1ID3A

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3A00
5F99A 3LJAB 4KHAA 4J8WC 3AZHD 5E5AC 2BYMB 4G92B 4ZUXD 5B0YA 3AFAC 3TU4C 3X1SD 5B2JA 2F8ND 5BNVA 5CP6C 1KU5A 1JFIA 3AZKC 1P3FA 3UTAD 5CPJD 3VH6T 3X1UC 4YS3A 1P3LB 3AZJD 1U35B 1P3IA 1TAFA 4LD9D 3KXBA 4KGCC 2NQBB 4J8VD 3AZHC 2F8NK 5AV6A 1P3PD 4J8XB 2RVQD 3R45A 3WTPB 3W96B 3B6FB 3B6GA 5B0ZB 3W99B 1F66A 4JJNA 5GT0A 3UT9D 3X1SC 5KDMB 5GT3D 1S32B 5B1MB 3VH6A 4E44A 3RELA 3AZLA 1P3BB 2HIOB 5AVBB 5C3IC 4X23B 4J8WA 5E5AA 4EO5B 3AV1B 1KX3B 4Z2MG 5B32B 3AZJC 3MNND 5B31G 3AFAA 3TU4A 3REJD 3VH5A 3C1CB 4LD9C 5CP6A 3MGRC 4J8VC 3AZKA 2YFVB 1P3PC 3W97D 2RVQC 3AZID 2NZDB 1BH8B 4R8PB 1AOIC 3X1UA 1M19D 5GT3C 4QLCD 3MVDD 3C1BB 3AYWB 1KX5D 5BO0B 4AWLB 4KGCA 4Z66C 3AZHA 5DNNB 4WU9B 3X1TB 1ID3B 5AVCD 3MNNC 3KWQC 3AZEB 3MGSB 3WTPE 3X1SA 3LZ0B 3REJC 3AN2D 2F8NA 3WA9B 1P3GD 3WAAB 2CV5B 3MGQD 3W97C 3AZIC 1P3AD 4WV4B 3LZ1C 2AROB 4H9SC 3KUYB 5B33C 1M19C 3WKJB 4H9QB 3AZJA 5BT1D 1H3OB 4QLCC 5B2IA 5DNMC 1KX5C 5JA4B 1P3KB 4LD9A 5AV9D 3B0BA 3MGRA 4J8VA 4Z5TA 2JSSA 1P3PA 3O62C 1AOIA 5AVCC 3AZFB 4ZBJB 1M1AA 5GT3A 5BNXB 4KUDB 2F8NH 4Z66A 1P3AC 3AZNC 4WU8B 1P3LD 2YFWB 5GSUB 4CSRB 1U35D 3AZGD 1ULYA 3MNNA 3W98B 3KWQA 3REJA 1HQ3C 1BH9A 3REHB 5AV9C 4J8XD 5B1LB 3W97A 3VH6W 3WTPD 4G92C 3B0CW 3AZIA 2PYOB 4WZSB 3LZ1A 3UTBA 3W99D 5B0ZD 4H9SA 3AV2B 1KX4B 2FJ7B 5B33A 1M19A 1S32D 5B1MD 3NQUA 5B32G 1EQZC 3MGPD 2HUEC 4QLCA 5DNMA 5CPKB 1KX5A 5AVBD 5AV5B 3V9RA 1P34B 3X1VB 3VH5W 3AV1D 1KX3D 5B32D 5F99B 4YM6D 2BYKA 4KHAB 3O62A 3AZGC 5AVCA 3LELB 3C1CD 1ZLAC 4H9PA 4NE5A 5B0YB 5B2JB 5BNVB 5B24D 1Q9CA 4R8PD 1P3AA 1B6WA 3AZNA 1A7WA 4CAYA 1P3FB 2LY8A 3MGPC 4YS3B 5AVBC 1HQ3A 5AV9A 1P3IB 1TAFB 3KXBB 4YM6C 5AV6B 3KSYA 3MGSD 3C1CC 3WA9D 4ZUXC 5B40D 4J8UD 1EQZA 3B6GB 3WAAD 1F66B 4JJNB 2CV5D 5GT0B 5B24C 3AZLB 3RELB 2L5AA 3KUYD 3UTAC 4G91C 5CPJC 4J8WB 3AZGA 1ZLAA 1P3KD 4AWLC 3A6ND 3AFAB 3TU4B 3REID 1P3OD 4XUJD 5CP6B 3AZKB 3AZFD 5GXQD 5B31D 4J8UC 5B40C 3NQJA 3MGPA 3X1UB 4KUDD 3UT9C 4WNNA 5JRGD 1N1JA 4WU8D 1TZYD 3KUYC 5GSUD 3REKD 4KGCB 1WWIA 4YM6A 4H9OA 3AZHB 5AY8B 2IO5C 4XZQD 3C1CA 1P3KC 4ZUXA 4H9NA 4NFTA 3REHD 4E45A 3A6NC 5B1LD 3REIC 3X1SB 4XUJC 1P3OC 2F8NB 2PYOD 5B24A 1KX4D 4DRAA 3AZMD 2FJ7D 3UTAA 5CPJA 5C3IB 4ZBJC 5GXQC 5B31C 5AV5D 5BO0A 1P34D 5JRGC 3X1VD 3AZJB 3MVDC 1M18D 5CPID 5B2IB 1TZYC 3LJAD 5F99D 3REKC 5FUGA 3MGRB 4Z5TB 1BFMA 3LELD 1P3PB 4XZQC 4HGAB 5B40A 4J8UA 3REHC 1AOIB 4H9RA 5B2JD 3UT9A 1M1AB 5B1LC 3AN2C 5GT3B 5G49B 1P3GC 3B0DC 3AZMC 1P3FD 3MGQC 4Z66B 5AV8B 5BT1C 3A6NA 3MNNB 1P3ID 1M18C 5CPIC 3KWQB 2NQBD 3REIA 1P3OA 4XUJA 3LJAC 1BH9B 5AV6D 3LELC 3W97B 3W96D 3AZIB 5GXQA 5B31A 3B6FD 3LZ1B 3UTBB 5B33B 1M19B 5JRGA 3NQUB 3MVDA 3RELD 1P3BD 2HIOD 5DNMB 1TZYA 1KX5B 1P3MB 4X23D 3REKA 4J8WD 4UUZA 1P3LC 4XZQA 1U35C 2BYKB 3O62B 5AVCB 4H9PB 5B1LA 3AN2A 2NQBC 5CP6D 1R4VA 1P3GA 2NZDD 4J8XC 3AZMA 3MGQA 3WTPC 3W96C 3B6FC 1P3AB 1JFIB 3W99C 5CHLB 5B0ZC 4Z2MH 3AZNB 4CAYB 3C1BD 1S32C 5B1MC 3AYWD 1P3BC 1M18A 5BS7C 2HIOC 5CPIA 4KGCD 1HQ3B 4X23C 3LJAA 2F8NG 5AV9B 4EO5C 5DNND 5AY8D 3AV1C 1KX3C 4WU9D 3X1TD 2BYMA 1ID3D 3LELA 