3AZGA

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAQRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgA00
1ZLAB 5G49B 1P3MC 3AFAA 4ZBJB 3X1SC 2NQBB 3KXBA 1F66D 3AYWD 3MVDC 3UTBA 1TZYC 3UT9A 3NQJA 3AZFB 5B40A 1KX4A 2F8NK 3AZEC 3WA9D 3A6ND 4KGCC 3C1BA 1P3IB 1ID3D 4WU9A 5B1MA 1M1AC 2HIOA 5F99A 5BNXB 3AZGB 1ZLAD 3WAAA 5GT3B 3C1CB 4J8UA 3RELA 3AZNB 2NQBD 5B0YB 3X1UC 5B31G 4J8WA 3VH6A 3TU4C 4NE3A 5AV8A 4H9PB 1EQZC 2AROB 3W99B 1KX5B 3AZFD 1P3OC 5B0ZA 5E5AA 5JRGA 1HQ3A 1P3AC 3AZKC 4XUJA 4AWLC 1KX3A 5B33A 1TAFB 1P3ID 5B2IC 3AZLB 5B32B 5B1LC 3AV2A 3AZGD 5GT3D 3C1CD 3W96B 4JJNA 3AZND 5CP6A 5B0YD 3LZ1B 4Z66A 4NE5A 2CWEA 4DRAA 1M18C 3AYWC 2JSSA 1S32A 2AROD 3W99D 3B0CW 2CV5A 1KX5D 1A7WA 2LY8A 3WTPE 4CSRB 3MGRB 3O62A 3WA9C 5AV9B 4LD9B 4CAYA 3AV1C 1P3KA 3AZLD 3B6FA 1ID3C 5B32D 4J8XA 4UUZB 3AN2C 1M19B 3B6GC 3W96D 3VH5T 1P3MA 3KSYA 3X1SA 5B24C 3LZ1D 3MVDA 1N1JA 4Z2MH 1TZYA 5BS7C 5CHLB 4H9OA 4H9NA 3MGRD 3AZEA 3V9RB 4NFTA 5AV6A 4XZQB 1P3GC 1H3OB 4KGCA 4LD9D 2NZDC 3WKJC 3UTAB 1M1AA 5KDMB 3B0BA 1M19D 3LELC 4H9SC 5GT3C 4J8VC 3X1UA 3UTBC 3TU4A 4X23C 1EQZA 2AROC 1P3BC 1P3OA 1P3FB 3C1BC 1P3AA 3AZKA 1F1EA 4XZQD 3REJD 3R45A 3WAAC 5B2IA 3UTAD 2F8NA 3AZLC 5B1LA 3MGQC 4DRBA 5B32C 3W96C 5BNVA 3LZ1C 1M18A 3AYWA 1P3FD 1ULYA 5CPIC 5B33C 3WA9A 5B31B 4Z5TC 5AV9C 3AV1A 4LD9C 4H9RA 1P34B 1ID3A 4ZUXB 3AN2A 3B6GA 3REIB 1P3LC 1F66B 1ZLAA 5B24A 1WWIA 5GT0B 5DNMC 4KUDB 5BS7A 4QLCC 2YFWB 3LZ0B 1BH9B 3W98B 2NZDA 1AOIC 4XZQC 3WKJA 1P34D 1P3IA 3REHB 4ZUXD 3LJAB 3REID 5BNXA 4H9SA 3LELA 3AZGA 5GT3A 3C1CA 4J8VA 5GT0D 4X23A 5AV5C 4KUDD 1JFIB 2AROA 3KWQB 1P3BA 3W99A 5AV6C 3LZ0D 1P3FC 3W98D 2BYKB 4EO5B 1TAFA 5GXQB 3REHD 3MGQA 3AZLA 3LJAD 5C3IB 5B32A 3KUYC 3W96A 3MGSB 3X1TB 3W97B 3LZ1A 4WV4B 3AZHB 4YM6C 3KWQD 5CPIA 3WTPC 4CSRA 5JA4A 4Z5TA 4E45A 5AV9A 4LD9A 5B31C 3AFAB 5GXQD 1P34C 4UUZA 1P3LA 1M19A 1F66C 5DNMA 3MGSD 3NQJB 3X1TD 3W97D 4H9QB 3AZHD 5CPKB 4QLCA 4WU8B 5BO0B 4R8PB 3A6NC 5B1MB 3V9RA 1AOIA 4XZQA 3AFAD 1ZLAC 3MNNB 5B2JB 5KDMA 4ZBJC 2NQBC 3LJAC 5AV5A 5E5AB 5CPKD 4XUJB 3AZFC 1KX3B 4WU8D 4KHAB 4R8PD 5FUGB 3REJB 5B1MD 1P3FA 1P3IC 4EO5C 5AVCB 5CPJB 3AZGC 3REKB 3VH6T 5GXQC 3MNND 3C1CC 5B2JD 3AZMB 3AZNC 1S32B 3KUYA 5B0YC 2IO5B 2CV5B 5E5AD 3W99C 3X1TC 1KX5C 4XUJD 4YM6A 1KX3D 3AZHC 3WTPA 4J8XB 5B31A 1P3PB 5AVCD 5CPJD 3X1SB 3REKD 1P34A 3MVDB 3AZMD 4Z2MG 1N1JB 1S32D 3B0CT 1F66A 4H9OB 2CV5D 3NQUA 3X1VB 3AZIB 2YFVB 1HTAA 4KGCB 2HUEB 3MGRC 2BYMB 4WU8C 3A6NA 3B6FD 2YFWA 1M1AB 4R8PC 4J8XD 3W98A 1P3PD 3X1SD 1M19C 5G49A 3REHA 3MVDD 3TU4B 3MNNC 2NQBA 3LJAA 1EQZB 5B2JC 3X1VD 1P3OB 3AZID 1P3AB 3AZKB 4AWLB 3AZFA 5AY8B 4KGCD 2PYOB 1M1AD 5B1LB 3REJC 4G92B 2BYKA 3UTAC 1BH8B 3AZJB 3X1UD 5GXQA 3MGPB 4YS3B 2RVQD 5GSUB 5CPJC 3REKC 3TU4D 3AZNA 1M18B 1EQZD 5B0YA 2F8NH 2IO5C 5DNNB 4H9PA 3MGSA 1P3OD 3X1TA 1P3AD 5AVBB 3AZKD 1KX5A 1R4VA 5AY8D 3AZHA 2PYOD 3AV1B 4WNNB 5B1LD 3B6GB 2FJ7B 5B24B 1P3PC 3AZJD 4YS3D 3MGPD 5GSUD 3VH5W 1M18D 3VH5A 1U35B 1Q9CA 5DNND 4HGAB 3X1VC 3AZIC 5AVBD 1P3GB 4H9QA 2NZDB 5CPKA 3MGRA 3AV1D 2HUEC 3WKJB 4WU8A 5BO0A 4R8PA 3AN2D 3B6GD 3KXBB 3LELB 2FJ7D 4ZUXC 5B24D 4J8VB 3UTBB 3UT9B 1WWSA 3REIC 2F8NG 4X23B 3MNNA 2RVQC 3VH6W 4E44A 5BT1D 5GT0C 5B40B 5B2JA 1U35D 1KX4B 1P3BB 4KUDC 3C1BB 4WU9B 1P3GD 2NZDD 3LZ0C 2HIOB 5AY8C 5F99B 3W98C 2PYOC 3WKJD 3WAAB 1H3OA 4KHAA 3MGQB 5FUGA 4J8UB 3REJA 3RELB 3KXBD 3LELD 4G92C 3UTAA 3REHC 4J8WB 5AV8B 4J8VD 3UTBD 5AVCA 3UT9D 5CPJA 3REKA 3AZJC 4YS3C 4X23D 3MGPC 5GSUC 5B40D 5B0ZB 3AZMA 1KX4D 5JRGB 1HQ3B 1P3BD 4G91B 5CPIB 5B33B 5DNNC 3C1BD 3KWQC 4WU9D 5JA4B 4Z5TB 5AVBC 3AV2B 2HIOD 5F99D 3WAAD 4J8UD 3MGQD 4JJNB 3RELD 3B0DB 5CP6B 4Z66B 1P3LB 4J8WD 2FJ7C 5AV8D 1P3PA 5DNMB 5C3IC 1BFMA 5B0ZD 3MGSC 3W97C 5BT1C 5JRGD 1HQ3D 4QLCB 1U35C 3O62B 5CPID 5B33D 3X1VA 4CAYB 3AZIA 2YFVA 1P3KB 4HGAC 3B6FB 4Z5TD 5AV9D 1AOIB 3AV2D 2BYMA 1P3MB 4JJND 5CP6D 3AFAC 4Z66D 1P3LD 4ZUXA 3KXBC 1TZYB 5DNMD 3REIA 4H9NB 5AV5B 3UT9C 5B32G 5GT0A 3AZEB 4QLCD 5B40C 1KX4C 3O62D 4KUDA 5AV6B 5CPKC 1P3KD 3LZ0A 4WU9C 1AOID 1BH9A 5B1MC 5AY8A 2PYOA 5F99C 2HIOC 1P3MD 4J8UC 3X1UB 3RELC 4WZSB 3KUYB 1KU5A 1TZYD 4J8WC 1BH8A 5AV8C 3AZJA 4YS3A 5AV5D 3MGPA 5GSUA 3AZED 4YM6B 5B0ZC 1B67A 5E5AC 5JRGC 5AV6D 1HQ3C 3WTPB 4M6BA 4G91C 5DNNA 1JFIA 3R45B 4XUJC 1KX3C 3KWQA 5B2IB 5AVBA 2F8NB 1B6WA 3AV2C 2L5AA 4NE6A 4WNNA 4JJNC 5AVCC 3B0DC 5CP6C 3KUYD 5BNVB 4Z66C 2FJ7A 3AYWB 3AZMC 3NQUB 1S32C 2CV5C 3W97A 1U35A 4YM6D 3WA9B 3WTPD 3O62C 3A6NB 5B2ID 4H9RB 1P3KC 1ID3B 1P3GA 2F8ND 3B6FC 5B31D 3AN2B 4J8XC
