5B2JB

Human nucleosome containing cpg methylated dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jB00
4WU8A 5B0YD 3AZHA 1M19C 1P3AB 4WU9C 3WTPE 3RELB 5B0YA 5B31B 5G49A 3UTAD 3LZ0C 5B2JC 5C3IC 5BO0B 3AZLB 3LELB 3UTAA 5B1LB 3AV2D 1BH8A 4UUZB 1TAFA 4G91B 3REKB 1P3MD 3AV2A 3WKJC 1S32C 3AZEC 3AN2C 1P3KB 3A6NC 4Z66D 4YS3C 3TU4D 1P3MA 1M19D 3MGPB 4WU9D 1N1JA 5BT1D 4Z66A 3TU4A 1M19A 4WU9A 2F8NB 5JA4A 3LZ0D 3LJAC 3MGQB 2CV5D 3R45B 4H9OA 5C3IB 5B2JB 3AV1B 5CPJC 3LZ0A 5B24D 4LD9A 3MGSC 4WZSB 5AV6D 1M1AC 2NQBB 1P3IB 2CV5A 2HIOB 3VH5W 3KWQD 5JRGD 3WKJD 5B24A 4XZQC 1JFIA 5AV6A 3AN2D 3MVDB 1U35B 5B0ZB 1S32D 2FJ7C 5GT0B 3KWQA 3AZEB 5JRGA 4WNNB 3WKJA 5AV5C 3A6NB 1S32A 3AN2A 4YS3B 1F1EA 3MGRC 3KUYB 4X23C 4QLCB 1WWIA 3WTPB 1M18C 5GSUC 3B0BA 1P3LD 4R8PC 5GXQD 1P3PD 3AZNB 3AZGD 3B6FC 1BH9B 1HQ3C 3LJAB 1P3LA 5CPJD 5GXQA 1P3PA 3AZGA 5BS7A 2YFVB 3MGSD 3AYWC 5CPJA 1TZYC 3UTBC 1F66B 1P3FC 1P3BD 3AZJB 4ZUXD 4XZQD 3MGSA 5B32G 5DNMB 2FJ7B 1P3BA 3AFAD 4ZUXA 3X1VD 4H9PA 5AV9C 3AFAA 3MGRB 1M18D 5GT3B 4X23B 3X1VA 4R8PD 2AROC 5E5AC 1ZLAD 4Z2MH 5GSUB 1KX3B 5AY8C 5B32C 1M18A 1KX4C 5CPKA 4R8PA 3B6FB 5AVCC 3LZ1D 1ZLAA 1HQ3B 4NE3A 3AZMC 4G92C 3X1UC 5DNND 3AYWD 3LZ1A 3REHB 4KHAA 3UTBD 1EQZC 1TZYB 5BNXB 1ID3B 5BNVB 1P3FB 3AYWA 5DNNA 4DRBA 3UTBA 5KDMB 5B40D 3C1CB 3X1SC 5AV9B 5B40A 3O62D 2AROD 5E5AD 1P3GC 3AZLC 3VH6W 5AY8B 5B1LC 3O62A 4H9NB 2AROA 5E5AA 5B32B 1KX4B 3C1BC 5AVCB 3AZMD 4YM6D 1Q9CA 4G92B 3X1UB 3AZMA 4YM6A 1EQZB 1P3OC 4J8VB 3MGPC 1P3AD 3RELD 5CPIB 3REIB 4XUJB 5B31D 1P3AA 3RELA 5B2ID 5AV8B 3X1SB 5B31A 3MGQC 3AV1C 5B2IA 3AZLD 3LELD 5B1LD 1P3GB 2NQBC 4EO5B 5BO0A 1P3IC 2HIOC 3C1BB 3AZLA 3LELA 3REKD 5B1LA 1P3KD 3MVDC 1U35C 4UUZA 2YFWB 5B0ZC 5GT0C 3UT9B 3REKA 4H9SA 3MGPD 1P3OB 1P3KA 3KUYC 4QLCC 3MGPA 3WTPC 3AZKB 2F8ND 2BYMB 3AZNC 1BH8B 3MGQD 2F8NA 5B2JD 3AV1D 4CAYB 4KUDC 2NQBD 3MGQA 1P3ID 3R45A 5B2JA 2HIOD 5F99C 3AV1A 1F66C 2NZDB 2IO5C 3AZJC 2NQBA 3MVDD 1U35D 5B0ZD 5DNMC 1P3IA 3W97C 2HIOA 5GT0D 3AZED 3A6ND 4J8WC 4YS3D 3MVDA 1U35A 5B0ZA 5GT0A 5CP6B 3AZEA 3W98B 4WNNA 3KUYD 2PYOC 3A6NA 4CSRB 4QLCD 3WTPD 4YS3A 5GT3C 4H9OB 3AZND 1KX3C 4NE6A 3WTPA 3LJAD 3AZNA 1A7WA 1BH9A 4KUDB 3LJAA 3WAAB 1F66D 3REHC 1M1AD 3NQUB 5F99B 3AZJD 1BFMA 2RVQC 2YFVA 1ID3C 2IO5B 5DNMD 3AZFC 1M1AA 3B0CT 2FJ7D 3W97B 3AZJA 3MNNC 3W99C 5AVBC 5AV5D 4J8WB 1P34C 4XZQA 5B1MB 3C1CC 2FJ7A 1HTAA 3MGRD 5GT3D 2PYOB 5AV5A 4X23D 5FUGB 5GSUD 4J8UC 1KX3D 3MGRA 3KXBB 5GT3A 5B33B 4X23A 3WA9C 1KX5B 3B6FD 4KGCC 3REJB 5GSUA 1HQ3D 3B0DC 1KX3A 4AWLB 1AOIB 3V9RB 1H3OB 3B6FA 3REHD 1HQ3A 1TZYD 4ZUXB 1ID3D 4J8VC 1P3FD 3REHA 4J8XB 3AZFB 1TZYA 5BNXA 3AZIB 1ID3A 5BNVA 5CPIC 3REIC 4XUJC 1P3FA 2F8NH 4Z5TC 3MNNB 4HGAC 5AVBB 3C1CD 1P34B 4DRAA 5KDMA 3W99B 3X1TC 5AV8C 5AV9D 5CPKB 4H9RB 3W96C 4M6BA 3C1CA 5AV9A 4J8UB 5AY8D 5B32D 1KX4D 3WA9B 4EO5C 4KGCB 5AVCD 3NQJA 3B0DB 5AY8A 3AZHC 4H9NA 5B32A 1KX4A 3X1UD 5AVCA 1EQZD 3UT9C 4J8VD 4Z2MG 5B0YC 2LY8A 3X1UA 1EQZA 5CPID 3REID 4XUJD 4H9QB 3AZKC 4Z5TB 4HGAB 5AV8D 3X1SD 5CPIA 3REIA 4XUJA 3X1TB 2BYKB 3W96B 5AV8A 3X1SA 3AV2C 1P3GD 4JJNB 2NZDC 3C1BD 4LD9B 1P3GA 3B6GB 4WU8B 3AZHB 3UT9D 3C1BA 3TU4C 3VH5T 1P3OD 5B0YB 2YFWA 5BT1C 5CP6C 3UT9A 3W98C 4ZBJB 5G49B 1P3OA 3AZKD 5B2IB 1ULYA 3UTAB 3AZKA 2CV5C 2BYMA 1TAFB 5B24C 5AV6C 3AV2B 1R4VA 3WAAC 2NZDD 3KWQC 4CAYA 5JRGC 1P3MB 2NZDA 1N1JB 4Z66B 3TU4B 1M19B 1B67A 4WU9B 5B1MC 5CP6D 3W98D 5JA4B 2JSSA 1P3LC 5GXQC 5CP6A 1P3PC 3W98A 4CSRA 3AZGC 5BS7C 3VH5A 3KXBC 3KUYA 3LZ0B 5B33C 4QLCA 1KX5C 3REJC 2CV5B 1AOIC 4AWLC 4KUDD 5B24B 3WAAD 1JFIB 5AV6B 4WV4B 5F99D 1P3BC 4ZUXC 3KWQB 5JRGB 3WKJB 4KUDA 3WAAA 1S32B 3AN2B 3NQUA 4J8XC 3W97D 5F99A 3AFAC 1F66A 3AZIC 3X1VC 4J8WD 5B1MD 5DNMA 3W97A 2PYOD 5CPKC 4J8WA 1ZLAC 5B1MA 1P3LB 5GXQB 1P3PB 4NFTA 3KXBD 2CWEA 5B33D 2PYOA 3AZGB 5FUGA 3LZ1C 1KX5D 3REJD 1AOID 5CPJB 3KXBA 5B33A 2F8NK 5DNNC 1KX5A 3VH6T 3MGSB 1M1AB 3REJA 1AOIA 3V9RA 1H3OA 1P3BB 2RVQD 4XZQB 4J8XD 3AZFD 4H9PB 3AZID 5B40C 5AV5B 1WWSA 3AFAB 2L5AA 3MNND 3W99D 5AVBD 4J8XA 3X1VB 1P34D 3AZFA 3AZIA 5CPKD 3O62C 1M18B 3MNNA 1P34A 5AVBA 4R8PB 3W99A 1ZLAB 2HUEC 4J8UD 4H9RA 3WA9D 5B31G 4KGCD 3LZ1B 4JJNC 4YM6C 4KHAB 4J8UA 4LD9C 3B6GC 3WA9A 3B0CW 5DNNB 3AYWB 4WU8C 4KGCA 3UTBB 1P3AC 4E44A 3RELC 1KU5A 4ZBJC 5B31C 5B40B 4J8VA 3VH6A 4Z5TD 5B2IC 4H9QA 3X1TD 3UTAC 3O62B 3W96D 2AROB 3KSYA 3NQJB 4Z5TA 5E5AB 5CHLB 3LELC 3X1TA 2HUEB 2BYKA 3W96A 4JJND 2F8NG 4G91C 3REKC 4H9SC 4YM6B 3AZMB 4LD9D 4E45A 3B6GD 1P3KC 1P3MC 4WU8D 3AZHD 4NE5A 4JJNA 1B6WA 4Z66C 3B6GA