5B32C 3AZED 3R45B 3LZ0D 1EQZB 2HUEB 2NZDC 2AROD 4R8PC 3B0CT 1P3LA 3WKJD 1U35A 5E5AB 3C1BC 3AZGB 5B2ID 3AYWC 1ZLAB 2NQBA 3MGRD 4M6BA 5DNNC 4Z5TD 5AY8C 4J8XA 4WU9C 2CWEA 3VH5T 3X1TC 3WTPA 1ID3C 3W96A 3B6FA 1AOID 5B0ZA 3W99A 3AZEC 3MGSC 3LZ0C 1M1AD 5KDMA 3WA9C 1S32A 5B1MA 4NE6A 4NE3A 3WAAC 3NQJB 4DRBA 3MGPB 1P3BA 5BS7A 2HIOA 5AVBA 2CV5C 4WNNB 4X23A 4Z66D 1N1JB 2AROC 5AV8D 3AV1A 1KX3A 5B32A 3WKJC 4YM6B 4H9OB 3W98D 3KWQD 5B2IC 4ZUXB 4H9NB 2YFVA 2NZDA 4Z5TC 1BH8A 5B24B 4R8PA 4HGAC 3LZ1D 3UTBD 3AV2D 3AZFC 3UTAB 4G91B 5B33D 5CPJB 1M1AC 3C1BA 1B67A 5CPKD 3AYWA 5DNMD 1P3MD 4KUDC 4WU8C 5DNNA 5AV8C 5AY8A 4LD9B 5GSUC 4WU9A 3X1TA 1ID3A 5FUGB 3O62D 4J8VB 3W98C 3AZEA 3MGSA 3LZ0A 3WA9A 5B0YD 5B40B 4J8UB 3WAAA 2CV5A 4H9RB 2PYOC 3UT9B 2AROA 3AZND 3KUYA 3UTBC 3AV2C 1KX4C 2FJ7C 3WKJA 4H9QA 1H3OA 4YS3D 5CPKC 5JA4A 1WWSA 2IO5B 5AV5C 1P3KA 1HQ3D 1P34C 1P3MC 3X1VC 3A6NB 3KXBD 3REJB 3REIB 1P3OB 4XUJB 5F99C 1F1EA 3AZFA 5GXQB 5B31B 1EQZD 3B6GD 5BNXA 5G49A 5B0YC 4JJND 1F66D 5GT0D 5B2JC 4KUDA 3AZLD 5JRGB 4QLCB 3MVDB 4WU8A 5AV8A 1TZYB 1HTAA 2YFWA 3V9RB 5GSUA 1P3FC 4CSRA 3REKB 4UUZB 5E5AD 3W98A 4YS3C 1ZLAD 4XZQB 3REHA 3AFAD 3TU4D 1P3IC 3KXBC 2PYOA 3AN2B 3AZKD 1P3GB 3B0DB 5AV6C 3AV2A 1KX4A 3AZMB 2FJ7A 3MGQB 3B6GC 3X1UD 1F66C 4JJNC 5CPKA 5AV5A 5GT0C 1P34A 1P3MA 3X1VA 3AZLC 3RELC 1M18B 5CPIB
chains in the Genus database with same CATH superfamily
5F99A 3LJAB 4KHAA 4J8WC 3AZHD 5E5AC 2BYMB 4G92B 4ZUXD 5B0YA 3AFAC 3TU4C 3X1SD 5B2JA 2F8ND 5BNVA 5CP6C 1KU5A 1JFIA 3AZKC 1P3FA 3UTAD 5CPJD 1PZRA 3VH6T 3X1UC 4YS3A 1P3LB 2ZY2A 3AZJD 1U35B 1P3IA 1TAFA 4LD9D 3KXBA 4KGCC 2NQBB 4J8VD 3AZHC 3EPKA 2F8NK 5AV6A 1P3PD 4J8XB 2RVQD 3R45A 3WTPB 3W96B 3B6FB 3B6GA 2RIQA 5B0ZB 1F66A 4JJNA 3W99B 5GT0A 3UT9D 3X1SC 5KDMB 5GT3D 1S32B 5B1MB 3VH6A 4E44A 3RELA 3H0RC 3AZLA 1P3BB 2HIOB 5AVBB 5C3IC 4X23B 4J8WA 5E5AA 4EO5B 3AV1B 1KX3B 4Z2MG 2XD5A 5B32B 3AZJC 3MNND 5B31G 3AFAA 3TU4A 3REJD 3VH5A 3C1CB 4LD9C 5CP6A 3MGRC 4J8VC 3AZKA 2YFVB 1P3PC 3W97D 2RVQC 3AZID 2NZDB 1BH8B 4R8PB 1AOIC 3X1UA 3IP4C 1M19D 5GT3C 2Y2KA 4QLCD 3MVDD 3C1BB 3AYWB 1KX5D 5BO0B 4AWLB 4KGCA 2Y2HA 4Z66C 3AZHA 5DNNB 4WU9B 3X1TB 1ID3B 5AVCD 2ZY5A 3MNNC 3KWQC 3AZEB 3MGSB 3WTPE 3X1SA 3LZ0B 3REJC 3AN2D 2F8NA 3WA9B 1P3GD 3WAAB 1T3UA 2CV5B 3MGQD 3W97C 3AZIC 1P3AD 4WV4B 3LZ1C 2AROB 4H9SC 3KUYB 5B33C 1M19C 3WKJB 4H9QB 3AZJA 5BT1D 1H3OB 4QLCC 5B2IA 5DNMC 1KX5C 5JA4B 1P3KB 4LD9A 5AV9D 3B0BA 3MGRA 4J8VA 4Z5TA 2JSSA 1P3PA 2J8PA 3O62C 1AOIA 5AVCC 3AZFB 2XD1A 2UWXA 4ZBJB 1M1AA 5GT3A 5BNXB 4KUDB 2F8NH 4Z66A 1P3AC 3AZNC 4WU8B 1P3LD 2YFWB 5GSUB 4CSRB 1U35D 3AZGD 1ULYA 3MNNA 3W98B 3KWQA 3REJA 1HQ3C 1BH9A 3REHB 5AV9C 4J8XD 5B1LB 3W97A 3VH6W 3WTPD 4G92C 3B0CW 3AZIA 2PYOB 4WZSB 3LZ1A 3UTBA 3W99D 5B0ZD 4H9SA 3AV2B 1KX4B 2FJ7B 5B33A 1M19A 1S32D 5B1MD 3NQUA 5B32G 1EQZC 3MGPD 2HUEC 4QLCA 5DNMA 5CPKB 1KX5A 5AVBD 5AV5B 3V9RA 1P34B 3X1VB 3VH5W 3AV1D 1KX3D 4WJ3C 5B32D 5F99B 4YM6D 2BYKA 4KHAB 3AL0C 3O62A 3AZGC 5AVCA 3LELB 3C1CD 1ZLAC 4H9PA 1W2EA 4NE5A 5B0YB 5B2JB 5BNVB 5B24D 1Q9CA 4R8PD 1P3AA 1B6WA 3AZNA 1A7WA 4CAYA 1P3FB 2DQNC 2LY8A 