chains in the Genus database with same CATH superfamily
1ZLAB 5G49B 1P3MC 3AFAA 4ZBJB 3X1SC 2NQBB 3KXBA 1F66D 3AYWD 3MVDC 3UTBA 1TZYC 3UT9A 3NQJA 3AZFB 5B40A 1KX4A 2F8NK 3AZEC 3WA9D 3A6ND 4KGCC 3C1BA 1P3IB 1ID3D 4WU9A 5B1MA 1M1AC 2HIOA 5F99A 5BNXB 3AZGB 1ZLAD 3WAAA 5GT3B 3C1CB 4J8UA 3RELA 3AZNB 2NQBD 5B0YB 3X1UC 5B31G 4J8WA 3VH6A 3TU4C 4NE3A 5AV8A 4H9PB 1EQZC 2AROB 3W99B 1KX5B 3AZFD 1P3OC 5B0ZA 5E5AA 5JRGA 3EPLA 1HQ3A 1P3AC 3AZKC 4XUJA 4AWLC 1KX3A 5B33A 1TAFB 1P3ID 5B2IC 3AZLB 5B32B 2W8SA 5B1LC 3AV2A 3AZGD 5GT3D 3C1CD 3W96B 4JJNA 3AZND 5CP6A 5B0YD 3LZ1B 4Z66A 4NE5A 2CWEA 2Y2LA 4DRAA 1M18C 3AYWC 2JSSA 1S32A 2AROD 2J8PA 3W99D 3B0CW 2CV5A 1KX5D 1A7WA 2LY8A 3WTPE 4CSRB 3MGRB 1T3UA 3O62A 3WA9C 5AV9B 4LD9B 4CAYA 3AV1C 1P3KA 3AZLD 3B6FA 1ID3C 5B32D 4J8XA 4UUZB 3AN2C 1M19B 3B6GC 2DQNC 3W96D 3VH5T 1P3MA 3KSYA 3X1SA 5B24C 3LZ1D 3MVDA 1N1JA 4Z2MH 1TZYA 5BS7C 5CHLB 4H9OA 4H9NA 3MGRD 3AZEA 3V9RB 4NFTA 5AV6A 4XZQB 1P3GC 1H3OB 4KGCA 4LD9D 2NZDC 2ZY4A 3WKJC 3UTAB 1M1AA 5KDMB 3B0BA 1M19D 3LELC 4H9SC 5GT3C 4J8VC 3X1UA 3UTBC 3TU4A 4X23C 1EQZA 2AROC 1P3BC 1P3OA 1P3FB 3C1BC 1P3AA 3AZKA 1F1EA 4XZQD 3REJD 3R45A 3WAAC 5B2IA 3UTAD 2F8NA 3AZLC 5B1LA 3MGQC 4DRBA 5B32C 3W96C 5BNVA 3LZ1C 3A1KA 1M18A 3AYWA 2ZY2A 1P3FD 1ULYA 5CPIC 5B33C 3WA9A 5B31B 4Z5TC 5AV9C 3AV1A 4LD9C 3EPHA 4H9RA 1P34B 1ID3A 4ZUXB 3AN2A 3B6GA 3REIB 1P3LC 1F66B 1ZLAA 5B24A 1WWIA 5GT0B 5DNMC 2G5HC 4KUDB 5BS7A 2VQRA 4QLCC 2YFWB 3LZ0B 1BH9B 3W98B 2NZDA 1AOIC 4XZQC 3WKJA 1P34D 1P3IA 3REHB 4ZUXD 3LJAB 3REID 5BNXA 4H9SA 3LELA 3AZGA 5GT3A 3C1CA 4J8VA 5GT0D 4DQYB 4X23A 5AV5C 4KUDD 1JFIB 2AROA 3KWQB 1P3BA 2ZM5A 3W99A 4WJ3C 5AV6C 3LZ0D 1P3FC 3W98D 2DF4C 2BYKB 4EO5B 1TAFA 5GXQB 3REHD 3MGQA 3AZLA 3EPKA 3LJAD 5C3IB 5B32A 3KUYC 3W96A 3MGSB 3X1TB 3W97B 3LZ1A 4WV4B 3AZHB 4YM6C 3KWQD 5CPIA 3WTPC 4CSRA 5JA4A 4Z5TA 4E45A 3KFUG 5AV9A 4LD9A 2Y2NA 5B31C 3AFAB 5GXQD 1P34C 2RIQA 4UUZA 1P3LA 1M19A 1F66C 5DNMA 3MGSD 3NQJB 3X1TD 3W97D 3EG5B 4H9QB 3AZHD 5CPKB 4QLCA 4WU8B 5BO0B 4R8PB 3A6NC 5B1MB 3V9RA 1AOIA 4XZQA 3AFAD 3F6TA 1ZLAC 3MNNB 5B2JB 5KDMA 4ZBJC 2NQBC 3LJAC 5AV5A 5E5AB 5CPKD 4XUJB 3AZFC 1KX3B 4WU8D 2JE5A 4KHAB 4R8PD 5FUGB 3REJB 5B1MD 1P3FA 1P3IC 4EO5C 2BG1A 5AVCB 5CPJB 3AZGC 3REKB 3VH6T 5GXQC 3MNND 3C1CC 5B2JD 3AZMB 3AZNC 1S32B 3KUYA 5B0YC 2JCHA 2IO5B 2CV5B 5E5AD 3W99C 3X1TC 1KX5C 2Y2OA 4XUJD 4YM6A 1KX3D 1PZRA 3AZHC 3WTPA 4J8XB 3EPJA 5B31A 1P3PB 5AVCD 5CPJD 3X1SB 3REKD 1P34A 3MVDB 3AZMD 4Z2MG 1N1JB 3IP4C 1S32D 3B0CT 3P5JB 1F66A 4H9OB 4UPKA 2CV5D 3NQUA 3X1VB 3AZIB 2YFVB 1HTAA 4KGCB 2HUEB 3MGRC 2BYMB 4WU8C 3A6NA 3B6FD 2YFWA 1M1AB 3AL0C 4R8PC 4J8XD 3W98A 1P3PD 3X1SD 2ZY3A 1M19C 5G49A 3REHA 3MVDD 3TU4B 3MNNC 2NQBA 2XD1A 3LJAA 1EQZB 5B2JC 2F2AC 3X1VD 1P3OB 3AZID 1P3AB 3AZKB 4AWLB 3AZFA 5AY8B 4KGCD 2PYOB 2XD5A 1M1AD 5B1LB 3REJC 3A1IA 4G92B 2BYKA 3UTAC 1BH8B 3AZJB 3X1UD 5GXQA 3MGPB 4YS3B 2RVQD 5GSUB 5CPJC 3REKC 3TU4D 3AZNA 1M18B 1EQZD 5B0YA 2F8NH 2IO5C 5DNNB 4H9PA 3MGSA 1P3OD 3X1TA 1P3AD 5AVBB 3AZKD 1KX5A 1R4VA 5AY8D 3AZHA 2Y2JA 3AV1B 2PYOD 4WNNB 5B1LD 3B6GB 2FJ7B 5B24B 1P3PC 3AZJD 4YS3D 3MGPD 5GSUD 3VH5W 1M18D 3VH5A 1U35B 2Y2PA 1Q9CA 5DNND 4HGAB 3X1VC 3AZIC 5AVBD 1P3GB 4H9QA 2NZDB 1Z2CB 5CPKA 3MGRA 3AV1D 2HUEC 3WKJB 4WU8A 2Y2QA 5BO0A 4R8PA 3AN2D 3B6GD 2FFFB 3KXBB 3LELB 2FJ7D 4ZUXC 5B24D 4J8VB 3UTBB 3UT9B 1WWSA 3REIC 2F8NG 4X23B 3MNNA 2RVQC 3VH6W 4E44A 5BT1D 5GT0C 5B40B 5B2JA 1U35D 1KX4B 1P3BB 4KUDC 3C1BB 4WU9B 1P3GD 2NZDD 2G5IC 3LZ0C 2HIOB 5AY8C 5F99B 3W98C 2PYOC 3WKJD 3WAAB 1H3OA 4KHAA 3MGQB 5FUGA 4J8UB 3REJA 3RELB 3KXBD 3LELD 4G92C 3UTAA 3REHC 4J8WB 5AV8B 4J8VD 3UTBD 5AVCA 3UT9D 5CPJA 3REKA 3AZJC 4YS3C 4X23D 3MGPC 3H0MC 3FDDA 5GSUC 5B40D 5B0ZB 3AZMA 1KX4D 5JRGB 1HQ3B 1P3BD 4G91B 5CPIB 5B33B 5DNNC 3C1BD 3KWQC 1W2EA 4WU9D 5JA4B 4Z5TB 5AVBC 3AV2B 2HIOD 5F99D 3WAAD 4J8UD 3MGQD 4JJNB 2Y2KA 3RELD 3B0DB 5CP6B 4Z66B 1P3LB 4J8WD 2FJ7C 5AV8D 1P3PA 3H0LC 5C3IC 5DNMB 1BFMA 5B0ZD 3MGSC 3W97C 5BT1C 5JRGD 1HQ3D 4QLCB 1U35C 3O62B 5CPID 5B33D 3X1VA 4CAYB 3AZIA 2YFVA 1P3KB 4HGAC 3B6FB 4Z5TD 5AV9D 1AOIB 3AV2D 2Y2GA 2BYMA 1P3MB 4JJND 5CP6D 3AFAC 4Z66D 1P3LD 4ZUXA 3KXBC 1TZYB 5DNMD 3REIA 4H9NB 5AV5B 3UT9C 5B32G 5GT0A 3AZEB 4QLCD 5B40C 1KX4C 3O62D 4KUDA 5AV6B 5CPKC 1P3KD 3H0RC 3LZ0A 4WU9C 1AOID 1BH9A 2ZY5A 5B1MC 5AY8A 2PYOA 2HIOC 5F99C 1P3MD 4J8UC 3X1UB 3RELC 4WZSB 3KUYB 1KU5A 1TZYD 4J8WC 1BH8A 5AV8C 3AZJA 4YS3A 5AV5D 3MGPA 2Y2HA 5GSUA 3AZED 4YM6B 5B0ZC 1B67A 5E5AC 5JRGC 5AV6D 1HQ3C 3WTPB 4M6BA 4G91C 5DNNA 1JFIA 3R45B 4XUJC 2Y2IA 3KWQA 5B2IB 1KX3C 5AVBA 2F8NB 1B6WA 3AV2C 2L5AA 4NE6A 4WNNA 2UWXA 4JJNC 5AVCC 3B0DC 5CP6C 3KUYD 5BNVB 4Z66C 2FJ7A 3AYWB 3AZMC 3NQUB 1S32C 2CV5C 3W97A 1U35A 4YM6D 3WA9B 3WTPD 3O62C 3A6NB 5B2ID 2Y2MA 4H9RB 1P3KC 1ID3B 1P3GA 2F8ND 3B6FC 5B31D 3AN2B 4J8XC