chains in the Genus database with same CATH superfamily
4WU8A 5B0YD 3AZHA 1M19C 1P3AB 4WU9C 3WTPE 3RELB 5B0YA 5B31B 2BG1A 5G49A 3UTAD 3LZ0C 5B2JC 5C3IC 5BO0B 3AZLB 3AL0C 3LELB 3UTAA 5B1LB 3AV2D 1BH8A 4UUZB 1TAFA 4G91B 3REKB 1P3MD 3AV2A 3WKJC 1S32C 3EPJA 3AZEC 3AN2C 1P3KB 3A6NC 4Z66D 4YS3C 3TU4D 1P3MA 1M19D 3MGPB 4WU9D 1N1JA 5BT1D 4Z66A 3TU4A 1M19A 4WU9A 2F8NB 5JA4A 3LZ0D 3A1IA 3LJAC 3MGQB 2CV5D 3R45B 4H9OA 5C3IB 5B2JB 3AV1B 5CPJC 3LZ0A 5B24D 4LD9A 3MGSC 4WZSB 2Y2LA 5AV6D 1M1AC 1P3IB 2CV5A 2NQBB 2HIOB 3VH5W 3KWQD 5JRGD 3WKJD 5B24A 4XZQC 1JFIA 5AV6A 3AN2D 3MVDB 1U35B 5B0ZB 1S32D 2FJ7C 4WJ3C 5GT0B 3KWQA 3AZEB 5JRGA 4WNNB 2Y2HA 3WKJA 5AV5C 3A6NB 1S32A 3AN2A 4YS3B 1F1EA 3MGRC 3KUYB 4X23C 4QLCB 1WWIA 3WTPB 1M18C 5GSUC 3B0BA 1P3LD 4R8PC 3EPHA 5GXQD 1P3PD 3AZNB 3AZGD 3B6FC 2RIQA 1BH9B 1HQ3C 3LJAB 1P3LA 5CPJD 5GXQA 1P3PA 3AZGA 2VQRA 5BS7A 2YFVB 3MGSD 3AYWC 5CPJA 1TZYC 3UTBC 1F66B 1P3FC 1P3BD 3AZJB 4ZUXD 4XZQD 3MGSA 2Y2OA 5B32G 5DNMB 2FJ7B 1P3BA 3AFAD 4ZUXA 4UPKA 3X1VD 4H9PA 5AV9C 3AFAA 3MGRB 1M18D 5GT3B 4X23B 3X1VA 4R8PD 2AROC 5E5AC 1ZLAD 4Z2MH 5GSUB 1KX3B 5AY8C 5B32C 1M18A 1KX4C 5CPKA 4R8PA 3B6FB 5AVCC 3LZ1D 1ZLAA 2Y2IA 1HQ3B 4NE3A 3AZMC 4G92C 3X1UC 5DNND 3AYWD 3LZ1A 3REHB 4KHAA 3UTBD 1EQZC 1TZYB 5BNXB 1ID3B 5BNVB 1P3FB 3AYWA 5DNNA 4DRBA 3UTBA 5KDMB 5B40D 3C1CB 3X1SC 4DQYB 5AV9B 5B40A 3O62D 2AROD 5E5AD 3EPKA 1P3GC 3AZLC 2DQNC 3VH6W 5AY8B 5B1LC 3O62A 4H9NB 2AROA 5E5AA 5B32B 1KX4B 3C1BC 5AVCB 3AZMD 4YM6D 1Q9CA 4G92B 3X1UB 3AZMA 4YM6A 1EQZB 1P3OC 4J8VB 3MGPC 2FFFB 1P3AD 3RELD 2Y2NA 5CPIB 3REIB 4XUJB 5B31D 1P3AA 3RELA 5B2ID 5AV8B 3X1SB 5B31A 3MGQC 3AV1C 5B2IA 3AZLD 3LELD 5B1LD 1P3GB 2NQBC 4EO5B 5BO0A 1P3IC 2HIOC 3C1BB 3AZLA 3LELA 3REKD 2Y2PA 5B1LA 1P3KD 3MVDC 1U35C 4UUZA 2YFWB 5B0ZC 5GT0C 3UT9B 3REKA 4H9SA 3MGPD 1P3OB 1P3KA 3H0RC 3KUYC 2W8SA 4QLCC 3MGPA 3WTPC 3AZKB 2F8ND 2Y2GA 2BYMB 3AZNC 1BH8B 3MGQD 2Y2MA 2F8NA 5B2JD 3AV1D 4CAYB 4KUDC 2NQBD 3MGQA 1P3ID 3R45A 5B2JA 2HIOD 5F99C 3AV1A 1F66C 2NZDB 2IO5C 3AZJC 2NQBA 3MVDD 1U35D 5B0ZD 5DNMC 1P3IA 3W97C 2HIOA 5GT0D 3A1KA 3AZED 3A6ND 2XD1A 4J8WC 4YS3D 3MVDA 1U35A 5B0ZA 2JCHA 5GT0A 5CP6B 3AZEA 3W98B 4WNNA 3KUYD 2PYOC 3A6NA 4CSRB 4QLCD 3WTPD 4YS3A 5GT3C 4H9OB 3AZND 1KX3C 4NE6A 3WTPA 3LJAD 2Y2JA 2J8PA 3AZNA 2F2AC 1A7WA 1BH9A 4KUDB 3LJAA 3WAAB 1F66D 3REHC 1M1AD 3NQUB 3EPLA 5F99B 3AZJD 1BFMA 2RVQC 2YFVA 1ID3C 2IO5B 5DNMD 3AZFC 1M1AA 3B0CT 2Y2KA 2FJ7D 3W97B 3AZJA 3MNNC 3W99C 5AVBC 5AV5D 4J8WB 1P34C 4XZQA 5B1MB 3C1CC 2FJ7A 1HTAA 2JE5A 3MGRD 5GT3D 2PYOB 5AV5A 4X23D 5FUGB 5GSUD 4J8UC 1KX3D 2ZY2A 3MGRA 3KXBB 5GT3A 5B33B 4X23A 3WA9C 1KX5B 3B6FD 4KGCC 3REJB 5GSUA 1HQ3D 3B0DC 1KX3A 4AWLB 1AOIB 3V9RB 1H3OB 3B6FA 3REHD 1HQ3A 1TZYD 4ZUXB 1ID3D 4J8VC 1P3FD 3REHA 4J8XB 3AZFB 1TZYA 5BNXA 3AZIB 1ID3A 5BNVA 3IP4C 5CPIC 4XUJC 3REIC 1P3FA 4Z5TC 2F8NH 3MNNB 4HGAC 5AVBB 3C1CD 1P34B 4DRAA 5KDMA 3W99B 3X1TC 5AV8C 5AV9D 5CPKB 4H9RB 3W96C 4M6BA 3C1CA 5AV9A 4J8UB 5AY8D 2ZM5A 2G5IC 5B32D 1T3UA 1KX4D 3WA9B 4EO5C 4KGCB 5AVCD 3NQJA 3B0DB 5AY8A 3AZHC 4H9NA 5B32A 1KX4A 3FDDA 3X1UD 5AVCA 1EQZD 3UT9C 2G5HC 4J8VD 4Z2MG 5B0YC 2LY8A 3X1UA 3KFUG 1EQZA 5CPID 3REID 4XUJD 4H9QB 3AZKC 4Z5TB 4HGAB 5AV8D 3X1SD 5CPIA 3REIA 4XUJA 3X1TB 2BYKB 3W96B 5AV8A 3X1SA 3AV2C 1P3GD 4JJNB 2NZDC 2ZY4A 3C1BD 4LD9B 1P3GA 3B6GB 4WU8B 3AZHB 3UT9D 3C1BA 3TU4C 3VH5T 1P3OD 5B0YB 2YFWA 5BT1C 5CP6C 3UT9A 3W98C 4ZBJB 5G49B 1P3OA 3AZKD 5B2IB 2Y2QA 1ULYA 1W2EA 3UTAB 3AZKA 2CV5C 1PZRA 2BYMA 5B24C 1TAFB 5AV6C 3AV2B 1R4VA 3WAAC 2NZDD 3KWQC 4CAYA 5JRGC 1P3MB 2NZDA 1N1JB 4Z66B 3TU4B 1M19B 1B67A 3H0MC 5B1MC 5CP6D 4WU9B 3W98D 5JA4B 3P5JB 2JSSA 1P3LC 2ZY3A 5GXQC 5CP6A 1P3PC 3W98A 4CSRA 3AZGC 5BS7C 3VH5A 3KXBC 3KUYA 3LZ0B 5B33C 4QLCA 1KX5C 3REJC 2CV5B 1AOIC 4AWLC 4KUDD 5B24B 3WAAD 1JFIB 5AV6B 3H0LC 4WV4B 5F99D 1P3BC 4ZUXC 3KWQB 5JRGB 3WKJB 4KUDA 2ZY5A 3WAAA 1S32B 3AN2B 3NQUA 4J8XC 3W97D 5F99A 3AFAC 1F66A 3AZIC 3X1VC 4J8WD 5B1MD 5DNMA 3W97A 2PYOD 5CPKC 4J8WA 1ZLAC 5B1MA 1P3LB 5GXQB 1P3PB 4NFTA 3KXBD 2CWEA 5B33D 2PYOA 3AZGB 5FUGA 3LZ1C 1KX5D 3REJD 1AOID 5CPJB 3KXBA 5B33A 2F8NK 5DNNC 1KX5A 3VH6T 3MGSB 1M1AB 3REJA 1AOIA 3EG5B 1Z2CB 3V9RA 1H3OA 1P3BB 2RVQD 4XZQB 4J8XD 3AZFD 4H9PB 3AZID 5B40C 5AV5B 1WWSA 3AFAB 2L5AA 3MNND 3W99D 5AVBD 4J8XA 3X1VB 1P34D 3AZFA 3AZIA 5CPKD 3O62C 2XD5A 1M18B 3MNNA 1P34A 5AVBA 4R8PB 3W99A 1ZLAB 2HUEC 4J8UD 4H9RA 3WA9D 5B31G 4KGCD 3LZ1B 4JJNC 4YM6C 4KHAB 4J8UA 4LD9C 3B6GC 3WA9A 3B0CW 5DNNB 3AYWB 4WU8C 4KGCA 3UTBB 3F6TA 1P3AC 4E44A 3RELC 2DF4C 1KU5A 4ZBJC 2UWXA 5B31C 5B40B 4J8VA 3VH6A 4Z5TD 5B2IC 4H9QA 3X1TD 3UTAC 3O62B 3W96D 2AROB 3KSYA 3NQJB 4Z5TA 5E5AB 5CHLB 3LELC 3X1TA 2HUEB 2BYKA 3W96A 4JJND 2F8NG 4G91C 3REKC 4H9SC 4YM6B 3AZMB 4LD9D 4E45A 3B6GD 1P3KC 1P3MC 4WU8D 3AZHD 4NE5A 4JJNA 1B6WA 4Z66C 3B6GA