3MGPC 4YS3B 5AVBC 1HQ3A 5AV9A 3A1KA 1P3IB 1TAFB 3KXBB 4YM6C 5AV6B 3KSYA 3MGSD 3C1CC 3WA9D 4ZUXC 5B40D 4J8UD 1EQZA 3B6GB 3WAAD 1F66B 4JJNB 2CV5D 5GT0B 5B24C 3AZLB 3RELB 2L5AA 3KUYD 3UTAC 4G91C 5CPJC 3P5JB 4J8WB 3AZGA 1ZLAA 1P3KD 4AWLC 3A6ND 3AFAB 3TU4B 3REID 1P3OD 4XUJD 5CP6B 3AZKB 3AZFD 5GXQD 5B31D 4J8UC 5B40C 3NQJA 3MGPA 3X1UB 4KUDD 3UT9C 4WNNA 5JRGD 1N1JA 3EPJA 4WU8D 1TZYD 3KUYC 5GSUD 3REKD 4KGCB 2Y2QA 1WWIA 4YM6A 4H9OA 3AZHB 5AY8B 2IO5C 4XZQD 3C1CA 1P3KC 4ZUXA 4H9NA 4NFTA 3REHD 2FFFB 4E45A 3A6NC 5B1LD 3REIC 3X1SB 4XUJC 1P3OC 2F8NB 2PYOD 5B24A 1KX4D 4DRAA 3AZMD 2FJ7D 3UTAA 5CPJA 5C3IB 4ZBJC 5GXQC 5B31C 2Y2GA 5AV5D 5BO0A 1P34D 5JRGC 3X1VD 3AZJB 3MVDC 1M18D 5CPID 5B2IB 1TZYC 3LJAD 5F99D 3REKC 5FUGA 3MGRB 4Z5TB 1BFMA 3LELD 1P3PB 4XZQC 4HGAB 2BG1A 5B40A 4J8UA 4DQYB 3REHC 3EG5B 1AOIB 4H9RA 5B2JD 3UT9A 1M1AB 5B1LC 3AN2C 5GT3B 5G49B 1P3GC 3B0DC 3AZMC 1P3FD 3MGQC 4Z66B 5AV8B 5BT1C 3A6NA 3MNNB 1P3ID 1M18C 2Y2LA 5CPIC 3KWQB 2NQBD 3REIA 1P3OA 1Z2CB 4XUJA 3LJAC 1BH9B 5AV6D 3EPHA 3LELC 3W97B 3W96D 3AZIB 5GXQA 5B31A 3B6FD 3LZ1B 3UTBB 5B33B 1M19B 5JRGA 3NQUB 3MVDA 3RELD 1P3BD 2HIOD 5DNMB 3KFUG 1TZYA 1KX5B 1P3MB 4X23D 3REKA 4J8WD 4UUZA 1P3LC 4XZQA 1U35C 2BYKB 3O62B 5AVCB 4H9PB 5B1LA 3AN2A 2NQBC 2ZY3A 5CP6D 1R4VA 1P3GA 2NZDD 4J8XC 3AZMA 3MGQA 3WTPC 3W96C 3B6FC 1P3AB 1JFIB 3W99C 5CHLB 5B0ZC 4Z2MH 3AZNB 4CAYB 3C1BD 1S32C 5B1MC 3AYWD 1P3BC 1M18A 2ZY4A 2HIOC 5BS7C 5CPIA 4KGCD 1HQ3B 4X23C 3LJAA 2F8NG 2G5HC 5AV9B 5DNND 4EO5C 5AY8D 3AV1C 3A1IA 4WU9D 1KX3C 3X1TD 2BYMA 1ID3D 3LELA 5B32C 3AZED 2JE5A 3R45B 3LZ0D 1EQZB 2VQRA 2HUEB 2NZDC 2AROD 4R8PC 3B0CT 1P3LA 3WKJD 1U35A 5E5AB 3C1BC 3AZGB 5B2ID 3AYWC 1ZLAB 2NQBA 3H0MC 3MGRD 3H0LC 4M6BA 5DNNC 4Z5TD 5AY8C 4J8XA 4WU9C 2CWEA 3VH5T 3X1TC 3WTPA 1ID3C 3W96A 3B6FA 1AOID 5B0ZA 3W99A 3AZEC 3MGSC 3LZ0C 1M1AD 5KDMA 3WA9C 3F6TA 1S32A 5B1MA 4NE6A 4NE3A 2Y2IA 3WAAC 3NQJB 4DRBA 3MGPB 1P3BA 5BS7A 2HIOA 5AVBA 2CV5C 4WNNB 2W8SA 4X23A 4Z66D 1N1JB 2AROC 5AV8D 3AV1A 1KX3A 5B32A 3WKJC 4YM6B 4H9OB 3W98D 2Y2NA 5B2IC 3KWQD 4ZUXB 4H9NB 2G5IC 2YFVA 2NZDA 4Z5TC 1BH8A 5B24B 4R8PA 4HGAC 3LZ1D 3UTBD 3AV2D 3AZFC 2ZM5A 4G91B 5B33D 3UTAB 5CPJB 1M1AC 3C1BA 1B67A 5CPKD 3AYWA 5DNMD 1P3MD 4KUDC 4WU8C 5DNNA 5AV8C 5AY8A 2Y2MA 4LD9B 5GSUC 4WU9A 3X1TA 2DF4C 1ID3A 2F2AC 5FUGB 3O62D 4J8VB 3W98C 3AZEA 3MGSA 3LZ0A 3WA9A 5B0YD 5B40B 4J8UB 3WAAA 2CV5A 4H9RB 2PYOC 3UT9B 3EPLA 2AROA 3AZND 3KUYA 3UTBC 3AV2C 1KX4C 2FJ7C 4UPKA 3WKJA 4H9QA 1H3OA 4YS3D 5CPKC 5JA4A 1WWSA 2IO5B 5AV5C 1P3KA 1HQ3D 1P34C 1P3MC 3X1VC 3A6NB 3KXBD 3REJB 2JCHA 2Y2OA 3REIB 1P3OB 4XUJB 5F99C 1F1EA 3AZFA 5GXQB 5B31B 1EQZD 3B6GD 5BNXA 5G49A 5B0YC 4JJND 1F66D 5GT0D 5B2JC 4KUDA 3AZLD 5JRGB 4QLCB 3MVDB 4WU8A 3FDDA 5AV8A 1TZYB 1HTAA 2YFWA 3V9RB 5GSUA 1P3FC 4CSRA 3REKB 4UUZB 5E5AD 3W98A 2Y2JA 4YS3C 1ZLAD 4XZQB 3REHA 3AFAD 3TU4D 1P3IC 3KXBC 2PYOA 3AN2B 3AZKD 1P3GB 3B0DB 5AV6C 3AV2A 1KX4A 3AZMB 2FJ7A 3MGQB 3B6GC 3X1UD 1F66C 4JJNC 5CPKA 5AV5A 5GT0C 1P34A 1P3MA 2Y2PA 3X1VA 3AZLC 3RELC 1M18B 5CPIB
chains in the Genus database with same CATH topology