chains in the Genus database with same CATH topology
1ZLAB 5G49B 1P3MC 3AFAA 4ZBJB 3X1SC 2NQBB 3KXBA 1F66D 3AYWD 3MVDC 3UTBA 1TZYC 3UT9A 3NQJA 3AZFB 5B40A 1KX4A 2F8NK 3AZEC 3WA9D 3A6ND 4KGCC 3C1BA 1P3IB 1ID3D 4WU9A 5B1MA 1M1AC 2HIOA 5F99A 5BNXB 3AZGB 1ZLAD 3WAAA 5GT3B 3C1CB 4J8UA 3RELA 3AZNB 2NQBD 5B0YB 3X1UC 5B31G 4J8WA 3VH6A 3TU4C 4NE3A 5AV8A 4H9PB 1EQZC 2AROB 3W99B 1KX5B 3AZFD 1P3OC 5B0ZA 5E5AA 5JRGA 3EPLA 1HQ3A 1P3AC 3AZKC 4XUJA 4AWLC 1KX3A 5B33A 1TAFB 1P3ID 5B2IC 3AZLB 5B32B 2W8SA 5B1LC 3AV2A 3AZGD 5GT3D 3C1CD 3W96B 4JJNA 3AZND 5CP6A 5B0YD 3LZ1B 4Z66A 4NE5A 2CWEA 2Y2LA 4DRAA 1M18C 3AYWC 2JSSA 1S32A 2AROD 2J8PA 3W99D 3B0CW 2CV5A 1KX5D 1A7WA 2LY8A 3WTPE 4CSRB 3MGRB 1T3UA 3O62A 3WA9C 5AV9B 4LD9B 4CAYA 3AV1C 1P3KA 3AZLD 3B6FA 1ID3C 5B32D 4J8XA 4UUZB 3AN2C 1M19B 3B6GC 2DQNC 3W96D 3VH5T 1P3MA 3KSYA 3X1SA 5B24C 3LZ1D 3MVDA 1N1JA 4Z2MH 1TZYA 5BS7C 5CHLB 4H9OA 4H9NA 3MGRD 3AZEA 3V9RB 4NFTA 5AV6A 4XZQB 1P3GC 1H3OB 4KGCA 4LD9D 2NZDC 2ZY4A 3WKJC 3UTAB 1M1AA 5KDMB 3B0BA 1M19D 3LELC 4H9SC 5GT3C 4J8VC 3X1UA 3UTBC 3TU4A 4X23C 1EQZA 2AROC 1P3BC 1P3OA 1P3FB 3C1BC 1P3AA 3AZKA 1F1EA 4XZQD 3REJD 3R45A 3WAAC 5B2IA 3UTAD 2F8NA 3AZLC 5B1LA 3MGQC 4DRBA 5B32C 3W96C 5BNVA 3LZ1C 3A1KA 1M18A 3AYWA 2ZY2A 1P3FD 1ULYA 5CPIC 5B33C 3WA9A 5B31B 4Z5TC 5AV9C 3AV1A 4LD9C 3EPHA 4H9RA 1P34B 1ID3A 4ZUXB 3AN2A 3B6GA 3REIB 1P3LC 1F66B 1ZLAA 5B24A 1WWIA 5GT0B 5DNMC 2G5HC 4KUDB 5BS7A 2VQRA 4QLCC 2YFWB 3LZ0B 1BH9B 3W98B 2NZDA 1AOIC 4XZQC 3WKJA 1P34D 1P3IA 3REHB 4ZUXD 3LJAB 3REID 5BNXA 4H9SA 3LELA 3AZGA 5GT3A 3C1CA 4J8VA 5GT0D 4DQYB 4X23A 5AV5C 4KUDD 1JFIB 2AROA 3KWQB 1P3BA 2ZM5A 3W99A 4WJ3C 5AV6C 3LZ0D 1P3FC 3W98D 2DF4C 2BYKB 4EO5B 1TAFA 5GXQB 3REHD 3MGQA 3AZLA 3EPKA 3LJAD 5C3IB 5B32A 3KUYC 3W96A 3MGSB 3X1TB 3W97B 3LZ1A 4WV4B 3AZHB 4YM6C 3KWQD 5CPIA 3WTPC 4CSRA 5JA4A 4Z5TA 4E45A 3KFUG 5AV9A 4LD9A 2Y2NA 5B31C 3AFAB 5GXQD 1P34C 2RIQA 4UUZA 1P3LA 1M19A 1F66C 5DNMA 3MGSD 3NQJB 3X1TD 3W97D 3EG5B 4H9QB 3AZHD 5CPKB 4QLCA 4WU8B 5BO0B 4R8PB 3A6NC 5B1MB 3V9RA 1AOIA 4XZQA 3AFAD 3F6TA 1ZLAC 3MNNB 5B2JB 5KDMA 4ZBJC 2NQBC 3LJAC 5AV5A 5E5AB 5CPKD 4XUJB 3AZFC 1KX3B 4WU8D 2JE5A 4KHAB 4R8PD 5FUGB 3REJB 5B1MD 1P3FA 1P3IC 4EO5C 2BG1A 5AVCB 5CPJB 3AZGC 3REKB 3VH6T 5GXQC 3MNND 3C1CC 5B2JD 3AZMB 3AZNC 1S32B 3KUYA 5B0YC 2JCHA 2IO5B 2CV5B 5E5AD 3W99C 3X1TC 1KX5C 2Y2OA 4XUJD 4YM6A 1KX3D 1PZRA 3AZHC 3WTPA 4J8XB 3EPJA 5B31A 1P3PB 5AVCD 5CPJD 3X1SB 3REKD 1P34A 3MVDB 3AZMD 4Z2MG 1N1JB 3IP4C 1S32D 3B0CT 3P5JB 1F66A 4H9OB 4UPKA 2CV5D 3NQUA 3X1VB 3AZIB 2YFVB 1HTAA 4KGCB 2HUEB 3MGRC 2BYMB 4WU8C 3A6NA 3B6FD 2YFWA 1M1AB 3AL0C 4R8PC 4J8XD 3W98A 1P3PD 3X1SD 2ZY3A 1M19C 5G49A 3REHA 3MVDD 3TU4B 3MNNC 2NQBA 2XD1A 3LJAA 1EQZB 5B2JC 2F2AC 3X1VD 1P3OB 3AZID 1P3AB 3AZKB 4AWLB 3AZFA 5AY8B 4KGCD 2PYOB 2XD5A 1M1AD 5B1LB 3REJC 3A1IA 4G92B 2BYKA 3UTAC 1BH8B 3AZJB 3X1UD 5GXQA 3MGPB 4YS3B 2RVQD 5GSUB 5CPJC 3REKC 3TU4D 3AZNA 1M18B 1EQZD 5B0YA 2F8NH 2IO5C 5DNNB 4H9PA 3MGSA 1P3OD 3X1TA 1P3AD 5AVBB 3AZKD 1KX5A 1R4VA 5AY8D 3AZHA 2Y2JA 3AV1B 2PYOD 4WNNB 5B1LD 3B6GB 2FJ7B 5B24B 1P3PC 3AZJD 4YS3D 3MGPD 5GSUD 3VH5W 1M18D 3VH5A 1U35B 2Y2PA 1Q9CA 5DNND 4HGAB 3X1VC 3AZIC 5AVBD 1P3GB 4H9QA 2NZDB 1Z2CB 5CPKA 3MGRA 3AV1D 2HUEC 3WKJB 4WU8A 2Y2QA 5BO0A 4R8PA 3AN2D 3B6GD 2FFFB 3KXBB 3LELB 2FJ7D 4ZUXC 5B24D 4J8VB 3UTBB 3UT9B 1WWSA 3REIC 2F8NG 4X23B 3MNNA 2RVQC 3VH6W 4E44A 5BT1D 5GT0C 5B40B 5B2JA 1U35D 1KX4B 1P3BB 4KUDC 3C1BB 4WU9B 1P3GD 2NZDD 2G5IC 3LZ0C 2HIOB 5AY8C 5F99B 3W98C 2PYOC 3WKJD 3WAAB 1H3OA 4KHAA 3MGQB 5FUGA 4J8UB 3REJA 3RELB 3KXBD 3LELD 4G92C 3UTAA 3REHC 4J8WB 5AV8B 4J8VD 3UTBD 5AVCA 3UT9D 5CPJA 3REKA 3AZJC 4YS3C 4X23D 3MGPC 3H0MC 3FDDA 5GSUC 5B40D 5B0ZB 3AZMA 1KX4D 5JRGB 1HQ3B 1P3BD 4G91B 5CPIB 5B33B 5DNNC 3C1BD 3KWQC 1W2EA 4WU9D 5JA4B 4Z5TB 5AVBC 3AV2B 2HIOD 5F99D 3WAAD 4J8UD 3MGQD 4JJNB 2Y2KA 