5B1L A;  5F99 C;  3LZ0 D;  3WKJ D;  3MGR C;  4X23 C;  5B40 C;  4UUZ A;  1H3O B;  1TZY B;  1P34 C;  4Z5T B;  1P3K B;  5CHL B;  1M19 D;  4EO5 C;  5AVC D;  3AZE D;  5AY8 B;  3X1T C;  2Y2M A;  3UTA C;  3WAA C;  1B6W A;  3REK A;  3REH B;  4H9R B;  1AOI A;  3W96 C;  4HGA B;  3MNN A;  5B32 A;  1HTA A;  4J8U B;  4JJN A;  4KGC D;  5AVB B;  4J8W D;  3W97 C;  5G49 B;  4KUD A;  3REH D;  1B67 A;  4AWL C;  2ARO B;  4J8U D;  3REI C;  1M1A C;  1ZLA A;  3X1V A;  3LJA D;  4UPK A;  2HUE B;  4LD9 C;  5B33 B;  5B2I C;  5JA4 B;  5BT1 D;  3REJ A;  3AZE A;  4XZQ B;  3AZL B;  3WA9 B;  3C1C D;  1H3O A;  1TZY A;  1P3K A;  4Z5T A;  4NE3 A;  5B33 D; 
#chains in the Genus database with same CATH homology
 5E5A B;  3AFA B;  1P3L C;  5AY8 A;  5B0Z D;  5KDM B;  1KU5 A;  5GSU B;  3AYW A;  3W99 A;  5DNM B;  2F8N G;  3O62 C;  5AV6 B;  4YS3 A;  5GT0 B;  2XD5 A;  1P3P B;  5B1L C;  2FJ7 D;  4H9R A;  3X1S C;  2CV5 C;  2JE5 A;  5DNN B;  5CPJ B;  4J8U A;  5GT0 D;  5AVB A;  4M6B A;  5B0Y B;  3UT9 B;  1P3P D;  5B24 A;  2RIQ A;  5F99 D;  1PZR A;  5G49 A;  3MGR D;  4X23 D;  3P5J B;  4WNN B;  3MGP B;  2ZY2 A;  5AV8 B;  1P34 D;  3EPH A;  3REL C;  2ARO A;  3AZH B;  5B2J A;  3UT9 D;  5B31 G;  1AOI C;  1BH9 B;  3MGP D;  3UTB C;  5B32 C;  5AV8 D;  2PYO A;  3AZH D;  1F66 B;  3WAA D;  1P3B C;  3MGS C;  5JA4 A;  5GT3 C;  3WTP B;  2Y2I A;  4XZQ A;  3AZL A;  2F8N A;  5CPK B;  3WA9 A;  3W96 D;  2BG1 A;  1F66 D;  1M1A B;  5E5A A;  2NZD B;  3AFA A;  5AV9 C;  2HIO C;  1KX4 C;  5GSU A;  1P3M A;  5CPK D;  5JRG C;  2Y2L A;  3C1B A;  5DNM A;  3REI D;  1M1A D;  5AV6 A;  5BNV B;  5BNX B;  3MGQ B;  4H9S C;  4LD9 D;  2Y2G A;  5DNN A;  4R8P C;  1TAF A;  2BYK B;  1T3U A;  3TU4 B;  5CPJ A;  5C3I C;  5FUG B;  5B0Y A;  3VH5 W;  3LEL C;  4J8X B;  3AYW C;  4WU9 C;  2YFW B;  3W99 C;  3W98 B;  4WNN A;  1ID3 C;  3MVD B;  2Y2K A;  3TU4 D;  1P3I B;  2UWX A;  3AZH A;  1P3O B;  1P3L D;  4H9N B;  1JFI A;  1BFM A;  3AZK C;  4WU8 C;  5CP6 C;  3NQU B;  5AV5 A;  4J8X D;  3W98 D;  3KSY A;  3MVD D;  4ZBJ C;  1P3O D;  2Y2J A;  5B1M A;  2NQB C;  5B24 C;  5GXQ C;  3AZJ C;  1KX3 C;  3WTP A;  4Z66 B;  3LZ0 B;  3AN2 A;  3WKJ B;  3X1S D;  2CV5 D;  5CPK A;  1S32 C;  3A1I A;  5BS7 A;  5B2J C;  1U35 C;  1M19 B;  2NZD A;  3FDD A;  1KX5 C;  1WWS A;  4QLC B;  4CAY B;  4YM6 B;  4Z66 D;  3LZ1 C;  3B6G C;  2PYO C;  3AV1 C;  4DRB A;  3REL D;  1P3B B;  3B0C W;  4DRA A;  3EPK A;  1P3A B;  1P3G B;  5BNV A;  5BNX A;  3MGQ A;  4QLC D;  4YM6 D;  3UTB D;  3AZN A;  4ZUX C;  2IO5 C;  5CPI C;  2BYK A;  3TU4 A;  3B6F A;  1P3B D;  3MGS D;  4KGC B;  1P3A D;  5GT3 D;  