5F99A 3LJAB 4KHAA 4J8WC 3AZHD 5E5AC 2BYMB 4G92B 4ZUXD 5B0YA 3AFAC 3TU4C 3X1SD 5B2JA 2F8ND 5BNVA 5CP6C 1KU5A 1JFIA 3AZKC 1P3FA 3UTAD 5CPJD 1PZRA 3VH6T 3X1UC 4YS3A 1P3LB 2ZY2A 3AZJD 1U35B 1P3IA 1TAFA 4LD9D 3KXBA 4KGCC 2NQBB 4J8VD 3AZHC 3EPKA 2F8NK 5AV6A 1P3PD 4J8XB 2RVQD 3R45A 3WTPB 3W96B 3B6FB 3B6GA 2RIQA 5B0ZB 1F66A 4JJNA 3W99B 5GT0A 3UT9D 3X1SC 5KDMB 5GT3D 1S32B 5B1MB 3VH6A 4E44A 3RELA 3H0RC 3AZLA 1P3BB 2HIOB 5AVBB 5C3IC 4X23B 4J8WA 5E5AA 4EO5B 3AV1B 1KX3B 4Z2MG 2XD5A 5B32B 3AZJC 3MNND 5B31G 3AFAA 3TU4A 3REJD 3VH5A 3C1CB 4LD9C 5CP6A 3MGRC 4J8VC 3AZKA 2YFVB 1P3PC 3W97D 2RVQC 3AZID 2NZDB 1BH8B 4R8PB 1AOIC 3X1UA 3IP4C 1M19D 5GT3C 2Y2KA 4QLCD 3MVDD 3C1BB 3AYWB 1KX5D 5BO0B 4AWLB 4KGCA 2Y2HA 4Z66C 3AZHA 5DNNB 4WU9B 3X1TB 1ID3B 5AVCD 2ZY5A 3MNNC 3KWQC 3AZEB 3MGSB 3WTPE 3X1SA 3LZ0B 3REJC 3AN2D 2F8NA 3WA9B 1P3GD 3WAAB 1T3UA 2CV5B 3MGQD 3W97C 3AZIC 1P3AD 4WV4B 3LZ1C 2AROB 4H9SC 3KUYB 5B33C 1M19C 3WKJB 4H9QB 3AZJA 5BT1D 1H3OB 4QLCC 5B2IA 5DNMC 1KX5C 5JA4B 1P3KB 4LD9A 5AV9D 3B0BA 3MGRA 4J8VA 4Z5TA 2JSSA 1P3PA 2J8PA 3O62C 1AOIA 5AVCC 3AZFB 2XD1A 2UWXA 4ZBJB 1M1AA 5GT3A 5BNXB 4KUDB 2F8NH 4Z66A 1P3AC 3AZNC 4WU8B 1P3LD 2YFWB 5GSUB 4CSRB 1U35D 3AZGD 1ULYA 3MNNA 3W98B 3KWQA 3REJA 1HQ3C 1BH9A 3REHB 5AV9C 4J8XD 5B1LB 3W97A 3VH6W 3WTPD 4G92C 3B0CW 3AZIA 2PYOB 4WZSB 3LZ1A 3UTBA 3W99D 5B0ZD 4H9SA 3AV2B 1KX4B 2FJ7B 5B33A 1M19A 1S32D 5B1MD 3NQUA 5B32G 1EQZC 3MGPD 2HUEC 4QLCA 5DNMA 5CPKB 1KX5A 5AVBD 5AV5B 3V9RA 1P34B 3X1VB 3VH5W 3AV1D 1KX3D 4WJ3C 5B32D 5F99B 4YM6D 2BYKA 4KHAB 3AL0C 3O62A 3AZGC 5AVCA 3LELB 3C1CD 1ZLAC 4H9PA 1W2EA 4NE5A 5B0YB 5B2JB 5BNVB 5B24D 1Q9CA 4R8PD 1P3AA 1B6WA 3AZNA 1A7WA 4CAYA 1P3FB 2DQNC 2LY8A 3MGPC 4YS3B 5AVBC 1HQ3A 5AV9A 3A1KA 1P3IB 1TAFB 3KXBB 4YM6C 5AV6B 3KSYA 3MGSD 3C1CC 3WA9D 4ZUXC 5B40D 4J8UD 1EQZA 3B6GB 3WAAD 1F66B 4JJNB 2CV5D 5GT0B 5B24C 3AZLB 3RELB 2L5AA 3KUYD 3UTAC 4G91C 5CPJC 3P5JB 4J8WB 3AZGA 1ZLAA 1P3KD 4AWLC 3A6ND 3AFAB 3TU4B 3REID 1P3OD 4XUJD 5CP6B 3AZKB 3AZFD 5GXQD 5B31D 4J8UC 5B40C 3NQJA 3MGPA 3X1UB 4KUDD 3UT9C 4WNNA 5JRGD 1N1JA 3EPJA 4WU8D 1TZYD 3KUYC 5GSUD 3REKD 4KGCB 2Y2QA 1WWIA 4YM6A 4H9OA 3AZHB 5AY8B 2IO5C 4XZQD 3C1CA 1P3KC 4ZUXA 4H9NA 4NFTA 3REHD 2FFFB 4E45A 3A6NC 5B1LD 3REIC 3X1SB 4XUJC 1P3OC 2F8NB 2PYOD 5B24A 1KX4D 4DRAA 3AZMD 2FJ7D 3UTAA 5CPJA 5C3IB 4ZBJC 5GXQC 5B31C 2Y2GA 5AV5D 5BO0A 1P34D 5JRGC 3X1VD 3AZJB 3MVDC 1M18D 5CPID 5B2IB 1TZYC 3LJAD 5F99D 3REKC 5FUGA 3MGRB 4Z5TB 1BFMA 3LELD 1P3PB 4XZQC 4HGAB 2BG1A 5B40A 4J8UA 4DQYB 3REHC 3EG5B 1AOIB 4H9RA 5B2JD 3UT9A 1M1AB 5B1LC 3AN2C 5GT3B 5G49B 1P3GC 3B0DC 3AZMC 1P3FD 3MGQC 4Z66B 5AV8B 5BT1C 3A6NA 3MNNB 1P3ID 1M18C 2Y2LA 5CPIC 3KWQB 2NQBD 3REIA 1P3OA 1Z2CB 4XUJA 3LJAC 1BH9B 5AV6D 3EPHA 3LELC 3W97B 3W96D 3AZIB 5GXQA 5B31A 3B6FD 3LZ1B 3UTBB 5B33B 1M19B 5JRGA 3NQUB 3MVDA 3RELD 1P3BD 2HIOD 5DNMB 3KFUG 1TZYA 1KX5B 1P3MB 4X23D 3REKA 4J8WD 4UUZA 1P3LC 4XZQA 1U35C 2BYKB 3O62B 5AVCB 4H9PB 5B1LA 3AN2A 2NQBC 2ZY3A 5CP6D 1R4VA 1P3GA 2NZDD 4J8XC 3AZMA 3MGQA 3WTPC 3W96C 3B6FC 1P3AB 1JFIB 3W99C 5CHLB 5B0ZC 4Z2MH 3AZNB 4CAYB 3C1BD 1S32C 5B1MC 3AYWD 1P3BC 1M18A 2ZY4A 