3RELD 3B0DB 5CP6B 4Z66B 1P3LB 4J8WD 2FJ7C 5AV8D 1P3PA 3H0LC 5C3IC 5DNMB 1BFMA 5B0ZD 3MGSC 3W97C 5BT1C 5JRGD 1HQ3D 4QLCB 1U35C 3O62B 5CPID 5B33D 3X1VA 4CAYB 3AZIA 2YFVA 1P3KB 4HGAC 3B6FB 4Z5TD 5AV9D 1AOIB 3AV2D 2Y2GA 2BYMA 1P3MB 4JJND 5CP6D 3AFAC 4Z66D 1P3LD 4ZUXA 3KXBC 1TZYB 5DNMD 3REIA 4H9NB 5AV5B 3UT9C 5B32G 5GT0A 3AZEB 4QLCD 5B40C 1KX4C 3O62D 4KUDA 5AV6B 5CPKC 1P3KD 3H0RC 3LZ0A 4WU9C 1AOID 1BH9A 2ZY5A 5B1MC 5AY8A 2PYOA 2HIOC 5F99C 1P3MD 4J8UC 3X1UB 3RELC 4WZSB 3KUYB 1KU5A 1TZYD 4J8WC 1BH8A 5AV8C 3AZJA 4YS3A 5AV5D 3MGPA 2Y2HA 5GSUA 3AZED 4YM6B 5B0ZC 1B67A 5E5AC 5JRGC 5AV6D 1HQ3C 3WTPB 4M6BA 4G91C 5DNNA 1JFIA 3R45B 4XUJC 2Y2IA 3KWQA 5B2IB 1KX3C 5AVBA 2F8NB 1B6WA 3AV2C 2L5AA 4NE6A 4WNNA 2UWXA 4JJNC 5AVCC 3B0DC 5CP6C 3KUYD 5BNVB 4Z66C 2FJ7A 3AYWB 3AZMC 3NQUB 1S32C 2CV5C 3W97A 1U35A 4YM6D 3WA9B 3WTPD 3O62C 3A6NB 5B2ID 2Y2MA 4H9RB 1P3KC 1ID3B 1P3GA 2F8ND 3B6FC 5B31D 3AN2B 4J8XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA B;  5G49 B;  1P3M C;  3AFA A;  4ZBJ B;  3X1S C;  2NQB B;  3KXB A;  1F66 D;  3AYW D;  3MVD C;  3UTB A;  1TZY C;  3UT9 A;  3NQJ A;  3AZF B;  5B40 A;  1KX4 A;  2F8N K;  3AZE C;  3WA9 D;  3A6N D;  4KGC C;  3C1B A;  1P3I B;  1ID3 D;  4WU9 A;  5B1M A;  1M1A C;  2HIO A;  5F99 A;  5BNX B;  3AZG B;  1ZLA D;  3WAA A;  5GT3 B;  3C1C B;  4J8U A;  3REL A;  3AZN B;  2NQB D;  5B0Y B;  3X1U C;  5B31 G;  4J8W A;  3VH6 A;  3TU4 C;  4NE3 A;  5AV8 A;  4H9P B;  1EQZ C;  2ARO B;  3W99 B;  1KX5 B;  3AZF D;  1P3O C;  5B0Z A;  5E5A A;  5JRG A;  1HQ3 A;  1P3A C;  3AZK C;  4XUJ A;  4AWL C;  1KX3 A;  5B33 A;  1TAF B;  1P3I D;  5B2I C;  3AZL B;  5B32 B;  5B1L C;  3AV2 A;  3AZG D;  5GT3 D;  3C1C D;  3W96 B;  4JJN A;  3AZN D;  5CP6 A;  5B0Y D;  3LZ1 B;  4Z66 A;  4NE5 A;  2CWE A;  4DRA A;  1M18 C;  3AYW C;  2JSS A;  1S32 A;  2ARO D;  3W99 D;  3B0C W;  2CV5 A;  1KX5 D;  1A7W A;  2LY8 A;  3WTP E;  4CSR B;  3MGR B;  3O62 A;  3WA9 C;  5AV9 B;  4LD9 B;  4CAY A;  3AV1 C;  1P3K A;  3AZL D;  3B6F A;  1ID3 C;  5B32 D;  4J8X A;  4UUZ B;  3AN2 C;  1M19 B;  3B6G C;  3W96 D;  3VH5 T;  1P3M A;  3KSY A;  3X1S A;  5B24 C;  3LZ1 D;  3MVD A;  1N1J A;  4Z2M H;  1TZY A;  5BS7 C;  5CHL B;  4H9O A;  4H9N A;  3MGR D;  3AZE A;  3V9R B;  4NFT A;  5AV6 A;  4XZQ B;  1P3G C;  1H3O B;  4KGC A;  4LD9 D;  2NZD C;  3WKJ C;  3UTA B;  1M1A A;  5KDM B;  3B0B A;  1M19 D;  3LEL C;  4H9S C;  5GT3 C;  4J8V C;  3X1U A;  3UTB C;  3TU4 A;  4X23 C;  1EQZ A;  2ARO C;  1P3B C;  1P3O A;  1P3F B;  3C1B C;  1P3A A;  3AZK A;  1F1E A;  4XZQ D;  3REJ D;  3R45 A;  3WAA C;  5B2I A;  3UTA D;  2F8N A;  3AZL C;  5B1L A;  3MGQ C;  4DRB A;  5B32 C;  3W96 C;  5BNV A;  3LZ1 C;  1M18 A;  3AYW A;  1P3F D;  1ULY A;  5CPI C;  5B33 C;  3WA9 A;  5B31 B;  4Z5T C;  5AV9 C;  3AV1 A;  4LD9 C;  4H9R A;  1P34 B;  1ID3 A;  4ZUX B;  3AN2 A;  3B6G A;  3REI B;  1P3L C;  1F66 B;  1ZLA A;  5B24 A;  1WWI A;  5GT0 B;  5DNM C;  4KUD B;  5BS7 A;  4QLC C;  2YFW B;  3LZ0 B;  1BH9 B;  3W98 B;  2NZD A;  1AOI C;  4XZQ C;  3WKJ A;  1P34 D;  1P3I A;  3REH B;  4ZUX D;  3LJA B;  3REI D;  5BNX A;  4H9S A;  3LEL A;  3AZG A;  5GT3 A;  3C1C A;  4J8V A;  5GT0 D;  4X23 A;  5AV5 C;  4KUD D;  1JFI B;  2ARO A;  3KWQ B;  1P3B A;  3W99 A;  5AV6 C;  3LZ0 D;  1P3F C;  3W98 D;  2BYK B;  4EO5 B;  1TAF A;  5GXQ B;  3REH D;  3MGQ A;  3AZL A;  3LJA D;  5C3I B;  5B32 A;  3KUY C;  3W96 A;  3MGS B;  3X1T B;  3W97 B;  3LZ1 A;  4WV4 B;  3AZH B;  4YM6 C;  3KWQ D;  5CPI A;  3WTP C;  4CSR A;  5JA4 A;  4Z5T A;  4E45 A;  5AV9 A;  4LD9 A;  5B31 C;  3AFA B;  5GXQ D;  1P34 C;  4UUZ A;  1P3L A;  1M19 A;  1F66 C;  5DNM A;  3MGS D;  3NQJ B;  3X1T D;  3W97 D;  4H9Q B;  3AZH D;  5CPK B;  4QLC A;  4WU8 B;  5BO0 B;  4R8P B;  3A6N C;  5B1M B;  3V9R A;  1AOI A;  4XZQ A;  3AFA D;  1ZLA C;  3MNN B;  5B2J B;  5KDM A;  4ZBJ C;  2NQB C;  3LJA C;  5AV5 A;  5E5A B;  5CPK D;  4XUJ B;  3AZF C;  1KX3 B;  4WU8 D;  4KHA B;  4R8P D;  5FUG B;  3REJ B;  5B1M D;  1P3F A;  1P3I C;  4EO5 C;  5AVC B;  5CPJ B;  3AZG C;  3REK B;  3VH6 T;  5GXQ C;  3MNN D;  3C1C C;  5B2J D;  3AZM B;  3AZN C;  1S32 B;  3KUY A;  5B0Y C;  2IO5 B;  2CV5 B;  5E5A D;  3W99 C;  3X1T C;  1KX5 C;  4XUJ D;  4YM6 A;  1KX3 D;  3AZH C;  3WTP A;  4J8X B;  5B31 A;  1P3P B;  5AVC D;  5CPJ D;  3X1S B;  3REK D;  1P34 A;  3MVD B;  3AZM D;  4Z2M G;  1N1J B;  1S32 D;  3B0C T;  1F66 A;  4H9O