1P3G D;  3EG5 B;  2YFV B;  4Z2M H;  4J8W B;  1KX4 B;  1P3M C;  3AZG A;  3C1B C;  3W98 A;  3H0R C;  3B0D B;  1HQ3 C;  1P3I A;  3VH6 A;  4H9N A;  1P3F B;  5AV9 D;  2HIO D;  1KX4 D;  3NQU A;  3LJA B;  2Y2O A;  5JRG D;  5B31 C;  1F1E A;  3AZF C;  1P3F D;  3VH5 A;  3X1U C;  3AZM C;  4J8V C;  3LZ0 A;  3WKJ A;  4H9Q B;  1M18 B;  1Q9C A;  1EQZ B;  4R8P D;  4G92 B;  3C1C B;  3AL0 C;  3R45 A;  1M19 A;  3AZI C;  5AVC A;  5B0Z B;  4CAY A;  3LEL D;  4WU9 D;  1M18 D;  2DF4 C;  3AV2 C;  1ID3 D;  1EQZ D;  5B1M C;  3KUY C;  4G91 B;  4WU8 D;  5CP6 D;  1P3A A;  1KX3 B;  3AN2 C;  2FJ7 B;  3KWQ C;  3A6N C;  4WJ3 C;  4XUJ C;  2Y2P A;  2NQB D;  5GXQ D;  4KGC A;  3AZJ D;  1KX3 D;  3KXB C;  4J8W A;  5F99 B;  4E44 A;  3MGR B;  4X23 B;  3REH A;  5B40 B;  1S32 D;  1U35 D;  1P34 B;  4EO5 B;  1KX5 D;  3X1T B;  2F8N K;  3LJA A;  3LZ1 D;  3B6G D;  2BYM B;  5B40 D;  3B6F C;  4H9O B;  1BH8 B;  3UTA B;  3WAA B;  2G5H C;  4E45 A;  3REK C;  3X1T D;  4H9Q A;  1EQZ A;  4ZUX D;  5CPI D;  3C1C A;  3MNN C;  4JJN C;  3B0C T;  3W96 B;  3UTA D;  5B33 A;  3W97 B;  4KUD C;  5B0Z A;  4AWL B;  1HQ3 D;  3REI B;  1ZLA C;  3X1V C;  3W97 D;  4J8V B;  2FJ7 A;  5KDM A;  4CSR B;  4KHA B;  1N1J B;  4LD9 B;  3AZF D;  5B2I B;  5AVC C;  3VH6 W;  3REJ C;  3AZE C;  5GT0 A;  3X1U D;  1P3P A;  3AZM D;  4J8V D;  5F99 A;  3MGR A;  1A7W A;  4X23 A;  1TZY C;  1P3K C;  4Z5T C;  3F6T A;  1P34 A;  2F8N H;  5B2I D;  3AZI D;  1P3L B;  4DQY B;  5AY8 C;  3UT9 A;  4XUJ B;  3AV2 D;  2BYM A;  5BO0 B;  3MGP A;  3KUY D;  5AV8 A;  1BH8 A;  4YS3 C;  3O62 B;  3UTA A;  3WAA A;  5B1L B;  4WV4 B;  3KWQ D;  3REH C;  3A6N D;  4XUJ D;  3X1S B;  2CV5 B;  1BH9 A;  4HGA C;  3H0L C;  3W96 A;  4J8U C;  1ULY A;  3WTP E;  3O62 D;  5AVB C;  1F66 A;  3EPL A;  3KXB D;  2LY8 A;  5B1L D;  3W97 A;  2VQR A;  2ARO C;  3REL B;  3REI A;  1M1A A;  2ZY4 A;  2HUE C;  1AOI B;  1R4V A;  4KHA A;  1N1J A;  3UTB B;  5B32 B;  4LD9 A;  5B33 C;  5B2I A;  3MGS B;  2J8P A;  3REK D;  4KUD B;  3IP4 C;  4XZQ C;  5GT3 B;  3AZL C;  2Y2N A;  1AOI D;  3WA9 C;  3MNN D;  5B32 D;  5E5A C;  3AFA C;  1P3L A;  4KUD D;  5FUG A;  2HIO B;  2RVQ C;  5AV9 B;  5GSU C;  3KFU G;  4J8X A;  2YFW A;  5JRG B;  5DNM C;  5BO0 A;  3MVD A;  5AV6 C;  5GT0 C;  1P3O A;  3REJ B;  1ZLA D;  3X1V D;  2G5I C;  4WZS B;  5DNN C;  3X1S A;  2CV5 A;  5CPJ C;  4R8P B;  2L5A A;  5C3I B;  5B0Y C;  3REJ D;  3UT9 C;  4Z66 A;  3LEL B;  3AYW B;  4WU9 B;  3MGP C;  1TZY D;  3W99 B;  5AV8 C;  4Z5T D;  1P3K D;  1ID3 B;  3AZH C;  4YS3 B;  3VH6 T;  3REL A;  5AY8 D;  3AZK B;  4WU8 B;  5CP6 B;  5AV5 C;  2Y2Q A;  4QLC A;  4YM6 