2HIOC 5BS7C 5CPIA 4KGCD 1HQ3B 4X23C 3LJAA 2F8NG 2G5HC 5AV9B 5DNND 4EO5C 5AY8D 3AV1C 3A1IA 4WU9D 1KX3C 3X1TD 2BYMA 1ID3D 3LELA 5B32C 3AZED 2JE5A 3R45B 3LZ0D 1EQZB 2VQRA 2HUEB 2NZDC 2AROD 4R8PC 3B0CT 1P3LA 3WKJD 1U35A 5E5AB 3C1BC 3AZGB 5B2ID 3AYWC 1ZLAB 2NQBA 3H0MC 3MGRD 3H0LC 4M6BA 5DNNC 4Z5TD 5AY8C 4J8XA 4WU9C 2CWEA 3VH5T 3X1TC 3WTPA 1ID3C 3W96A 3B6FA 1AOID 5B0ZA 3W99A 3AZEC 3MGSC 3LZ0C 1M1AD 5KDMA 3WA9C 3F6TA 1S32A 5B1MA 4NE6A 4NE3A 2Y2IA 3WAAC 3NQJB 4DRBA 3MGPB 1P3BA 5BS7A 2HIOA 5AVBA 2CV5C 4WNNB 2W8SA 4X23A 4Z66D 1N1JB 2AROC 5AV8D 3AV1A 1KX3A 5B32A 3WKJC 4YM6B 4H9OB 3W98D 2Y2NA 5B2IC 3KWQD 4ZUXB 4H9NB 2G5IC 2YFVA 2NZDA 4Z5TC 1BH8A 5B24B 4R8PA 4HGAC 3LZ1D 3UTBD 3AV2D 3AZFC 2ZM5A 4G91B 5B33D 3UTAB 5CPJB 1M1AC 3C1BA 1B67A 5CPKD 3AYWA 5DNMD 1P3MD 4KUDC 4WU8C 5DNNA 5AV8C 5AY8A 2Y2MA 4LD9B 5GSUC 4WU9A 3X1TA 2DF4C 1ID3A 2F2AC 5FUGB 3O62D 4J8VB 3W98C 3AZEA 3MGSA 3LZ0A 3WA9A 5B0YD 5B40B 4J8UB 3WAAA 2CV5A 4H9RB 2PYOC 3UT9B 3EPLA 2AROA 3AZND 3KUYA 3UTBC 3AV2C 1KX4C 2FJ7C 4UPKA 3WKJA 4H9QA 1H3OA 4YS3D 5CPKC 5JA4A 1WWSA 2IO5B 5AV5C 1P3KA 1HQ3D 1P34C 1P3MC 3X1VC 3A6NB 3KXBD 3REJB 2JCHA 2Y2OA 3REIB 1P3OB 4XUJB 5F99C 1F1EA 3AZFA 5GXQB 5B31B 1EQZD 3B6GD 5BNXA 5G49A 5B0YC 4JJND 1F66D 5GT0D 5B2JC 4KUDA 3AZLD 5JRGB 4QLCB 3MVDB 4WU8A 3FDDA 5AV8A 1TZYB 1HTAA 2YFWA 3V9RB 5GSUA 1P3FC 4CSRA 3REKB 4UUZB 5E5AD 3W98A 2Y2JA 4YS3C 1ZLAD 4XZQB 3REHA 3AFAD 3TU4D 1P3IC 3KXBC 2PYOA 3AN2B 3AZKD 1P3GB 3B0DB 5AV6C 3AV2A 1KX4A 3AZMB 2FJ7A 3MGQB 3B6GC 3X1UD 1F66C 4JJNC 5CPKA 5AV5A 5GT0C 1P34A 1P3MA 2Y2PA 3X1VA 3AZLC 3RELC 1M18B 5CPIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 A;  3LJA B;  4KHA A;  4J8W C;  3AZH D;  5E5A C;  2BYM B;  4G92 B;  4ZUX D;  5B0Y A;  3AFA C;  3TU4 C;  3X1S D;  5B2J A;  2F8N D;  5BNV A;  5CP6 C;  1KU5 A;  1JFI A;  3AZK C;  1P3F A;  3UTA D;  5CPJ D;  3VH6 T;  3X1U C;  4YS3 A;  1P3L B;  3AZJ D;  1U35 B;  1P3I A;  1TAF A;  4LD9 D;  3KXB A;  4KGC C;  2NQB B;  4J8V D;  3AZH C;  2F8N K;  5AV6 A;  1P3P D;  4J8X B;  2RVQ D;  3R45 A;  3WTP B;  3W96 B;  3B6F B;  3B6G A;  5B0Z B;  3W99 B;  1F66 A;  4JJN A;  5GT0 A;  3UT9 D;  3X1S C;  5KDM B;  5GT3 D;  1S32 B;  5B1M B;  3VH6 A;  4E44 A;  3REL A;  3AZL A;  1P3B B;  2HIO B;  5AVB B;  5C3I C;  4X23 B;  4J8W A;  5E5A A;  4EO5 B;  3AV1 B;  1KX3 B;  4Z2M G;  5B32 B;  3AZJ C;  3MNN D;  5B31 G;  3AFA A;  3TU4 A;  3REJ D;  3VH5 A;  3C1C B;  4LD9 C;  5CP6 A;  3MGR C;  4J8V C;  3AZK A;  2YFV B;  1P3P C;  3W97 D;  2RVQ C;  3AZI D;  2NZD B;  1BH8 B;  4R8P B;  1AOI C;  3X1U A;  1M19 D;  5GT3 C;  4QLC D;  3MVD D;  3C1B B;  3AYW B;  1KX5 D;  5BO0 B;  4AWL B;  4KGC A;  4Z66 C;  3AZH A;  5DNN B;  4WU9 B;  3X1T B;  1ID3 B;  5AVC D;  3MNN C;  3KWQ C;  3AZE B;  3MGS B;  3WTP E;  3X1S A;  3LZ0 B;  3REJ C;  3AN2 D;  2F8N A;  3WA9 B;  1P3G D;  3WAA B;  2CV5 B;  3MGQ D;  3W97 C;  3AZI C;  1P3A D;  4WV4 B;  3LZ1 C;  2ARO B;  4H9S C;  3KUY B;  5B33 C;  1M19 C;  3WKJ B;  4H9Q B;  3AZJ A;  5BT1 D;  1H3O B;  4QLC C;  5B2I A;  5DNM C;  1KX5 C;  5JA4 B;  1P3K B;  4LD9 A;  5AV9 D;  3B0B A;  3MGR