B;  2CV5 D;  3NQU A;  3X1V B;  3AZI B;  2YFV B;  1HTA A;  4KGC B;  2HUE B;  3MGR C;  2BYM B;  4WU8 C;  3A6N A;  3B6F D;  2YFW A;  1M1A B;  4R8P C;  4J8X D;  3W98 A;  1P3P D;  3X1S D;  1M19 C;  5G49 A;  3REH A;  3MVD D;  3TU4 B;  3MNN C;  2NQB A;  3LJA A;  1EQZ B;  5B2J C;  3X1V D;  1P3O B;  3AZI D;  1P3A B;  3AZK B;  4AWL B;  3AZF A;  5AY8 B;  4KGC D;  2PYO B;  1M1A D;  5B1L B;  3REJ C;  4G92 B;  2BYK A;  3UTA C;  1BH8 B;  3AZJ B;  3X1U D;  5GXQ A;  3MGP B;  4YS3 B;  2RVQ D;  5GSU B;  5CPJ C;  3REK C;  3TU4 D;  3AZN A;  1M18 B;  1EQZ D;  5B0Y A;  2F8N H;  2IO5 C;  5DNN B;  4H9P A;  3MGS A;  1P3O D;  3X1T A;  1P3A D;  5AVB B;  3AZK D;  1KX5 A;  1R4V A;  5AY8 D;  3AZH A;  2PYO D;  3AV1 B;  4WNN B;  5B1L D;  3B6G B;  2FJ7 B;  5B24 B;  1P3P C;  3AZJ D;  4YS3 D;  3MGP D;  5GSU D;  3VH5 W;  1M18 D;  3VH5 A;  1U35 B;  1Q9C A;  5DNN D;  4HGA B;  3X1V C;  3AZI C;  5AVB D;  1P3G B;  4H9Q A;  2NZD B;  5CPK A;  3MGR A;  3AV1 D;  2HUE C;  3WKJ B;  4WU8 A;  5BO0 A;  4R8P A;  3AN2 D;  3B6G D;  3KXB B;  3LEL B;  2FJ7 D;  4ZUX C;  5B24 D;  4J8V B;  3UTB B;  3UT9 B;  1WWS A;  3REI C;  2F8N G;  4X23 B;  3MNN A;  2RVQ C;  3VH6 W;  4E44 A;  5BT1 D;  5GT0 C;  5B40 B;  5B2J A;  1U35 D;  1KX4 B;  1P3B B;  4KUD C;  3C1B B;  4WU9 B;  1P3G D;  2NZD D;  3LZ0 C;  2HIO B;  5AY8 C;  5F99 B;  3W98 C;  2PYO C;  3WKJ D;  3WAA B;  1H3O A;  4KHA A;  3MGQ B;  5FUG A;  4J8U B;  3REJ A;  3REL B;  3KXB D;  3LEL D;  4G92 C;  3UTA A;  3REH C;  4J8W B;  5AV8 B;  4J8V D;  3UTB D;  5AVC A;  3UT9 D;  5CPJ A;  3REK A;  3AZJ C;  4YS3 C;  4X23 D;  3MGP C;  5GSU C;  5B40 D;  5B0Z B;  3AZM A;  1KX4 D;  5JRG B;  1HQ3 B;  1P3B D;  4G91 B;  5CPI B;  5B33 B;  5DNN C;  3C1B D;  3KWQ C;  4WU9 D;  5JA4 B;  4Z5T B;  5AVB C;  3AV2 B;  2HIO D;  5F99 D;  3WAA D;  4J8U D;  3MGQ D;  4JJN B;  3REL D;  3B0D B;  5CP6 B;  4Z66 B;  1P3L B;  4J8W D;  2FJ7 C;  5AV8 D;  1P3P A;  5DNM B;  5C3I C;  1BFM A;  5B0Z D;  3MGS C;  3W97 C;  5BT1 C;  5JRG D;  1HQ3 D;  4QLC B;  1U35 C;  3O62 B;  5CPI D;  5B33 D;  3X1V A;  4CAY B;  3AZI A;  2YFV A;  1P3K B;  4HGA C;  3B6F B;  4Z5T D;  5AV9 D;  1AOI B;  3AV2 D;  2BYM A;  1P3M B;  4JJN D;  5CP6 D;  3AFA C;  4Z66 D;  1P3L D;  4ZUX A;  3KXB C;  1TZY B;  5DNM D;  3REI A;  4H9N B;  5AV5 B;  3UT9 C;  5B32 G;  5GT0 A;  3AZE B;  4QLC D;  5B40 C;  1KX4 C;  3O62 D;  4KUD A;  5AV6 B;  5CPK C;  1P3K D;  3LZ0 A;  4WU9 C;  1AOI D;  1BH9 A;  5B1M C;  5AY8 A;  2PYO A;  5F99 C;  2HIO C;  1P3M D;  4J8U C;  3X1U B;  3REL C;  4WZS B;  3KUY B;  1KU5 A;  1TZY D;  4J8W C;  1BH8 A;  5AV8 C;  3AZJ A;  4YS3 A;  5AV5 D;  3MGP A;  5GSU A;  3AZE D;  4YM6 B;  5B0Z C;  1B67 A;  5E5A C;  5JRG C;  5AV6 D;  1HQ3 C;  3WTP B;  4M6B A;  4G91 C;  5DNN A;  1JFI A;  3R45 B;  4XUJ C;  1KX3 C;  3KWQ A;  5B2I B;  5AVB A;  2F8N B;  1B6W A;  3AV2 C;  2L5A A;  4NE6 A;  4WNN A;  4JJN C;  5AVC C;  3B0D C;  5CP6 C;  3KUY D;  5BNV B;  4Z66 C;  2FJ7 A;  3AYW B;  3AZM C;  3NQU B;  1S32 C;  2CV5 C;  3W97 A;  1U35 A;  4YM6 D;  3WA9 B;  3WTP D;  3O62 C;  3A6N B;  5B2I D;  4H9R B;  1P3K C;  1ID3 B;  1P3G A;  2F8N D;  3B6F C;  5B31 D;  3AN2 B;  4J8X C; 
#chains in the Genus database with same CATH topology
 1ZLA B;  5G49 B;  1P3M C;  3AFA A;  4ZBJ B;  3X1S C;  2NQB B;  3KXB A;  1F66 D;  3AYW D;  3MVD C;  3UTB A;  1TZY C;  3UT9 A;  3NQJ A;  3AZF B;  5B40 A;  1KX4 A;  2F8N K;  3AZE C;  3WA9 D;  3A6N D;  4KGC C;  3C1B A;  1P3I B;  1ID3 D;  4WU9 A;  5B1M A;  1M1A C;  2HIO A;  5F99 A;  5BNX B;  3AZG B;  1ZLA D;  3WAA A;  5GT3 B;  3C1C B;  4J8U A;  3REL A;  3AZN B;  2NQB D;  5B0Y B;  3X1U C;  5B31 G;  4J8W A;  3VH6 A;  3TU4 C;  4NE3 A;  5AV8 A;  4H9P B;  1EQZ C;  2ARO B;  3W99 B;  1KX5 B;  3AZF D;  1P3O C;  5B0Z A;  5E5A A;  5JRG A;  3EPL A;  1HQ3 A;  1P3A C;  3AZK C;  4XUJ A;  4AWL C;  1KX3 A;  5B33 A;  1TAF B;  1P3I D;  5B2I C;  3AZL B;  5B32 B;  2W8S A;  5B1L C;  3AV2 A;  3AZG D;  5GT3 D;  3C1C D;  3W96 B;  4JJN A;  3AZN D;  5CP6 A;  5B0Y D;  3LZ1 B;  4Z66 A;  4NE5 A;  2CWE A;  2Y2L A;  4DRA A;  1M18 C;  3AYW C;  2JSS A;  1S32 A;  2ARO D;  2J8P A;  3W99 D;  3B0C W;  2CV5 A;  1KX5 D;  1A7W A;  2LY8 A;  3WTP E;  4CSR B;  3MGR B;  1T3U A;  3O62 A;  3WA9 C;  5AV9 B;  4LD9 B;  4CAY A;  3AV1 C;  1P3K A;  3AZL D;  3B6F A;  1ID3 C;  5B32 D;  4J8X A;  4UUZ B;  3AN2 C;  1M19 B;  3B6G C;  2DQN