A;  3AYW D;  3W99 D;  2JCH A;  3UTB A;  4ZBJ B;  1F66 C;  4YS3 D;  1P3B A;  3MGS A;  5B24 B;  3VH5 T;  2NQB B;  5GXQ B;  3WTP C;  3AZK D;  3AZJ B;  5GT3 A;  1P3G A;  5CPK C;  5BS7 C;  1S32 B;  5B2J B;  5AVB D;  2NZD C;  1U35 B;  5B24 D;  5AV9 A;  2HIO A;  1Z2C B;  4NFT A;  1KX4 A;  2YFV A;  1KX5 B;  3LZ1 B;  3B6G B;  5JRG A;  2PYO B;  2ARO D;  3AV1 B;  5B2J D;  1P3F A;  3MGQ C;  2F8N B;  3AZN C;  4H9S A;  2PYO D;  3AV1 D;  4ZUX B;  2IO5 B;  4R8P A;  3TU4 C;  5CPI B;  4H9P B;  3NQJ B;  1WWI A;  3A1K A;  4XZQ D;  3AZL D;  2F8N D;  3AZG C;  1P3M B;  4J8X C;  3LEL A;  3WA9 D;  3C1B B;  4WU9 A;  1M18 A;  3MVD C;  3W98 C;  1ID3 A;  1P3I C;  1HQ3 B;  5E5A D;  3AFA D;  1P3O C;  2RVQ D;  3AZK A;  4WU8 A;  5CP6 A;  5GSU D;  1P3M D;  3C1B D;  5DNM D;  1TAF B;  5AV6 D;  5B31 B;  3AZF B;  2DQN C;  2NQB A;  5GXQ A;  3AZJ A;  1KX3 A;  3X1U B;  4NE6 A;  4Z66 C;  3LZ0 C;  3AZM B;  3V9R B;  3WKJ C;  5DNN D;  5CPJ D;  1S32 A;  1M19 C;  1JFI B;  5B0Y D;  1U35 A;  5B31 D;  3AZI B;  5AV5 B;  4QLC C;  2XD1 A;  4YM6 C;  1KX5 A;  3LZ1 A;  3B6G A;  3AV2 B;  5B40 A;  3AV1 A;  5B1M B;  3KUY B;  1P3A C;  2ZM5 A;  1P3G C;  3EPJ A;  3B0B A;  5AV5 D;  3AN2 B;  3KWQ B;  3X1T A;  3A6N B;  4ZUX A;  5B1M D;  5CPI A;  1W2E A;  4H9O A;  4H9P A;  4KGC C;  3NQJ A;  3WTP D;  4J8W C;  3KXB B;  3AN2 D;  2JSS A;  3B0D C;  4UUZ B;  1HQ3 A;  2NZD D;  2FFF B;  1P3F C;  4Z2M G;  3LJA C;  2F2A C;  3AZN B;  3B6F B;  5B31 A;  3AZF A;  3MGQ D;  5BT1 C;  3AZG B;  3X1U A;  3REK B;  3AZM A;  4J8V A;  3V9R A;  1M18 C;  3AZN D;  1EQZ C;  4CSR A;  4G92 C;  3C1C C;  3B6F D;  3MNN B;  4JJN B;  3AZI A;  3AZG D;  5B0Z C;  2CWE A;  2ZY3 A;  3AV2 A;  1P3I D;  3KUY A;  4JJN D;  4G91 C;  2Y2H A;  2FJ7 C;  1ZLA B;  5B32 G;  3X1V B;  2W8S A;  3KWQ A;  4NE5 A;  3A6N A;  4XUJ A;  3R45 B;  2ZY5 A;  3H0M C;  3O62 A;  5AVC B;  3AZE B;  1P3P C;  3KXB A;  5B1L A;  5F99 C;  3LZ0 D;  3WKJ D;  3MGR C;  4X23 C;  5B40 C;  4UUZ A;  1H3O B;  1TZY B;  1P34 C;  4Z5T B;  1P3K B;  5CHL B;  1M19 D;  4EO5 C;  5AVC D;  3AZE D;  5AY8 B;  3X1T C;  2Y2M A;  3UTA C;  3WAA C;  1B6W A;  3REK A;  3REH B;  4H9R B;  1AOI A;  3W96 C;  4HGA B;  3MNN A;  5B32 A;  1HTA A;  4J8U B;  4JJN A;  4KGC D;  5AVB B;  4J8W D;  3W97 C;  5G49 B;  4KUD A;  3REH D;  1B67 A;  4AWL C;  2ARO B;  4J8U D;  3REI C;  1M1A C;  1ZLA A;  3X1V A;  3LJA D;  4UPK A;  2HUE B;  4LD9 C;  5B33 B;  5B2I C;  5JA4 B;  5BT1 D;  3REJ A;  3AZE A;  4XZQ B;  3AZL B;  3WA9 B;  3C1C D;  1H3O A;  1TZY A;  1P3K A;  4Z5T A;  4NE3 A;  5B33 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...