A;  4J8V A;  4Z5T A;  2JSS A;  1P3P A;  3O62 C;  1AOI A;  5AVC C;  3AZF B;  4ZBJ B;  1M1A A;  5GT3 A;  5BNX B;  4KUD B;  2F8N H;  4Z66 A;  1P3A C;  3AZN C;  4WU8 B;  1P3L D;  2YFW B;  5GSU B;  4CSR B;  1U35 D;  3AZG D;  1ULY A;  3MNN A;  3W98 B;  3KWQ A;  3REJ A;  1HQ3 C;  1BH9 A;  3REH B;  5AV9 C;  4J8X D;  5B1L B;  3W97 A;  3VH6 W;  3WTP D;  4G92 C;  3B0C W;  3AZI A;  2PYO B;  4WZS B;  3LZ1 A;  3UTB A;  3W99 D;  5B0Z D;  4H9S A;  3AV2 B;  1KX4 B;  2FJ7 B;  5B33 A;  1M19 A;  1S32 D;  5B1M D;  3NQU A;  5B32 G;  1EQZ C;  3MGP D;  2HUE C;  4QLC A;  5DNM A;  5CPK B;  1KX5 A;  5AVB D;  5AV5 B;  3V9R A;  1P34 B;  3X1V B;  3VH5 W;  3AV1 D;  1KX3 D;  5B32 D;  5F99 B;  4YM6 D;  2BYK A;  4KHA B;  3O62 A;  3AZG C;  5AVC A;  3LEL B;  3C1C D;  1ZLA C;  4H9P A;  4NE5 A;  5B0Y B;  5B2J B;  5BNV B;  5B24 D;  1Q9C A;  4R8P D;  1P3A A;  1B6W A;  3AZN A;  1A7W A;  4CAY A;  1P3F B;  2LY8 A;  3MGP C;  4YS3 B;  5AVB C;  1HQ3 A;  5AV9 A;  1P3I B;  1TAF B;  3KXB B;  4YM6 C;  5AV6 B;  3KSY A;  3MGS D;  3C1C C;  3WA9 D;  4ZUX C;  5B40 D;  4J8U D;  1EQZ A;  3B6G B;  3WAA D;  1F66 B;  4JJN B;  2CV5 D;  5GT0 B;  5B24 C;  3AZL B;  3REL B;  2L5A A;  3KUY D;  3UTA C;  4G91 C;  5CPJ C;  4J8W B;  3AZG A;  1ZLA A;  1P3K D;  4AWL C;  3A6N D;  3AFA B;  3TU4 B;  3REI D;  1P3O D;  4XUJ D;  5CP6 B;  3AZK B;  3AZF D;  5GXQ D;  5B31 D;  4J8U C;  5B40 C;  3NQJ A;  3MGP A;  3X1U B;  4KUD D;  3UT9 C;  4WNN A;  5JRG D;  1N1J A;  4WU8 D;  1TZY D;  3KUY C;  5GSU D;  3REK D;  4KGC B;  1WWI A;  4YM6 A;  4H9O A;  3AZH B;  5AY8 B;  2IO5 C;  4XZQ D;  3C1C A;  1P3K C;  4ZUX A;  4H9N A;  4NFT A;  3REH D;  4E45 A;  3A6N C;  5B1L D;  3REI C;  3X1S B;  4XUJ C;  1P3O C;  2F8N B;  2PYO D;  5B24 A;  1KX4 D;  4DRA A;  3AZM D;  2FJ7 D;  3UTA A;  5CPJ A;  5C3I B;  4ZBJ C;  5GXQ C;  5B31 C;  5AV5 D;  5BO0 A;  1P34 D;  5JRG C;  3X1V D;  3AZJ B;  3MVD C;  1M18 D;  5CPI D;  5B2I B;  1TZY C;  3LJA D;  5F99 D;  3REK C;  5FUG A;  3MGR B;  4Z5T B;  1BFM A;  3LEL D;  1P3P B;  4XZQ C;  4HGA B;  5B40 A;  4J8U A;  3REH C;  1AOI B;  4H9R A;  5B2J D;  3UT9 A;  1M1A B;  5B1L C;  3AN2 C;  5GT3 B;  5G49 B;  1P3G C;  3B0D C;  3AZM C;  1P3F D;  3MGQ C;  4Z66 B;  5AV8 B;  5BT1 C;  3A6N A;  3MNN B;  1P3I D;  1M18 C;  5CPI C;  3KWQ B;  2NQB D;  3REI A;  1P3O A;  4XUJ A;  3LJA C;  1BH9 B;  5AV6 D;  3LEL C;  3W97 B;  3W96 D;  3AZI B;  5GXQ A;  5B31 A;  3B6F D;  3LZ1 B;  3UTB B;  5B33 B;  1M19 B;  5JRG A;  3NQU B;  3MVD A;  3REL D;  1P3B D;  2HIO D;  5DNM B;  1TZY A;  1KX5 B;  1P3M B;  4X23 D;  3REK A;  4J8W D;  4UUZ A;  1P3L C;  4XZQ A;  1U35 C;  2BYK B;  3O62 B;  5AVC B;  4H9P B;  5B1L A;  3AN2 A;  2NQB C;  5CP6 D;  1R4V A;  1P3G A;  2NZD D;  4J8X C;  3AZM A;  3MGQ A;  3WTP C;  3W96 C;  3B6F C;  1P3A B;  1JFI B;  3W99 C;  5CHL B;  5B0Z C;  4Z2M H;  3AZN B;  4CAY B;  3C1B D;  1S32 C;  5B1M C;  3AYW D;  1P3B C;  1M18 A;  5BS7 C;  2HIO C;  5CPI A;  4KGC D;  1HQ3 B;  4X23 C;  3LJA A;  2F8N G;  5AV9 B;  4EO5 C;  5DNN D;  5AY8 D;  3AV1 C;  1KX3 C;  4WU9 D;  3X1T D;  2BYM A;  1ID3 D;  3LEL