C;  3W96 D;  3VH5 T;  1P3M A;  3KSY A;  3X1S A;  5B24 C;  3LZ1 D;  3MVD A;  1N1J A;  4Z2M H;  1TZY A;  5BS7 C;  5CHL B;  4H9O A;  4H9N A;  3MGR D;  3AZE A;  3V9R B;  4NFT A;  5AV6 A;  4XZQ B;  1P3G C;  1H3O B;  4KGC A;  4LD9 D;  2NZD C;  2ZY4 A;  3WKJ C;  3UTA B;  1M1A A;  5KDM B;  3B0B A;  1M19 D;  3LEL C;  4H9S C;  5GT3 C;  4J8V C;  3X1U A;  3UTB C;  3TU4 A;  4X23 C;  1EQZ A;  2ARO C;  1P3B C;  1P3O A;  1P3F B;  3C1B C;  1P3A A;  3AZK A;  1F1E A;  4XZQ D;  3REJ D;  3R45 A;  3WAA C;  5B2I A;  3UTA D;  2F8N A;  3AZL C;  5B1L A;  3MGQ C;  4DRB A;  5B32 C;  3W96 C;  5BNV A;  3LZ1 C;  3A1K A;  1M18 A;  3AYW A;  2ZY2 A;  1P3F D;  1ULY A;  5CPI C;  5B33 C;  3WA9 A;  5B31 B;  4Z5T C;  5AV9 C;  3AV1 A;  4LD9 C;  3EPH A;  4H9R A;  1P34 B;  1ID3 A;  4ZUX B;  3AN2 A;  3B6G A;  3REI B;  1P3L C;  1F66 B;  1ZLA A;  5B24 A;  1WWI A;  5GT0 B;  5DNM C;  2G5H C;  4KUD B;  5BS7 A;  2VQR A;  4QLC C;  2YFW B;  3LZ0 B;  1BH9 B;  3W98 B;  2NZD A;  1AOI C;  4XZQ C;  3WKJ A;  1P34 D;  1P3I A;  3REH B;  4ZUX D;  3LJA B;  3REI D;  5BNX A;  4H9S A;  3LEL A;  3AZG A;  5GT3 A;  3C1C A;  4J8V A;  5GT0 D;  4DQY B;  4X23 A;  5AV5 C;  4KUD D;  1JFI B;  2ARO A;  3KWQ B;  1P3B A;  2ZM5 A;  3W99 A;  4WJ3 C;  5AV6 C;  3LZ0 D;  1P3F C;  3W98 D;  2DF4 C;  2BYK B;  4EO5 B;  1TAF A;  5GXQ B;  3REH D;  3MGQ A;  3AZL A;  3EPK A;  3LJA D;  5C3I B;  5B32 A;  3KUY C;  3W96 A;  3MGS B;  3X1T B;  3W97 B;  3LZ1 A;  4WV4 B;  3AZH B;  4YM6 C;  3KWQ D;  5CPI A;  3WTP C;  4CSR A;  5JA4 A;  4Z5T A;  4E45 A;  3KFU G;  5AV9 A;  4LD9 A;  2Y2N A;  5B31 C;  3AFA B;  5GXQ D;  1P34 C;  2RIQ A;  4UUZ A;  1P3L A;  1M19 A;  1F66 C;  5DNM A;  3MGS D;  3NQJ B;  3X1T D;  3W97 D;  3EG5 B;  4H9Q B;  3AZH D;  5CPK B;  4QLC A;  4WU8 B;  5BO0 B;  4R8P B;  3A6N C;  5B1M B;  3V9R A;  1AOI A;  4XZQ A;  3AFA D;  3F6T A;  1ZLA C;  3MNN B;  5B2J B;  5KDM A;  4ZBJ C;  2NQB C;  3LJA C;  5AV5 A;  5E5A B;  5CPK D;  4XUJ B;  3AZF C;  1KX3 B;  4WU8 D;  2JE5 A;  4KHA B;  4R8P D;  5FUG B;  3REJ B;  5B1M D;  1P3F A;  1P3I C;  4EO5 C;  2BG1 A;  5AVC B;  5CPJ B;  3AZG C;  3REK B;  3VH6 T;  5GXQ C;  3MNN D;  3C1C C;  5B2J D;  3AZM B;  3AZN C;  1S32 B;  3KUY A;  5B0Y C;  2JCH A;  2IO5 B;  2CV5 B;  5E5A D;  3W99 C;  3X1T C;  1KX5 C;  2Y2O A;  4XUJ D;  4YM6 A;  1KX3 D;  1PZR A;  3AZH C;  3WTP A;  4J8X B;  3EPJ A;  5B31 A;  1P3P B;  5AVC D;  5CPJ D;  3X1S B;  3REK D;  1P34 A;  3MVD B;  3AZM D;  4Z2M G;  1N1J B;  3IP4 C;  1S32 D;  3B0C T;  3P5J B;  1F66 A;  4H9O B;  4UPK A;  2CV5 D;  3NQU A;  3X1V B;  3AZI B;  2YFV B;  1HTA A;  4KGC B;  2HUE B;  3MGR C;  2BYM B;  4WU8 C;  3A6N A;  3B6F D;  2YFW A;  1M1A B;  3AL0 C;  4R8P C;  4J8X D;  3W98 A;  1P3P D;  3X1S D;  2ZY3 A;  1M19 C;  5G49 A;  3REH A;  3MVD D;  3TU4 B;  3MNN C;  2NQB A;  2XD1 A;  3LJA A;  1EQZ B;  5B2J C;  2F2A C;  3X1V D;  1P3O B;  3AZI D;  1P3A B;  3AZK B;  4AWL B;  3AZF A;  5AY8 B;  4KGC D;  2PYO B;  2XD5 A;  1M1A D;  5B1L B;  3REJ C;  3A1I A;  4G92 B;  2BYK A;  3UTA C;  1BH8 B;  3AZJ B;  3X1U D;  5GXQ A;  3MGP B;  4YS3 B;  2RVQ D;  5GSU B;  5CPJ C;  3REK C;  3TU4 D;  3AZN A;  1M18 B;  1EQZ D;  5B0Y A;  2F8N H;  2IO5 C;  5DNN B;  4H9P A;  3MGS A;  1P3O D;  3X1T A;  1P3A D;  5AVB B;  3AZK D;  1KX5 A;  1R4V A;  5AY8 D;  3AZH A;  2Y2J A;  3AV1 B;  2PYO D;  4WNN B;  5B1L D;  3B6G B;  2FJ7 B;  5B24 B;  1P3P C;  3AZJ D;  4YS3 D;  3MGP D;  5GSU D;  3VH5 W;  1M18 D;  3VH5 A;  1U35 B;  2Y2P A;  1Q9C A;  5DNN D;  4HGA B;  3X1V C;  3AZI C;  5AVB D;  1P3G B;  4H9Q A;  2NZD B;  1Z2C B;  5CPK A;  3MGR A;  3AV1 D;  2HUE C;  3WKJ B;  4WU8 A;  2Y2Q A;  5BO0 A;  4R8P A;  3AN2 D;  3B6G D;  2FFF B;  3KXB B;  3LEL B;  2FJ7 D;  4ZUX C;  5B24 D;  4J8V B;  3UTB B;  3UT9 B;  1WWS A;  3REI C;  2F8N G;  4X23 B;  3MNN A;  2RVQ C;  3VH6 W;  4E44 A;  5BT1 D;  5GT0 C;  5B40 B;  5B2J A;  1U35 D;  1KX4 B;  1P3B B;  4KUD C;  3C1B B;  4WU9 B;  1P3G D;  2NZD D;  2G5I C;  3LZ0 C;  2HIO B;  5AY8 C;  5F99 B;  3W98 C;  2PYO C;  3WKJ D;  3WAA B;  1H3O A;  4KHA A;  3MGQ B;  5FUG A;  4J8U B;  3REJ A;  3REL B;  3KXB D;  3LEL D;  4G92 C;  3UTA A;  3REH C;  4J8W B;  5AV8 B;  4J8V D;  3UTB D;  5AVC A;  3UT9 D;  5CPJ A;  3REK A;  3AZJ C;  4YS3 C;  4X23 D;  3MGP C;  3H0M C;  3FDD A;  5GSU C;  5B40 D;  5B0Z B;  3AZM A;  1KX4 D;  5JRG B;  1HQ3 B;  1P3B D;  4G91 B;  5CPI B;  