chains in the Genus database with same CATH topology
4WU8A 5B0YD 3AZHA 1M19C 1P3AB 4WU9C 3WTPE 3RELB 5B0YA 5B31B 2BG1A 5G49A 3UTAD 3LZ0C 5B2JC 5C3IC 5BO0B 3AZLB 3AL0C 3LELB 3UTAA 5B1LB 3AV2D 1BH8A 4UUZB 1TAFA 4G91B 3REKB 1P3MD 3AV2A 3WKJC 1S32C 3EPJA 3AZEC 3AN2C 1P3KB 3A6NC 4Z66D 4YS3C 3TU4D 1P3MA 1M19D 3MGPB 4WU9D 1N1JA 5BT1D 4Z66A 3TU4A 1M19A 4WU9A 2F8NB 5JA4A 3LZ0D 3A1IA 3LJAC 3MGQB 2CV5D 3R45B 4H9OA 5C3IB 5B2JB 3AV1B 5CPJC 3LZ0A 5B24D 4LD9A 3MGSC 4WZSB 2Y2LA 5AV6D 1M1AC 1P3IB 2CV5A 2NQBB 2HIOB 3VH5W 3KWQD 5JRGD 3WKJD 5B24A 4XZQC 1JFIA 5AV6A 3AN2D 3MVDB 1U35B 5B0ZB 1S32D 2FJ7C 4WJ3C 5GT0B 3KWQA 3AZEB 5JRGA 4WNNB 2Y2HA 3WKJA 5AV5C 3A6NB 1S32A 3AN2A 4YS3B 1F1EA 3MGRC 3KUYB 4X23C 4QLCB 1WWIA 3WTPB 1M18C 5GSUC 3B0BA 1P3LD 4R8PC 3EPHA 5GXQD 1P3PD 3AZNB 3AZGD 3B6FC 2RIQA 1BH9B 1HQ3C 3LJAB 1P3LA 5CPJD 5GXQA 1P3PA 3AZGA 2VQRA 5BS7A 2YFVB 3MGSD 3AYWC 5CPJA 1TZYC 3UTBC 1F66B 1P3FC 1P3BD 3AZJB 4ZUXD 4XZQD 3MGSA 2Y2OA 5B32G 5DNMB 2FJ7B 1P3BA 3AFAD 4ZUXA 4UPKA 3X1VD 4H9PA 5AV9C 3AFAA 3MGRB 1M18D 5GT3B 4X23B 3X1VA 4R8PD 2AROC 5E5AC 1ZLAD 4Z2MH 5GSUB 1KX3B 5AY8C 5B32C 1M18A 1KX4C 5CPKA 4R8PA 3B6FB 5AVCC 3LZ1D 1ZLAA 2Y2IA 1HQ3B 4NE3A 3AZMC 4G92C 3X1UC 5DNND 3AYWD 3LZ1A 3REHB 4KHAA 3UTBD 1EQZC 1TZYB 5BNXB 1ID3B 5BNVB 1P3FB 3AYWA 5DNNA 4DRBA 3UTBA 5KDMB 5B40D 3C1CB 3X1SC 4DQYB 5AV9B 5B40A 3O62D 2AROD 5E5AD 3EPKA 1P3GC 3AZLC 2DQNC 3VH6W 5AY8B 5B1LC 3O62A 4H9NB 2AROA 5E5AA 5B32B 1KX4B 3C1BC 5AVCB 3AZMD 4YM6D 1Q9CA 4G92B 3X1UB 3AZMA 4YM6A 1EQZB 1P3OC 4J8VB 3MGPC 2FFFB 1P3AD 3RELD 2Y2NA 5CPIB 3REIB 4XUJB 5B31D 1P3AA 3RELA 5B2ID 5AV8B 3X1SB 5B31A 3MGQC 3AV1C 5B2IA 3AZLD 3LELD 5B1LD 1P3GB 2NQBC 4EO5B 5BO0A 1P3IC 2HIOC 3C1BB 3AZLA 3LELA 3REKD 2Y2PA 5B1LA 1P3KD 3MVDC 1U35C 4UUZA 2YFWB 5B0ZC 5GT0C 3UT9B 3REKA 4H9SA 3MGPD 1P3OB 1P3KA 3H0RC 3KUYC 2W8SA 4QLCC 3MGPA 3WTPC 3AZKB 2F8ND 2Y2GA 2BYMB 3AZNC 1BH8B 3MGQD 2Y2MA 2F8NA 5B2JD 3AV1D 4CAYB 4KUDC 2NQBD 3MGQA 1P3ID 3R45A 5B2JA 2HIOD 5F99C 3AV1A 1F66C 2NZDB 2IO5C 3AZJC 2NQBA 3MVDD 1U35D 5B0ZD 5DNMC 1P3IA 3W97C 2HIOA 5GT0D 3A1KA 3AZED 3A6ND 2XD1A 4J8WC 4YS3D 3MVDA 1U35A 5B0ZA 2JCHA 5GT0A 5CP6B 3AZEA 3W98B 4WNNA 3KUYD 2PYOC 3A6NA 4CSRB 4QLCD 3WTPD 4YS3A 5GT3C 4H9OB 3AZND 1KX3C 4NE6A 3WTPA 3LJAD 2Y2JA 2J8PA 3AZNA 2F2AC 1A7WA 1BH9A 4KUDB 3LJAA 3WAAB 1F66D 3REHC 1M1AD 3NQUB 3EPLA 5F99B 3AZJD 1BFMA 2RVQC 2YFVA 1ID3C 2IO5B 5DNMD 3AZFC 1M1AA 3B0CT 2Y2KA 2FJ7D 3W97B 3AZJA 3MNNC 3W99C 5AVBC 5AV5D 4J8WB 1P34C 4XZQA 5B1MB 3C1CC 2FJ7A 1HTAA 2JE5A 3MGRD 5GT3D 2PYOB 5AV5A 4X23D 5FUGB 5GSUD 4J8UC 1KX3D 2ZY2A 3MGRA 3KXBB 5GT3A 5B33B 4X23A 3WA9C 1KX5B 3B6FD 4KGCC 3REJB 5GSUA 1HQ3D 3B0DC 1KX3A 4AWLB 1AOIB 3V9RB 1H3OB 3B6FA 3REHD 1HQ3A 1TZYD 4ZUXB 1ID3D 4J8VC 1P3FD 3REHA 4J8XB 3AZFB 1TZYA 5BNXA 3AZIB 1ID3A 5BNVA 3IP4C 5CPIC 4XUJC 3REIC 1P3FA 4Z5TC 2F8NH 3MNNB 4HGAC 5AVBB 3C1CD 1P34B 4DRAA 5KDMA 3W99B 3X1TC 5AV8C 5AV9D 5CPKB 4H9RB 3W96C 4M6BA 3C1CA 5AV9A 4J8UB 5AY8D 2ZM5A 2G5IC 5B32D 1T3UA 1KX4D 3WA9B 4EO5C 4KGCB 5AVCD 3NQJA 3B0DB 5AY8A 3AZHC 4H9NA 5B32A 1KX4A 3FDDA 3X1UD 5AVCA 1EQZD 3UT9C 2G5HC 4J8VD 4Z2MG 5B0YC 2LY8A 3X1UA 3KFUG 1EQZA 5CPID 3REID 4XUJD 4H9QB 3AZKC 4Z5TB 4HGAB 5AV8D 3X1SD 5CPIA 3REIA 4XUJA 3X1TB 2BYKB 3W96B 5AV8A 3X1SA 3AV2C 1P3GD 4JJNB 2NZDC 2ZY4A 3C1BD 4LD9B 1P3GA 3B6GB 4WU8B 3AZHB 3UT9D 3C1BA 3TU4C 3VH5T 1P3OD 5B0YB 2YFWA 5BT1C 5CP6C 3UT9A 3W98C 4ZBJB 5G49B 1P3OA 3AZKD 5B2IB 2Y2QA 1ULYA 1W2EA 3UTAB 3AZKA 2CV5C 1PZRA 2BYMA 5B24C 1TAFB 5AV6C 3AV2B 1R4VA 3WAAC 2NZDD 3KWQC 4CAYA 5JRGC 1P3MB 2NZDA 1N1JB 4Z66B 3TU4B 1M19B 1B67A 3H0MC 5B1MC 5CP6D 4WU9B 3W98D 5JA4B 3P5JB 2JSSA 1P3LC 2ZY3A 5GXQC 5CP6A 1P3PC 3W98A 4CSRA 3AZGC 5BS7C 3VH5A 3KXBC 3KUYA 3LZ0B 5B33C 4QLCA 1KX5C 3REJC 2CV5B 1AOIC 4AWLC 4KUDD 5B24B 3WAAD 1JFIB 5AV6B 3H0LC 4WV4B 5F99D 1P3BC 4ZUXC 3KWQB 5JRGB 3WKJB 4KUDA 2ZY5A 3WAAA 