A;  5B32 C;  3AZE D;  3R45 B;  3LZ0 D;  1EQZ B;  2HUE B;  2NZD C;  2ARO D;  4R8P C;  3B0C T;  1P3L A;  3WKJ D;  1U35 A;  5E5A B;  3C1B C;  3AZG B;  5B2I D;  3AYW C;  1ZLA B;  2NQB A;  3MGR D;  4M6B A;  5DNN C;  4Z5T D;  5AY8 C;  4J8X A;  4WU9 C;  2CWE A;  3VH5 T;  3X1T C;  3WTP A;  1ID3 C;  3W96 A;  3B6F A;  1AOI D;  5B0Z A;  3W99 A;  3AZE C;  3MGS C;  3LZ0 C;  1M1A D;  5KDM A;  3WA9 C;  1S32 A;  5B1M A;  4NE6 A;  4NE3 A;  3WAA C;  3NQJ B;  4DRB A;  3MGP B;  1P3B A;  5BS7 A;  2HIO A;  5AVB A;  2CV5 C;  4WNN B;  4X23 A;  4Z66 D;  1N1J B;  2ARO C;  5AV8 D;  3AV1 A;  1KX3 A;  5B32 A;  3WKJ C;  4YM6 B;  4H9O B;  3W98 D;  3KWQ D;  5B2I C;  4ZUX B;  4H9N B;  2YFV A;  2NZD A;  4Z5T C;  1BH8 A;  5B24 B;  4R8P A;  4HGA C;  3LZ1 D;  3UTB D;  3AV2 D;  3AZF C;  3UTA B;  4G91 B;  5B33 D;  5CPJ B;  1M1A C;  3C1B A;  1B67 A;  5CPK D;  3AYW A;  5DNM D;  1P3M D;  4KUD C;  4WU8 C;  5DNN A;  5AV8 C;  5AY8 A;  4LD9 B;  5GSU C;  4WU9 A;  3X1T A;  1ID3 A;  5FUG B;  3O62 D;  4J8V B;  3W98 C;  3AZE A;  3MGS A;  3LZ0 A;  3WA9 A;  5B0Y D;  5B40 B;  4J8U B;  3WAA A;  2CV5 A;  4H9R B;  2PYO C;  3UT9 B;  2ARO A;  3AZN D;  3KUY A;  3UTB C;  3AV2 C;  1KX4 C;  2FJ7 C;  3WKJ A;  4H9Q A;  1H3O A;  4YS3 D;  5CPK C;  5JA4 A;  1WWS A;  2IO5 B;  5AV5 C;  1P3K A;  1HQ3 D;  1P34 C;  1P3M C;  3X1V C;  3A6N B;  3KXB D;  3REJ B;  3REI B;  1P3O B;  4XUJ B;  5F99 C;  1F1E A;  3AZF A;  5GXQ B;  5B31 B;  1EQZ D;  3B6G D;  5BNX A;  5G49 A;  5B0Y C;  4JJN D;  1F66 D;  5GT0 D;  5B2J C;  4KUD A;  3AZL D;  5JRG B;  4QLC B;  3MVD B;  4WU8 A;  5AV8 A;  1TZY B;  1HTA A;  2YFW A;  3V9R B;  5GSU A;  1P3F C;  4CSR A;  3REK B;  4UUZ B;  5E5A D;  3W98 A;  4YS3 C;  1ZLA D;  4XZQ B;  3REH A;  3AFA D;  3TU4 D;  1P3I C;  3KXB C;  2PYO A;  3AN2 B;  3AZK D;  1P3G B;  3B0D B;  5AV6 C;  3AV2 A;  1KX4 A;  3AZM B;  2FJ7 A;  3MGQ B;  3B6G C;  3X1U D;  1F66 C;  4JJN C;  5CPK A;  5AV5 A;  5GT0 C;  1P34 A;  1P3M A;  3X1V A;  3AZL C;  3REL C;  1M18 B;  5CPI B; 
#chains in the Genus database with same CATH topology
 5F99 A;  3LJA B;  4KHA A;  4J8W C;  3AZH D;  5E5A C;  2BYM B;  4G92 B;  4ZUX D;  5B0Y A;  3AFA C;  3TU4 C;  3X1S D;  5B2J A;  2F8N D;  5BNV A;  5CP6 C;  1KU5 A;  1JFI A;  3AZK C;  1P3F A;  3UTA D;  5CPJ D;  1PZR A;  3VH6 T;  3X1U C;  4YS3 A;  1P3L B;  2ZY2 A;  3AZJ D;  1U35 B;  1P3I A;  1TAF A;  4LD9 D;  3KXB A;  4KGC C;  2NQB B;  4J8V D;  3AZH C;  3EPK A;  2F8N K;  5AV6 A;  1P3P D;  4J8X B;  2RVQ D;  3R45 A;  3WTP B;  3W96 B;  3B6F B;  3B6G A;  2RIQ A;  5B0Z B;  1F66 A;  4JJN A;  3W99 B;  5GT0 A;  3UT9 D;  3X1S C;  5KDM B;  5GT3 D;  1S32 B;  5B1M B;  3VH6 A;  4E44 A;  3REL A;  3H0R C;  3AZL A;  1P3B B;  2HIO B;  5AVB B;  5C3I C;  4X23 B;  4J8W A;  5E5A A;  4EO5 B;  3AV1 B;  1KX3 B;  4Z2M G;  2XD5 A;  5B32 B;  3AZJ C;  3MNN D;  5B31 G;  3AFA A;  3TU4 A;  3REJ D;  3VH5 A;  3C1C B;  4LD9 C;  5CP6 A;  3MGR C;  4J8V C;  3AZK A;  2YFV B;  1P3P C;  3W97 D;  2RVQ C;  3AZI D;  2NZD B;  1BH8 B;  4R8P B;  1AOI C;  3X1U A;  3IP4 C;  1M19 D;  5GT3 C;  2Y2K A;  4QLC D;  3MVD D;  