5B33 B;  5DNN C;  3C1B D;  3KWQ C;  1W2E A;  4WU9 D;  5JA4 B;  4Z5T B;  5AVB C;  3AV2 B;  2HIO D;  5F99 D;  3WAA D;  4J8U D;  3MGQ D;  4JJN B;  2Y2K A;  3REL D;  3B0D B;  5CP6 B;  4Z66 B;  1P3L B;  4J8W D;  2FJ7 C;  5AV8 D;  1P3P A;  3H0L C;  5C3I C;  5DNM B;  1BFM A;  5B0Z D;  3MGS C;  3W97 C;  5BT1 C;  5JRG D;  1HQ3 D;  4QLC B;  1U35 C;  3O62 B;  5CPI D;  5B33 D;  3X1V A;  4CAY B;  3AZI A;  2YFV A;  1P3K B;  4HGA C;  3B6F B;  4Z5T D;  5AV9 D;  1AOI B;  3AV2 D;  2Y2G A;  2BYM A;  1P3M B;  4JJN D;  5CP6 D;  3AFA C;  4Z66 D;  1P3L D;  4ZUX A;  3KXB C;  1TZY B;  5DNM D;  3REI A;  4H9N B;  5AV5 B;  3UT9 C;  5B32 G;  5GT0 A;  3AZE B;  4QLC D;  5B40 C;  1KX4 C;  3O62 D;  4KUD A;  5AV6 B;  5CPK C;  1P3K D;  3H0R C;  3LZ0 A;  4WU9 C;  1AOI D;  1BH9 A;  2ZY5 A;  5B1M C;  5AY8 A;  2PYO A;  2HIO C;  5F99 C;  1P3M D;  4J8U C;  3X1U B;  3REL C;  4WZS B;  3KUY B;  1KU5 A;  1TZY D;  4J8W C;  1BH8 A;  5AV8 C;  3AZJ A;  4YS3 A;  5AV5 D;  3MGP A;  2Y2H A;  5GSU A;  3AZE D;  4YM6 B;  5B0Z C;  1B67 A;  5E5A C;  5JRG C;  5AV6 D;  1HQ3 C;  3WTP B;  4M6B A;  4G91 C;  5DNN A;  1JFI A;  3R45 B;  4XUJ C;  2Y2I A;  3KWQ A;  5B2I B;  1KX3 C;  5AVB A;  2F8N B;  1B6W A;  3AV2 C;  2L5A A;  4NE6 A;  4WNN A;  2UWX A;  4JJN C;  5AVC C;  3B0D C;  5CP6 C;  3KUY D;  5BNV B;  4Z66 C;  2FJ7 A;  3AYW B;  3AZM C;  3NQU B;  1S32 C;  2CV5 C;  3W97 A;  1U35 A;  4YM6 D;  3WA9 B;  3WTP D;  3O62 C;  3A6N B;  5B2I D;  2Y2M A;  4H9R B;  1P3K C;  1ID3 B;  1P3G A;  2F8N D;  3B6F C;  5B31 D;  3AN2 B;  4J8X C; 
#chains in the Genus database with same CATH homology
 1ZLA B;  5G49 B;  1P3M C;  3AFA A;  4ZBJ B;  3X1S C;  2NQB B;  3KXB A;  1F66 D;  3AYW D;  3MVD C;  3UTB A;  1TZY C;  3UT9 A;  3NQJ A;  3AZF B;  5B40 A;  1KX4 A;  2F8N K;  3AZE C;  3WA9 D;  3A6N D;  4KGC C;  3C1B A;  1P3I B;  1ID3 D;  4WU9 A;  5B1M A;  1M1A C;  2HIO A;  5F99 A;  5BNX B;  3AZG B;  1ZLA D;  3WAA A;  5GT3 B;  3C1C B;  4J8U A;  3REL A;  3AZN B;  2NQB D;  5B0Y B;  3X1U C;  5B31 G;  4J8W A;  3VH6 A;  3TU4 C;  4NE3 A;  5AV8 A;  4H9P B;  1EQZ C;  2ARO B;  3W99 B;  1KX5 B;  3AZF D;  1P3O C;  5B0Z A;  5E5A A;  5JRG A;  3EPL A;  1HQ3 A;  1P3A C;  3AZK C;  4XUJ A;  4AWL C;  1KX3 A;  5B33 A;  1TAF B;  1P3I D;  5B2I C;  3AZL B;  5B32 B;  2W8S A;  5B1L C;  3AV2 A;  3AZG D;  5GT3 D;  3C1C D;  3W96 B;  4JJN A;  3AZN D;  5CP6 A;  5B0Y D;  3LZ1 B;  4Z66 A;  4NE5 A;  2CWE A;  2Y2L A;  4DRA A;  1M18 C;  3AYW C;  2JSS A;  1S32 A;  2ARO D;  2J8P A;  3W99 D;  3B0C W;  2CV5 A;  1KX5 D;  1A7W A;  2LY8 A;  3WTP E;  4CSR B;  3MGR B;  1T3U A;  3O62 A;  3WA9 C;  5AV9 B;  4LD9 B;  4CAY A;  3AV1 C;  1P3K A;  3AZL D;  3B6F A;  1ID3 C;  5B32 D;  4J8X A;  4UUZ B;  3AN2 C;  1M19 B;  3B6G C;  2DQN C;  3W96 D;  3VH5 T;  1P3M A;  3KSY A;  3X1S A;  5B24 C;  3LZ1 D;  3MVD A;  1N1J A;  4Z2M H;  1TZY A;  5BS7 C;  5CHL B;  4H9O A;  4H9N A;  3MGR D;  3AZE A;  3V9R B;  4NFT A;  5AV6 A;  4XZQ B;  1P3G C;  1H3O B;  4KGC A;  4LD9 D;  2NZD C;  2ZY4 A;  3WKJ C;  3UTA B;  1M1A A;  5KDM B;  3B0B A;  1M19 D;  3LEL C;  4H9S C;  5GT3 C;  4J8V C;  3X1U A;  3UTB C;  3TU4 A;  4X23 C;  1EQZ A;  2ARO C;  1P3B C;  1P3O A;  1P3F B;  3C1B C;  1P3A A;  3AZK A;  1F1E A;  4XZQ D;  3REJ D;  3R45 A;  3WAA C;  5B2I A;  3UTA D;  2F8N A;  3AZL C;  5B1L A;  3MGQ C;  4DRB A;  5B32 C;  3W96 C;  5BNV A;  3LZ1 C;  3A1K A;  1M18 A;  3AYW A;  2ZY2 A;  1P3F D;  1ULY A;  5CPI C;  5B33 C;  3WA9 A;  5B31 B;  4Z5T C;  5AV9 C;  3AV1 A;  4LD9 C;  3EPH A;  4H9R A;  1P34 B;  1ID3 A;  4ZUX B;  3AN2 A;  3B6G A;  3REI B;  1P3L C;  1F66 B;  1ZLA A;  5B24 A;  1WWI A;  5GT0 B;  5DNM C;  2G5H C;  4KUD B;  5BS7 A;  2VQR A;  4QLC C;  2YFW B;  3LZ0 B;  1BH9 B;  3W98 B;  2NZD A;  1AOI C;  4XZQ C;  3WKJ A;  1P34 D;  1P3I A;  3REH B;  4ZUX D;  3LJA B;  3REI D;  5BNX A;  4H9S A;  3LEL A;  3AZG A;  5GT3 A;  3C1C A;  4J8V A;  5GT0 D;  4DQY B;  4X23 A;  5AV5 C;  4KUD D;  1JFI B;  2ARO A;  3KWQ B;  1P3B A;  2ZM5 A;  3W99 A;  4WJ3 C;  5AV6 C;  3LZ0 D;  1P3F C;  3W98 D;  2DF4 C;  2BYK B;  4EO5 B;  1TAF A;  5GXQ B;  3REH D;  3MGQ A;  3AZL A;  3EPK A;  3LJA D;  5C3I B;  5B32 A;  3KUY C;  3W96 A;  3MGS B;  3X1T B;  3W97 B;  3LZ1 A;  4WV4 B;  3AZH B;  4YM6 C;  3KWQ D;  5CPI A;  3WTP C;  4CSR A;  5JA4 A;  4Z5T A;  4E45 A;  3KFU G;  5AV9 A;  4LD9 A;  2Y2N A;  5B31 C;  3AFA B;  