1S32B 3AN2B 3NQUA 4J8XC 3W97D 5F99A 3AFAC 1F66A 3AZIC 3X1VC 4J8WD 5B1MD 5DNMA 3W97A 2PYOD 5CPKC 4J8WA 1ZLAC 5B1MA 1P3LB 5GXQB 1P3PB 4NFTA 3KXBD 2CWEA 5B33D 2PYOA 3AZGB 5FUGA 3LZ1C 1KX5D 3REJD 1AOID 5CPJB 3KXBA 5B33A 2F8NK 5DNNC 1KX5A 3VH6T 3MGSB 1M1AB 3REJA 1AOIA 3EG5B 1Z2CB 3V9RA 1H3OA 1P3BB 2RVQD 4XZQB 4J8XD 3AZFD 4H9PB 3AZID 5B40C 5AV5B 1WWSA 3AFAB 2L5AA 3MNND 3W99D 5AVBD 4J8XA 3X1VB 1P34D 3AZFA 3AZIA 5CPKD 3O62C 2XD5A 1M18B 3MNNA 1P34A 5AVBA 4R8PB 3W99A 1ZLAB 2HUEC 4J8UD 4H9RA 3WA9D 5B31G 4KGCD 3LZ1B 4JJNC 4YM6C 4KHAB 4J8UA 4LD9C 3B6GC 3WA9A 3B0CW 5DNNB 3AYWB 4WU8C 4KGCA 3UTBB 3F6TA 1P3AC 4E44A 3RELC 2DF4C 1KU5A 4ZBJC 2UWXA 5B31C 5B40B 4J8VA 3VH6A 4Z5TD 5B2IC 4H9QA 3X1TD 3UTAC 3O62B 3W96D 2AROB 3KSYA 3NQJB 4Z5TA 5E5AB 5CHLB 3LELC 3X1TA 2HUEB 2BYKA 3W96A 4JJND 2F8NG 4G91C 3REKC 4H9SC 4YM6B 3AZMB 4LD9D 4E45A 3B6GD 1P3KC 1P3MC 4WU8D 3AZHD 4NE5A 4JJNA 1B6WA 4Z66C 3B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 A;  5B0Y D;  3AZH A;  1M19 C;  1P3A B;  4WU9 C;  3WTP E;  3REL B;  5B0Y A;  5B31 B;  5G49 A;  3UTA D;  3LZ0 C;  5B2J C;  5C3I C;  5BO0 B;  3AZL B;  3LEL B;  3UTA A;  5B1L B;  3AV2 D;  1BH8 A;  4UUZ B;  1TAF A;  4G91 B;  3REK B;  1P3M D;  3AV2 A;  3WKJ C;  1S32 C;  3AZE C;  3AN2 C;  1P3K B;  3A6N C;  4Z66 D;  4YS3 C;  3TU4 D;  1P3M A;  1M19 D;  3MGP B;  4WU9 D;  1N1J A;  5BT1 D;  4Z66 A;  3TU4 A;  1M19 A;  4WU9 A;  2F8N B;  5JA4 A;  3LZ0 D;  3LJA C;  3MGQ B;  2CV5 D;  3R45 B;  4H9O A;  5C3I B;  5B2J B;  3AV1 B;  5CPJ C;  3LZ0 A;  5B24 D;  4LD9 A;  3MGS C;  4WZS B;  5AV6 D;  1M1A C;  2NQB B;  1P3I B;  2CV5 A;  2HIO B;  3VH5 W;  3KWQ D;  5JRG D;  3WKJ D;  5B24 A;  4XZQ C;  1JFI A;  5AV6 A;  3AN2 D;  3MVD B;  1U35 B;  5B0Z B;  1S32 D;  2FJ7 C;  5GT0 B;  3KWQ A;  3AZE B;  5JRG A;  4WNN B;  3WKJ A;  5AV5 C;  3A6N B;  1S32 A;  3AN2 A;  4YS3 B;  1F1E A;  3MGR C;  3KUY B;  4X23 C;  4QLC B;  1WWI A;  3WTP B;  1M18 C;  5GSU C;  3B0B A;  1P3L D;  4R8P C;  5GXQ D;  1P3P D;  3AZN B;  3AZG D;  3B6F C;  1BH9 B;  1HQ3 C;  3LJA B;  1P3L A;  5CPJ D;  5GXQ A;  1P3P A;  3AZG A;  5BS7 A;  2YFV B;  3MGS D;  3AYW C;  5CPJ A;  1TZY C;  3UTB C;  1F66 B;  1P3F C;  1P3B D;  3AZJ B;  4ZUX D;  4XZQ D;  3MGS A;  5B32 G;  5DNM B;  2FJ7 B;  1P3B A;  3AFA D;  4ZUX A;  3X1V D;  4H9P A;  5AV9 C;  3AFA A;  3MGR B;  1M18 D;  5GT3 B;  4X23 B;  3X1V A;  4R8P D;  2ARO C;  5E5A C;  1ZLA D;  4Z2M H;  5GSU B;  1KX3 B;  5AY8 C;  5B32 C;  1M18 A;  1KX4 C;  5CPK A;  4R8P A;  3B6F B;  5AVC C;  3LZ1 D;  1ZLA A;  1HQ3 B;  4NE3 A;  3AZM C;  4G92 C;  3X1U C;  5DNN D;  3AYW D;  3LZ1 A;  3REH B;  4KHA A;  3UTB D;  1EQZ C;  1TZY B;  5BNX B;  1ID3 B;  5BNV B;  1P3F B;  3AYW A;  5DNN A;  4DRB A;  3UTB A;  5KDM B;  5B40 D;  3C1C B;  3X1S C;  5AV9 B;  5B40 A;  3O62 D;  2ARO D;  5E5A D;  1P3G C;  3AZL C;  3VH6 W;  5AY8 B;  5B1L C;  3O62 A;  4H9N B;  2ARO A;  5E5A A;  5B32 B;  1KX4 B;  3C1B C;  5AVC B;  3AZM D;  4YM6 D;  1Q9C A;  4G92 B;  3X1U B;  3AZM A;  4YM6 A;  1EQZ B;  1P3O C;  4J8V B;  3MGP C;  1P3A D;  3REL D;  5CPI B;  3REI B;  4XUJ B;  5B31 D;  1P3A A;  3REL A;  5B2I D;  5AV8 B;  3X1S B;  5B31 A;  3MGQ C;  3AV1 C;  5B2I A;  3AZL D;  3LEL D;  5B1L D;  1P3G B;  2NQB C;  4EO5 B;  5BO0 A;  1P3I C;  2HIO C;  3C1B B;  3AZL A;  3LEL A;  3REK D;  5B1L A;  1P3K D;  3MVD C;  1U35 C;  4UUZ A;  2YFW B;  5B0Z C;  5GT0 C;  3UT9 B;  3REK A;  4H9S A;  3MGP D;  1P3O B;  1P3K A;  3KUY C;  4QLC C;  3MGP A;  3WTP C;  3AZK B;  2F8N D;  2BYM B;  3AZN C;  1BH8 B;  3MGQ D;  2F8N A;  5B2J D;  3AV1 D;  4CAY B;  4KUD C;  2NQB D;  3MGQ A;  1P3I D;  3R45 A;  5B2J A;  2HIO D;  5F99 C;  3AV1 A;  1F66 C;  2NZD B;  2IO5 C;  3AZJ C;  2NQB A;  3MVD D;  1U35 D;  5B0Z D;  5DNM C;  1P3I A;  3W97 C;  2HIO A;  5GT0 D;  3AZE D;  3A6N D;  4J8W C;  4YS3 D;  3MVD A;  1U35 A;  5B0Z A;  5GT0 A;  5CP6 B;  3AZE A;  3W98 B;  4WNN A;  3KUY D;  2PYO C;  3A6N A;  4CSR B;  4QLC D;  3WTP D;  4YS3 A;  5GT3 C;  4H9O B;  3AZN D;  1KX3 C;  4NE6 A;  3WTP A;  3LJA D;  3AZN A;  1A7W A;  1BH9 A;  4KUD B;  3LJA A;  3WAA B;  1F66 D;  3REH C;  1M1A D;  3NQU B;  5F99 B;  3AZJ D;  1BFM A;  2RVQ C;  2YFV A;  1ID3 C;  2IO5 B;  5DNM D;  3AZF C;  1M1A A;  3B0C T;  2FJ7 D;  3W97 B;  3AZJ A;  3MNN C;  3W99 C;  5AVB C;  5AV5 D;  4J8W B;  1P34 C;  4XZQ A;  5B1M B;  3C1C C;  2FJ7 A;  1HTA A;  3MGR D;  5GT3 D;  2PYO B;  5AV5 A;  4X23 D;  5FUG B;  5GSU D;  4J8U C;  1KX3 D;  3MGR A;  3KXB B;  5GT3 A;  5B33 B;  4X23 A;  3WA9 C;  1KX5 B;  3B6F D;  4KGC C;  3REJ B;  5GSU A;  1HQ3 D;  3B0D C;  1KX3 A;  4AWL B;  1AOI B;  3V9R B;  1H3O B;  3B6F A;  3REH D;  1HQ3 A;  1TZY D;  4ZUX B;  1ID3 D;  4J8V C;  1P3F D;  3REH A;  4J8X B;  3AZF B;  1TZY A;  5BNX A;  3AZI B;  1ID3 A;  5BNV A;  5CPI C;  3REI C;  4XUJ C;  1P3F A;  2F8N H;  4Z5T C;  3MNN B;  4HGA C;  5AVB B;  3C1C D;  1P34 B;  4DRA A;  5KDM A;  3W99 B;  3X1T C;  5AV8 C;  5AV9 D;  5CPK B;  4H9R B;  3W96 C;  4M6B A;  3C1C A;  5AV9 A;  4J8U B;  5AY8 D;  5B32 D;  1KX4 D;  3WA9 B;  4EO5 C;  4KGC B;  5AVC D;  3NQJ A;  3B0D B;  5AY8 A;  3AZH C;  4H9N A;  5B32 A;  1KX4 A;  3X1U D;  5AVC A;  1EQZ D;  3UT9 C;  4J8V D;  4Z2M G;  5B0Y C;  2LY8 A;  3X1U A;  1EQZ A;  5CPI D;  3REI D;  4XUJ D;  4H9Q B;  3AZK C;  4Z5T B;  4HGA B;  5AV8 D;  3X1S D;  5CPI A;  3REI A;  4XUJ A;  3X1T B;  2BYK B;  3W96 B;  5AV8 A;  3X1S A;  3AV2 C;  1P3G D;  4JJN B;  2NZD C;  3C1B D;  4LD9 B;  1P3G A;  3B6G B;  4WU8 B;  3AZH B;  3UT9 D;  3C1B A;  3TU4 C;  3VH5 T;  1P3O D;  5B0Y B;  2YFW A;  5BT1 C;  5CP6 C;  3UT9 A;  3W98 C;  4ZBJ B;  5G49 B;  1P3O A;  3AZK D;  5B2I B;  1ULY A;  3UTA B;  3AZK A;  2CV5 C;  2BYM A;  1TAF B;  5B24 C;  5AV6 C;  3AV2 B;  1R4V A;  3WAA C;  2NZD D;  3KWQ C;  4CAY A;  5JRG C;  1P3M B;  2NZD A;  1N1J B;  4Z66 B;  3TU4 B;  1M19 B;  1B67 A;  4WU9 B;  5B1M C;  5CP6 D;  3W98 D;  5JA4 B;  2JSS A;  1P3L C;  5GXQ C;  5CP6 A;  1P3P C;  3W98 A;  4CSR A;  3AZG C;  5BS7 C;  3VH5 A;  3KXB C;  3KUY A;  3LZ0 B;  5B33 C;  4QLC A;  1KX5 C;  3REJ C;  2CV5 B;  1AOI C;  4AWL C;  4KUD D;  5B24 B;  3WAA D;  1JFI B;  5AV6 B;  4WV4 B;  5F99 D;  1P3B C;  4ZUX C;  3KWQ B;  5JRG B;  3WKJ B;  4KUD A;  3WAA A;  1S32 B;  3AN2 B;  3NQU A;  4J8X C;  3W97 D;  5F99 A;  3AFA C;  1F66 A;  3AZI C;  3X1V C;  4J8W D;  5B1M D;  5DNM A;  3W97 A;  2PYO D;  5CPK C;  4J8W A;  1ZLA C;  5B1M A;  1P3L B;  5GXQ B;  1P3P B;  4NFT A;  3KXB D;  2CWE A;  5B33 D;  2PYO A;  3AZG B;  5FUG A;  3LZ1 C;  1KX5 D;  3REJ D;  1AOI D;  5CPJ B;  3KXB A;  5B33 A;  2F8N K;  5DNN C;  1KX5 A;  3VH6 T;  3MGS B;  1M1A B;  3REJ A;  1AOI A;  3V9R A;  1H3O A;  1P3B B;  2RVQ D;  4XZQ B;  4J8X D;  3AZF D;  4H9P B;  3AZI D;  5B40 C;  5AV5 B;  1WWS A;  3AFA B;  2L5A A;  3MNN D;  3W99 D;  5AVB D;  4J8X A;  3X1V B;  1P34 D;  3AZF A;  3AZI A;  5CPK D;  3O62 C;  1M18 B;  3MNN A;  1P34 A;  5AVB A;  4R8P B;  3W99 A;  1ZLA B;  2HUE C;  4J8U D;  4H9R A;  3WA9 D;  5B31 G;  4KGC D;  3LZ1 B;  4JJN C;  4YM6 C;  4KHA B;  4J8U A;  4LD9 C;  3B6G C;  3WA9 A;  3B0C W;  5DNN B;  3AYW B;  4WU8 C;  4KGC A;  3UTB B;  1P3A C;  4E44 A;  3REL C;  1KU5 A;  4ZBJ C;  5B31 C;  5B40 B;  4J8V A;  3VH6 A;  4Z5T D;  5B2I C;  4H9Q A;  3X1T D;  3UTA C;  3O62 B;  3W96 D;  2ARO B;  3KSY A;  3NQJ B;  4Z5T A;  5E5A B;  5CHL B;  3LEL C;  3X1T A;  2HUE B;  2BYK A;  3W96 A;  4JJN D;  2F8N G;  4G91 C;  3REK C;  4H9S C;  4YM6 B;  3AZM B;  4LD9 D;  4E45 A;  3B6G D;  1P3K C;  1P3M C;  4WU8 D;  3AZH D;  4NE5 A;  4JJN A;  1B6W A;  4Z66 C;  3B6G A; 
#chains in the Genus database with same CATH topology
 4WU8 A;  5B0Y D;  3AZH A;  1M19 C;  1P3A B;  4WU9 C;  3WTP E;  3REL B;  5B0Y A;  5B31 B;  2BG1 A;  5G49 A;  3UTA D;  3LZ0 C;  5B2J C;  5C3I C;  5BO0 B;  3AZL B;  3AL0 C;  3LEL B;  3UTA A;  5B1L B;  3AV2 D;  1BH8 A;  4UUZ B;  1TAF A;  4G91 B;  3REK B;  1P3M D;  3AV2 A;  3WKJ C;  1S32 C;  3EPJ A;  3AZE C;  3AN2 C;  1P3K B;  3A6N C;  4Z66 D;  4YS3 C;  3TU4 D;  1P3M A;  1M19 D;  3MGP B;  4WU9 D;  1N1J A;  5BT1 D;  4Z66 A;  3TU4 A;  1M19 A;  4WU9 A;  2F8N B;  5JA4 A;  3LZ0 D;  3A1I A;  3LJA C;  3MGQ B;  2CV5 D;  3R45 B;  4H9O A;  5C3I B;  5B2J B;  3AV1 B;  5CPJ C;  3LZ0 A;  5B24 D;  4LD9 A;  3MGS C;  4WZS B;  2Y2L A;  5AV6 D;  1M1A C;  1P3I B;  2CV5 A;  2NQB B;  2HIO B;  3VH5 W;  3KWQ D;  5JRG D;  3WKJ D;  5B24 A;  4XZQ C;  1JFI A;  5AV6 A;  3AN2 D;  3MVD B;  1U35 B;  5B0Z B;  1S32 D;  2FJ7 C;  4WJ3 C;  5GT0 B;  3KWQ A;  3AZE B;  5JRG A;  4WNN B;  2Y2H A;  3WKJ A;  5AV5 C;  3A6N B;  1S32 A;  3AN2 A;  4YS3 B;  1F1E A;  3MGR C;  3KUY B;  4X23 C;  4QLC B;  1WWI A;  3WTP B;  1M18 C;  5GSU C;  3B0B A;  1P3L D;  4R8P C;  3EPH A;  5GXQ D;  1P3P D;  3AZN B;  3AZG D;  3B6F C;  2RIQ A;  1BH9 B;  