5GXQ D;  1P34 C;  2RIQ A;  4UUZ A;  1P3L A;  1M19 A;  1F66 C;  5DNM A;  3MGS D;  3NQJ B;  3X1T D;  3W97 D;  3EG5 B;  4H9Q B;  3AZH D;  5CPK B;  4QLC A;  4WU8 B;  5BO0 B;  4R8P B;  3A6N C;  5B1M B;  3V9R A;  1AOI A;  4XZQ A;  3AFA D;  3F6T A;  1ZLA C;  3MNN B;  5B2J B;  5KDM A;  4ZBJ C;  2NQB C;  3LJA C;  5AV5 A;  5E5A B;  5CPK D;  4XUJ B;  3AZF C;  1KX3 B;  4WU8 D;  2JE5 A;  4KHA B;  4R8P D;  5FUG B;  3REJ B;  5B1M D;  1P3F A;  1P3I C;  4EO5 C;  2BG1 A;  5AVC B;  5CPJ B;  3AZG C;  3REK B;  3VH6 T;  5GXQ C;  3MNN D;  3C1C C;  5B2J D;  3AZM B;  3AZN C;  1S32 B;  3KUY A;  5B0Y C;  2JCH A;  2IO5 B;  2CV5 B;  5E5A D;  3W99 C;  3X1T C;  1KX5 C;  2Y2O A;  4XUJ D;  4YM6 A;  1KX3 D;  1PZR A;  3AZH C;  3WTP A;  4J8X B;  3EPJ A;  5B31 A;  1P3P B;  5AVC D;  5CPJ D;  3X1S B;  3REK D;  1P34 A;  3MVD B;  3AZM D;  4Z2M G;  1N1J B;  3IP4 C;  1S32 D;  3B0C T;  3P5J B;  1F66 A;  4H9O B;  4UPK A;  2CV5 D;  3NQU A;  3X1V B;  3AZI B;  2YFV B;  1HTA A;  4KGC B;  2HUE B;  3MGR C;  2BYM B;  4WU8 C;  3A6N A;  3B6F D;  2YFW A;  1M1A B;  3AL0 C;  4R8P C;  4J8X D;  3W98 A;  1P3P D;  3X1S D;  2ZY3 A;  1M19 C;  5G49 A;  3REH A;  3MVD D;  3TU4 B;  3MNN C;  2NQB A;  2XD1 A;  3LJA A;  1EQZ B;  5B2J C;  2F2A C;  3X1V D;  1P3O B;  3AZI D;  1P3A B;  3AZK B;  4AWL B;  3AZF A;  5AY8 B;  4KGC D;  2PYO B;  2XD5 A;  1M1A D;  5B1L B;  3REJ C;  3A1I A;  4G92 B;  2BYK A;  3UTA C;  1BH8 B;  3AZJ B;  3X1U D;  5GXQ A;  3MGP B;  4YS3 B;  2RVQ D;  5GSU B;  5CPJ C;  3REK C;  3TU4 D;  3AZN A;  1M18 B;  1EQZ D;  5B0Y A;  2F8N H;  2IO5 C;  5DNN B;  4H9P A;  3MGS A;  1P3O D;  3X1T A;  1P3A D;  5AVB B;  3AZK D;  1KX5 A;  1R4V A;  5AY8 D;  3AZH A;  2Y2J A;  3AV1 B;  2PYO D;  4WNN B;  5B1L D;  3B6G B;  2FJ7 B;  5B24 B;  1P3P C;  3AZJ D;  4YS3 D;  3MGP D;  5GSU D;  3VH5 W;  1M18 D;  3VH5 A;  1U35 B;  2Y2P A;  1Q9C A;  5DNN D;  4HGA B;  3X1V C;  3AZI C;  5AVB D;  1P3G B;  4H9Q A;  2NZD B;  1Z2C B;  5CPK A;  3MGR A;  3AV1 D;  2HUE C;  3WKJ B;  4WU8 A;  2Y2Q A;  5BO0 A;  4R8P A;  3AN2 D;  3B6G D;  2FFF B;  3KXB B;  3LEL B;  2FJ7 D;  4ZUX C;  5B24 D;  4J8V B;  3UTB B;  3UT9 B;  1WWS A;  3REI C;  2F8N G;  4X23 B;  3MNN A;  2RVQ C;  3VH6 W;  4E44 A;  5BT1 D;  5GT0 C;  5B40 B;  5B2J A;  1U35 D;  1KX4 B;  1P3B B;  4KUD C;  3C1B B;  4WU9 B;  1P3G D;  2NZD D;  2G5I C;  3LZ0 C;  2HIO B;  5AY8 C;  5F99 B;  3W98 C;  2PYO C;  3WKJ D;  3WAA B;  1H3O A;  4KHA A;  3MGQ B;  5FUG A;  4J8U B;  3REJ A;  3REL B;  3KXB D;  3LEL D;  4G92 C;  3UTA A;  3REH C;  4J8W B;  5AV8 B;  4J8V D;  3UTB D;  5AVC A;  3UT9 D;  5CPJ A;  3REK A;  3AZJ C;  4YS3 C;  4X23 D;  3MGP C;  3H0M C;  3FDD A;  5GSU C;  5B40 D;  5B0Z B;  3AZM A;  1KX4 D;  5JRG B;  1HQ3 B;  1P3B D;  4G91 B;  5CPI B;  5B33 B;  5DNN C;  3C1B D;  3KWQ C;  1W2E A;  4WU9 D;  5JA4 B;  4Z5T B;  5AVB C;  3AV2 B;  2HIO D;  5F99 D;  3WAA D;  4J8U D;  3MGQ D;  4JJN B;  2Y2K A;  3REL D;  3B0D B;  5CP6 B;  4Z66 B;  1P3L B;  4J8W D;  2FJ7 C;  5AV8 D;  1P3P A;  3H0L C;  5C3I C;  5DNM B;  1BFM A;  5B0Z D;  3MGS C;  3W97 C;  5BT1 C;  5JRG D;  1HQ3 D;  4QLC B;  1U35 C;  3O62 B;  5CPI D;  5B33 D;  3X1V A;  4CAY B;  3AZI A;  2YFV A;  1P3K B;  4HGA C;  3B6F B;  4Z5T D;  5AV9 D;  1AOI B;  3AV2 D;  2Y2G A;  2BYM A;  1P3M B;  4JJN D;  5CP6 D;  3AFA C;  4Z66 D;  1P3L D;  4ZUX A;  3KXB C;  1TZY B;  5DNM D;  3REI A;  4H9N B;  5AV5 B;  3UT9 C;  5B32 G;  5GT0 A;  3AZE B;  4QLC D;  5B40 C;  1KX4 C;  3O62 D;  4KUD A;  5AV6 B;  5CPK C;  1P3K D;  3H0R C;  3LZ0 A;  4WU9 C;  1AOI D;  1BH9 A;  2ZY5 A;  5B1M C;  5AY8 A;  2PYO A;  2HIO C;  5F99 C;  1P3M D;  4J8U C;  3X1U B;  3REL C;  4WZS B;  3KUY B;  1KU5 A;  1TZY D;  4J8W C;  1BH8 A;  5AV8 C;  3AZJ A;  4YS3 A;  5AV5 D;  3MGP A;  2Y2H A;  5GSU A;  3AZE D;  4YM6 B;  5B0Z C;  1B67 A;  5E5A C;  5JRG C;  5AV6 D;  1HQ3 C;  3WTP B;  4M6B A;  4G91 C;  5DNN A;  1JFI A;  3R45 B;  4XUJ C;  2Y2I A;  3KWQ A;  5B2I B;  1KX3 C;  5AVB A;  2F8N B;  1B6W A;  3AV2 C;  2L5A A;  4NE6 A;  4WNN A;  2UWX A;  4JJN C;  5AVC C;  3B0D C;  5CP6 C;  3KUY D;  5BNV B;  4Z66 C;  2FJ7 A;  3AYW B;  3AZM C;  3NQU B;  1S32 C;  2CV5 C;  3W97 A;  1U35 A;  4YM6 D;  3WA9 B;  3WTP D;  3O62 C;  3A6N B;  5B2I D;  2Y2M A;  4H9R B;  1P3K C;  1ID3 B;  1P3G A;  2F8N D;  3B6F C;  5B31 D;  3AN2 B;  4J8X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...