1HQ3 C;  3LJA B;  1P3L A;  5CPJ D;  5GXQ A;  1P3P A;  3AZG A;  2VQR A;  5BS7 A;  2YFV B;  3MGS D;  3AYW C;  5CPJ A;  1TZY C;  3UTB C;  1F66 B;  1P3F C;  1P3B D;  3AZJ B;  4ZUX D;  4XZQ D;  3MGS A;  2Y2O A;  5B32 G;  5DNM B;  2FJ7 B;  1P3B A;  3AFA D;  4ZUX A;  4UPK A;  3X1V D;  4H9P A;  5AV9 C;  3AFA A;  3MGR B;  1M18 D;  5GT3 B;  4X23 B;  3X1V A;  4R8P D;  2ARO C;  5E5A C;  1ZLA D;  4Z2M H;  5GSU B;  1KX3 B;  5AY8 C;  5B32 C;  1M18 A;  1KX4 C;  5CPK A;  4R8P A;  3B6F B;  5AVC C;  3LZ1 D;  1ZLA A;  2Y2I A;  1HQ3 B;  4NE3 A;  3AZM C;  4G92 C;  3X1U C;  5DNN D;  3AYW D;  3LZ1 A;  3REH B;  4KHA A;  3UTB D;  1EQZ C;  1TZY B;  5BNX B;  1ID3 B;  5BNV B;  1P3F B;  3AYW A;  5DNN A;  4DRB A;  3UTB A;  5KDM B;  5B40 D;  3C1C B;  3X1S C;  4DQY B;  5AV9 B;  5B40 A;  3O62 D;  2ARO D;  5E5A D;  3EPK A;  1P3G C;  3AZL C;  2DQN C;  3VH6 W;  5AY8 B;  5B1L C;  3O62 A;  4H9N B;  2ARO A;  5E5A A;  5B32 B;  1KX4 B;  3C1B C;  5AVC B;  3AZM D;  4YM6 D;  1Q9C A;  4G92 B;  3X1U B;  3AZM A;  4YM6 A;  1EQZ B;  1P3O C;  4J8V B;  3MGP C;  2FFF B;  1P3A D;  3REL D;  2Y2N A;  5CPI B;  3REI B;  4XUJ B;  5B31 D;  1P3A A;  3REL A;  5B2I D;  5AV8 B;  3X1S B;  5B31 A;  3MGQ C;  3AV1 C;  5B2I A;  3AZL D;  3LEL D;  5B1L D;  1P3G B;  2NQB C;  4EO5 B;  5BO0 A;  1P3I C;  2HIO C;  3C1B B;  3AZL A;  3LEL A;  3REK D;  2Y2P A;  5B1L A;  1P3K D;  3MVD C;  1U35 C;  4UUZ A;  2YFW B;  5B0Z C;  5GT0 C;  3UT9 B;  3REK A;  4H9S A;  3MGP D;  1P3O B;  1P3K A;  3H0R C;  3KUY C;  2W8S A;  4QLC C;  3MGP A;  3WTP C;  3AZK B;  2F8N D;  2Y2G A;  2BYM B;  3AZN C;  1BH8 B;  3MGQ D;  2Y2M A;  2F8N A;  5B2J D;  3AV1 D;  4CAY B;  4KUD C;  2NQB D;  3MGQ A;  1P3I D;  3R45 A;  5B2J A;  2HIO D;  5F99 C;  3AV1 A;  1F66 C;  2NZD B;  2IO5 C;  3AZJ C;  2NQB A;  3MVD D;  1U35 D;  5B0Z D;  5DNM C;  1P3I A;  3W97 C;  2HIO A;  5GT0 D;  3A1K A;  3AZE D;  3A6N D;  2XD1 A;  4J8W C;  4YS3 D;  3MVD A;  1U35 A;  5B0Z A;  2JCH A;  5GT0 A;  5CP6 B;  3AZE A;  3W98 B;  4WNN A;  3KUY D;  2PYO C;  3A6N A;  4CSR B;  4QLC D;  3WTP D;  4YS3 A;  5GT3 C;  4H9O B;  3AZN D;  1KX3 C;  4NE6 A;  3WTP A;  3LJA D;  2Y2J A;  2J8P A;  3AZN A;  2F2A C;  1A7W A;  1BH9 A;  4KUD B;  3LJA A;  3WAA B;  1F66 D;  3REH C;  1M1A D;  3NQU B;  3EPL A;  5F99 B;  3AZJ D;  1BFM A;  2RVQ C;  2YFV A;  1ID3 C;  2IO5 B;  5DNM D;  3AZF C;  1M1A A;  3B0C T;  2Y2K A;  2FJ7 D;  3W97 B;  3AZJ A;  3MNN C;  3W99 C;  5AVB C;  5AV5 D;  4J8W B;  1P34 C;  4XZQ A;  5B1M B;  3C1C C;  2FJ7 A;  1HTA A;  2JE5 A;  3MGR D;  5GT3 D;  2PYO B;  5AV5 A;  4X23 D;  5FUG B;  5GSU D;  4J8U C;  1KX3 D;  2ZY2 A;  3MGR A;  3KXB B;  5GT3 A;  5B33 B;  4X23 A;  3WA9 C;  1KX5 B;  3B6F D;  4KGC C;  3REJ B;  5GSU A;  1HQ3 D;  3B0D C;  1KX3 A;  4AWL B;  1AOI B;  3V9R B;  1H3O B;  3B6F A;  3REH D;  1HQ3 A;  1TZY D;  4ZUX B;  1ID3 D;  4J8V C;  1P3F D;  3REH A;  4J8X B;  3AZF B;  1TZY A;  5BNX A;  3AZI B;  1ID3 A;  5BNV A;  3IP4 C;  5CPI C;  4XUJ C;  3REI C;  1P3F A;  4Z5T C;  2F8N H;  3MNN B;  4HGA C;  5AVB B;  3C1C D;  1P34 B;  4DRA A;  5KDM A;  3W99 B;  3X1T C;  5AV8 C;  5AV9 D;  5CPK B;  4H9R B;  3W96 C;  4M6B A;  3C1C A;  5AV9 A;  4J8U B;  5AY8 D;  2ZM5 A;  2G5I C;  5B32 D;  1T3U A;  1KX4 D;  3WA9 B;  4EO5 C;  4KGC B;  5AVC D;  3NQJ A;  3B0D B;  5AY8 A;  3AZH C;  4H9N A;  5B32 A;  1KX4 A;  3FDD A;  3X1U D;  5AVC A;  1EQZ D;  3UT9 C;  2G5H C;  4J8V D;  4Z2M G;  5B0Y C;  2LY8 A;  3X1U A;  3KFU G;  1EQZ A;  5CPI D;  3REI D;  4XUJ D;  4H9Q B;  3AZK C;  4Z5T B;  4HGA B;  5AV8 D;  3X1S D;  5CPI A;  3REI A;  4XUJ A;  3X1T B;  2BYK B;  3W96 B;  5AV8 A;  3X1S A;  3AV2 C;  1P3G D;  4JJN B;  2NZD C;  2ZY4 A;  3C1B D;  4LD9 B;  1P3G A;  3B6G B;  4WU8 B;  3AZH B;  3UT9 D;  3C1B A;  3TU4 C;  3VH5 T;  1P3O D;  5B0Y B;  2YFW A;  5BT1 C;  5CP6 C;  3UT9 A;  3W98 C;  4ZBJ B;  5G49 B;  1P3O A;  3AZK D;  5B2I B;  2Y2Q A;  1ULY A;  1W2E A;  3UTA B;  3AZK A;  2CV5 C;  1PZR A;  2BYM A;  5B24 C;  1TAF B;  5AV6 C;  3AV2 B;  1R4V A;  3WAA C;  2NZD D;  3KWQ C;  4CAY A;  5JRG C;  1P3M B;  2NZD A;  1N1J B;  4Z66 B;  3TU4 B;  1M19 B;  1B67 A;  3H0M C;  5B1M C;  5CP6 D;  4WU9 B;  3W98 D;  5JA4 B;  3P5J B;  2JSS A;  1P3L C;  2ZY3 A;  5GXQ C;  5CP6 A;  1P3P C;  3W98 A;  4CSR A;  3AZG C;  5BS7 C;  3VH5 A;  3KXB C;  3KUY A;  3LZ0 B;  5B33 C;  4QLC A;  1KX5 C;  3REJ C;  2CV5 B;  1AOI C;  4AWL C;  4KUD D;  5B24 B;  3WAA D;  1JFI B;  5AV6 B;  3H0L C;  4WV4 B;  5F99 D;  1P3B C;  4ZUX C;  3KWQ B;  5JRG B;  3WKJ B;  4KUD A;  2ZY5 A;  3WAA A;  1S32 B;  3AN2 B;  3NQU A;  4J8X C;  3W97 D;  5F99 A;  3AFA C;  1F66 A;  3AZI C;  3X1V C;  4J8W D;  5B1M D;  5DNM A;  3W97 A;  2PYO D;  5CPK C;  4J8W A;  1ZLA C;  5B1M A;  1P3L B;  5GXQ B;  1P3P B;  4NFT A;  3KXB D;  2CWE A;  5B33 D;  2PYO A;  3AZG B;  5FUG A;  3LZ1 C;  1KX5 D;  3REJ D;  1AOI D;  5CPJ B;  3KXB A;  5B33 A;  2F8N K;  5DNN C;  1KX5 A;  3VH6 T;  3MGS B;  1M1A B;  3REJ A;  1AOI A;  3EG5 B;  1Z2C B;  3V9R A;  1H3O A;  1P3B B;  2RVQ D;  4XZQ B;  4J8X D;  3AZF D;  4H9P B;  3AZI D;  5B40 C;  5AV5 B;  1WWS A;  3AFA B;  2L5A A;  3MNN D;  3W99 D;  5AVB D;  4J8X A;  3X1V B;  1P34 D;  3AZF A;  3AZI A;  5CPK D;  3O62 C;  2XD5 A;  1M18 B;  3MNN A;  1P34 A;  5AVB A;  4R8P B;  3W99 A;  1ZLA B;  2HUE C;  4J8U D;  4H9R A;  3WA9 D;  5B31 G;  4KGC D;  3LZ1 B;  4JJN C;  4YM6 C;  4KHA B;  4J8U A;  4LD9 C;  3B6G C;  3WA9 A;  3B0C W;  5DNN B;  3AYW B;  4WU8 C;  4KGC A;  3UTB B;  3F6T A;  1P3A C;  4E44 A;  3REL C;  2DF4 C;  1KU5 A;  4ZBJ C;  2UWX A;  5B31 C;  5B40 B;  4J8V A;  3VH6 A;  4Z5T D;  5B2I C;  4H9Q A;  3X1T D;  3UTA C;  3O62 B;  3W96 D;  2ARO B;  3KSY A;  3NQJ B;  4Z5T A;  5E5A B;  5CHL B;  3LEL C;  3X1T A;  2HUE B;  2BYK A;  3W96 A;  4JJN D;  2F8N G;  4G91 C;  3REK C;  4H9S C;  4YM6 B;  3AZM B;  4LD9 D;  4E45 A;  3B6G D;  1P3K C;  1P3M C;  4WU8 D;  3AZH D;  4NE5 A;  4JJN A;  1B6W A;  4Z66 C;  3B6G A; 
#chains in the Genus database with same CATH homology
 4WU8 A;  5B0Y D;  3AZH A;  1M19 C;  1P3A B;  4WU9 C;  3WTP E;  3REL B;  5B0Y A;  5B31 B;  2BG1 A;  5G49 A;  3UTA D;  3LZ0 C;  5B2J C;  5C3I C;  5BO0 B;  3AZL B;  3AL0 C;  3LEL B;  3UTA A;  5B1L B;  3AV2 D;  1BH8 A;  4UUZ B;  1TAF A;  4G91 B;  3REK B;  1P3M D;  3AV2 A;  3WKJ C;  1S32 C;  3EPJ A;  3AZE C;  3AN2 C;  1P3K B;  3A6N C;  4Z66 D;  4YS3 C;  3TU4 D;  1P3M A;  1M19 D;  3MGP B;  4WU9 D;  1N1J A;  5BT1 D;  4Z66 A;  3TU4 A;  1M19 A;  4WU9 A;  2F8N B;  5JA4 A;  3LZ0 D;  3A1I A;  3LJA C;  3MGQ B;  2CV5 D;  3R45 B;  4H9O A;  5C3I B;  5B2J B;  3AV1 B;  5CPJ C;  3LZ0 A;  5B24 D;  4LD9 A;  3MGS C;  4WZS B;  2Y2L A;  5AV6 D;  1M1A C;  1P3I B;  2CV5 A;  2NQB B;  2HIO B;  3VH5 W;  3KWQ D;  5JRG D;  3WKJ D;  5B24 A;  4XZQ C;  1JFI A;  5AV6 A;  3AN2 D;  3MVD B;  1U35 B;  5B0Z B;  1S32 D;  2FJ7 C;  4WJ3 C;  5GT0 B;  3KWQ A;  3AZE B;  5JRG A;  4WNN B;  2Y2H A;  3WKJ A;  5AV5 C;  3A6N B;  1S32 A;  3AN2 A;  4YS3 B;  1F1E A;  3MGR C;  3KUY B;  4X23 C;  4QLC B;  1WWI A;  3WTP B;  1M18 C;  5GSU C;  3B0B A;  1P3L D;  4R8P C;  3EPH A;  5GXQ D;  1P3P D;  3AZN B;  3AZG D;  3B6F C;  2RIQ A;  1BH9 B;  1HQ3 C;  3LJA B;  1P3L A;  5CPJ D;  5GXQ A;  1P3P A;  3AZG A;  2VQR A;  5BS7 A;  2YFV B;  3MGS D;  3AYW C;  5CPJ A;  1TZY C;  3UTB C;  1F66 B;  1P3F C;  1P3B D;  3AZJ B;  4ZUX D;  4XZQ D;  3MGS A;  2Y2O A;  5B32 G;  5DNM B;  2FJ7 B;  1P3B A;  3AFA D;  4ZUX A;  4UPK A;  3X1V D;  4H9P A;  5AV9 C;  3AFA A;  3MGR B;  1M18 D;  5GT3 B;  4X23 B;  3X1V A;  4R8P D;  2ARO C;  5E5A C;  1ZLA D;  4Z2M H;  5GSU B;  1KX3 B;  5AY8 C;  5B32 C;  1M18 A;  1KX4 C;  5CPK A;  4R8P A;  3B6F B;  5AVC C;  3LZ1 D;  1ZLA A;  2Y2I A;  1HQ3 B;  4NE3 A;  3AZM C;  4G92 C;  3X1U C;  5DNN D;  3AYW D;  3LZ1 A;  3REH B;  4KHA A;  3UTB D;  1EQZ C;  1TZY B;  5BNX B;  1ID3 B;  5BNV B;  1P3F B;  3AYW A;  5DNN A;  4DRB A;  3UTB A;  5KDM B;  5B40 D;  3C1C B;  3X1S C;  4DQY B;  5AV9 B;  5B40 A;  3O62 D;  2ARO D;  5E5A D;  3EPK A;  1P3G C;  3AZL C;  2DQN C;  3VH6 W;  5AY8 B;  5B1L C;  3O62 A;  4H9N B;  2ARO A;  5E5A A;  5B32 B;  1KX4 B;  3C1B C;  5AVC B;  3AZM D;  4YM6 D;  1Q9C A;  4G92 B;  3X1U B;  3AZM A;  4YM6 A;  1EQZ B;  1P3O C;  4J8V B;  3MGP C;  2FFF B;  1P3A D;  3REL D;  2Y2N A;  5CPI B;  3REI B;  4XUJ B;  5B31 D;  1P3A A;  3REL A;  5B2I D;  5AV8 B;  3X1S B;  5B31 A;  3MGQ C;  3AV1 C;  5B2I A;  3AZL D;  3LEL D;  5B1L D;  1P3G B;  2NQB C;  4EO5 B;  5BO0 A;  1P3I C;  2HIO C;  3C1B B;  3AZL A;  3LEL A;  3REK D;  2Y2P A;  5B1L A;  1P3K D;  3MVD C;  1U35 C;  4UUZ A;  2YFW B;  5B0Z C;  5GT0 C;  3UT9 B;  3REK A;  4H9S A;  3MGP D;  1P3O B;  1P3K A;  3H0R C;  3KUY C;  2W8S A;  4QLC C;  3MGP A;  3WTP C;  3AZK B;  2F8N D;  2Y2G A;  2BYM B;  3AZN C;  1BH8 B;  3MGQ D;  2Y2M A;  2F8N A;  5B2J D;  3AV1 D;  4CAY B;  4KUD C;  2NQB D;  3MGQ A;  1P3I D;  3R45 A;  5B2J A;  2HIO D;  5F99 C;  3AV1 A;  1F66 C;  2NZD B;  2IO5 C;  3AZJ C;  2NQB A;  3MVD D;  1U35 D;  5B0Z D;  5DNM C;  1P3I A;  3W97 C;  2HIO A;  5GT0 D;  3A1K A;  3AZE D;  3A6N D;  2XD1 A;  4J8W C;  4YS3 D;  3MVD A;  1U35 A;  5B0Z A;  2JCH A;  5GT0 A;  5CP6 B;  3AZE A;  3W98 B;  4WNN A;  3KUY D;  2PYO C;  3A6N A;  4CSR B;  4QLC D;  3WTP D;  4YS3 A;  5GT3 C;  4H9O B;  3AZN D;  1KX3 C;  4NE6 A;  3WTP A;  3LJA D;  2Y2J A;  2J8P A;  3AZN A;  2F2A C;  1A7W A;  1BH9 A;  4KUD B;  3LJA A;  3WAA B;  1F66 D;  3REH C;  1M1A D;  3NQU B;  3EPL A;  5F99 B;  3AZJ D;  1BFM A;  2RVQ C;  2YFV A;  1ID3 C;  2IO5 B;  5DNM D;  3AZF C;  1M1A A;  3B0C T;  2Y2K A;  2FJ7 D;  3W97 B;  3AZJ A;  3MNN C;  3W99 C;  5AVB C;  5AV5 D;  4J8W B;  1P34 C;  4XZQ A;  5B1M B;  3C1C C;  2FJ7 A;  1HTA A;  2JE5 A;  3MGR D;  5GT3 D;  2PYO B;  5AV5 A;  4X23 D;  5FUG B;  5GSU D;  4J8U C;  1KX3 D;  2ZY2 A;  3MGR A;  3KXB B;  5GT3 A;  5B33 B;  4X23 A;  3WA9 C;  1KX5 B;  3B6F D;  4KGC C;  3REJ B;  5GSU A;  1HQ3 D;  3B0D C;  1KX3 A;  4AWL B;  1AOI B;  3V9R B;  1H3O B;  3B6F A;  3REH D;  1HQ3 A;  1TZY D;  4ZUX B;  1ID3 D;  4J8V C;  1P3F D;  3REH A;  4J8X B;  3AZF B;  1TZY A;  5BNX A;  3AZI B;  1ID3 A;  5BNV A;  3IP4 C;  5CPI C;  4XUJ C;  3REI C;  1P3F A;  4Z5T C;  2F8N H;  3MNN B;  4HGA C;  5AVB B;  3C1C D;  1P34 B;  4DRA A;  5KDM A;  3W99 B;  3X1T C;  5AV8 C;  5AV9 D;  5CPK B;  4H9R B;  3W96 C;  4M6B A;  3C1C A;  5AV9 A;  4J8U B;  5AY8 D;  2ZM5 A;  2G5I C;  5B32 D;  1T3U A;  1KX4 D;  3WA9 B;  4EO5 C;  4KGC B;  5AVC D;  3NQJ A;  3B0D B;  5AY8 A;  3AZH C;  4H9N A;  5B32 A;  1KX4 A;  3FDD A;  3X1U D;  5AVC A;  1EQZ D;  3UT9 C;  2G5H C;  4J8V D;  4Z2M G;  5B0Y C;  2LY8 A;  3X1U A;  3KFU G;  1EQZ A;  5CPI D;  3REI D;  4XUJ D;  4H9Q B;  3AZK C;  4Z5T B;  4HGA B;  5AV8 D;  3X1S D;  5CPI A;  3REI A;  4XUJ A;  3X1T B;  2BYK B;  3W96 B;  5AV8 A;  3X1S A;  3AV2 C;  1P3G D;  4JJN B;  2NZD C;  2ZY4 A;  3C1B D;  4LD9 B;  1P3G A;  3B6G B;  4WU8 B;  3AZH B;  3UT9 D;  3C1B A;  3TU4 C;  3VH5 T;  1P3O D;  5B0Y B;  2YFW A;  5BT1 C;  5CP6 C;  3UT9 A;  3W98 C;  4ZBJ B;  5G49 B;  1P3O A;  3AZK D;  5B2I B;  2Y2Q A;  1ULY A;  1W2E A;  3UTA B;  3AZK A;  2CV5 C;  1PZR A;  2BYM A;  5B24 C;  1TAF B;  5AV6 C;  3AV2 B;  1R4V A;  3WAA C;  2NZD D;  3KWQ C;  4CAY A;  5JRG C;  1P3M B;  2NZD A;  1N1J B;  4Z66 B;  3TU4 B;  1M19 B;  1B67 A;  3H0M C;  5B1M C;  5CP6 D;  4WU9 B;  3W98 D;  5JA4 B;  3P5J B;  2JSS A;  1P3L C;  2ZY3 A;  5GXQ C;  5CP6 A;  1P3P C;  3W98 A;  4CSR A;  3AZG C;  5BS7 C;  3VH5 A;  3KXB C;  3KUY A;  3LZ0 B;  5B33 C;  4QLC A;  1KX5 C;  3REJ C;  2CV5 B;  1AOI C;  4AWL C;  4KUD D;  5B24 B;  3WAA D;  1JFI B;  5AV6 B;  3H0L C;  4WV4 B;  5F99 D;  1P3B C;  4ZUX C;  3KWQ B;  5JRG B;  3WKJ B;  4KUD A;  2ZY5 A;  3WAA A;  1S32 B;  3AN2 B;  3NQU A;  4J8X C;  3W97 D;  5F99 A;  3AFA C;  1F66 A;  3AZI C;  3X1V C;  4J8W D;  5B1M D;  5DNM A;  3W97 A;  2PYO D;  5CPK C;  4J8W A;  1ZLA C;  5B1M A;  1P3L B;  5GXQ B;  1P3P B;  4NFT A;  3KXB D;  2CWE A;  5B33 D;  2PYO A;  3AZG B;  5FUG A;  3LZ1 C;  1KX5 D;  3REJ D;  1AOI D;  5CPJ B;  3KXB A;  5B33 A;  2F8N K;  5DNN C;  1KX5 A;  3VH6 T;  3MGS B;  1M1A B;  3REJ A;  1AOI A;  3EG5 B;  1Z2C B;  3V9R A;  1H3O A;  1P3B B;  2RVQ D;  4XZQ B;  4J8X D;  3AZF D;  4H9P B;  3AZI D;  5B40 C;  5AV5 B;  1WWS A;  3AFA B;  2L5A A;  3MNN D;  3W99 D;  5AVB D;  4J8X A;  3X1V B;  1P34 D;  3AZF A;  3AZI A;  5CPK D;  3O62 C;  2XD5 A;  1M18 B;  3MNN A;  1P34 A;  5AVB A;  4R8P B;  3W99 A;  1ZLA B;  2HUE C;  4J8U D;  4H9R A;  3WA9 D;  5B31 G;  4KGC D;  3LZ1 B;  4JJN C;  4YM6 C;  4KHA B;  4J8U A;  4LD9 C;  3B6G C;  3WA9 A;  3B0C W;  5DNN B;  3AYW B;  4WU8 C;  4KGC A;  3UTB B;  3F6T A;  1P3A C;  4E44 A;  3REL C;  2DF4 C;  1KU5 A;  4ZBJ C;  2UWX A;  5B31 C;  5B40 B;  4J8V A;  3VH6 A;  4Z5T D;  5B2I C;  4H9Q A;  3X1T D;  3UTA C;  3O62 B;  3W96 D;  2ARO B;  3KSY A;  3NQJ B;  4Z5T A;  5E5A B;  5CHL B;  3LEL C;  3X1T A;  2HUE B;  2BYK A;  3W96 A;  4JJN D;  2F8N G;  4G91 C;  3REK C;  4H9S C;  4YM6 B;  3AZM B;  4LD9 D;  4E45 A;  3B6G D;  1P3K C;  1P3M C;  4WU8 D;  3AZH D;  4NE5 A;  4JJN A;  1B6W A;  4Z66 C;  3B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...