3C1B B;  3AYW B;  1KX5 D;  5BO0 B;  4AWL B;  4KGC A;  2Y2H A;  4Z66 C;  3AZH A;  5DNN B;  4WU9 B;  3X1T B;  1ID3 B;  5AVC D;  2ZY5 A;  3MNN C;  3KWQ C;  3AZE B;  3MGS B;  3WTP E;  3X1S A;  3LZ0 B;  3REJ C;  3AN2 D;  2F8N A;  3WA9 B;  1P3G D;  3WAA B;  1T3U A;  2CV5 B;  3MGQ D;  3W97 C;  3AZI C;  1P3A D;  4WV4 B;  3LZ1 C;  2ARO B;  4H9S C;  3KUY B;  5B33 C;  1M19 C;  3WKJ B;  4H9Q B;  3AZJ A;  5BT1 D;  1H3O B;  4QLC C;  5B2I A;  5DNM C;  1KX5 C;  5JA4 B;  1P3K B;  4LD9 A;  5AV9 D;  3B0B A;  3MGR A;  4J8V A;  4Z5T A;  2JSS A;  1P3P A;  2J8P A;  3O62 C;  1AOI A;  5AVC C;  3AZF B;  2XD1 A;  2UWX A;  4ZBJ B;  1M1A A;  5GT3 A;  5BNX B;  4KUD B;  2F8N H;  4Z66 A;  1P3A C;  3AZN C;  4WU8 B;  1P3L D;  2YFW B;  5GSU B;  4CSR B;  1U35 D;  3AZG D;  1ULY A;  3MNN A;  3W98 B;  3KWQ A;  3REJ A;  1HQ3 C;  1BH9 A;  3REH B;  5AV9 C;  4J8X D;  5B1L B;  3W97 A;  3VH6 W;  3WTP D;  4G92 C;  3B0C W;  3AZI A;  2PYO B;  4WZS B;  3LZ1 A;  3UTB A;  3W99 D;  5B0Z D;  4H9S A;  3AV2 B;  1KX4 B;  2FJ7 B;  5B33 A;  1M19 A;  1S32 D;  5B1M D;  3NQU A;  5B32 G;  1EQZ C;  3MGP D;  2HUE C;  4QLC A;  5DNM A;  5CPK B;  1KX5 A;  5AVB D;  5AV5 B;  3V9R A;  1P34 B;  3X1V B;  3VH5 W;  3AV1 D;  1KX3 D;  4WJ3 C;  5B32 D;  5F99 B;  4YM6 D;  2BYK A;  4KHA B;  3AL0 C;  3O62 A;  3AZG C;  5AVC A;  3LEL B;  3C1C D;  1ZLA C;  4H9P A;  1W2E A;  4NE5 A;  5B0Y B;  5B2J B;  5BNV B;  5B24 D;  1Q9C A;  4R8P D;  1P3A A;  1B6W A;  3AZN A;  1A7W A;  4CAY A;  1P3F B;  2DQN C;  2LY8 A;  3MGP C;  4YS3 B;  5AVB C;  1HQ3 A;  5AV9 A;  3A1K A;  1P3I B;  1TAF B;  3KXB B;  4YM6 C;  5AV6 B;  3KSY A;  3MGS D;  3C1C C;  3WA9 D;  4ZUX C;  5B40 D;  4J8U D;  1EQZ A;  3B6G B;  3WAA D;  1F66 B;  4JJN B;  2CV5 D;  5GT0 B;  5B24 C;  3AZL B;  3REL B;  2L5A A;  3KUY D;  3UTA C;  4G91 C;  5CPJ C;  3P5J B;  4J8W B;  3AZG A;  1ZLA A;  1P3K D;  4AWL C;  3A6N D;  3AFA B;  3TU4 B;  3REI D;  1P3O D;  4XUJ D;  5CP6 B;  3AZK B;  3AZF D;  5GXQ D;  5B31 D;  4J8U C;  5B40 C;  3NQJ A;  3MGP A;  3X1U B;  4KUD D;  3UT9 C;  4WNN A;  5JRG D;  1N1J A;  3EPJ A;  4WU8 D;  1TZY D;  3KUY C;  5GSU D;  3REK D;  4KGC B;  2Y2Q A;  1WWI A;  4YM6 A;  4H9O A;  3AZH B;  5AY8 B;  2IO5 C;  4XZQ D;  3C1C A;  1P3K C;  4ZUX A;  4H9N A;  4NFT A;  3REH D;  2FFF B;  4E45 A;  3A6N C;  5B1L D;  3REI C;  3X1S B;  4XUJ C;  1P3O C;  2F8N B;  2PYO D;  5B24 A;  1KX4 D;  4DRA A;  3AZM D;  2FJ7 D;  3UTA A;  5CPJ A;  5C3I B;  4ZBJ C;  5GXQ C;  5B31 C;  2Y2G A;  5AV5 D;  5BO0 A;  1P34 D;  5JRG C;  3X1V D;  3AZJ B;  3MVD C;  1M18 D;  5CPI D;  5B2I B;  1TZY C;  3LJA D;  5F99 D;  3REK C;  5FUG A;  3MGR B;  4Z5T B;  1BFM A;  3LEL D;  1P3P B;  4XZQ C;  4HGA B;  2BG1 A;  5B40 A;  4J8U A;  4DQY B;  3REH C;  3EG5 B;  1AOI B;  4H9R A;  5B2J D;  3UT9 A;  1M1A B;  5B1L C;  3AN2 C;  5GT3 B;  5G49 B;  1P3G C;  3B0D C;  3AZM C;  1P3F D;  3MGQ C;  4Z66 B;  5AV8 B;  5BT1 C;  3A6N A;  3MNN B;  1P3I D;  1M18 C;  2Y2L A;  5CPI C;  3KWQ B;  2NQB D;  3REI A;  1P3O A;  1Z2C B;  4XUJ A;  3LJA C;  1BH9 B;  5AV6 D;  3EPH A;  3LEL C;  3W97 B;  3W96 D;  3AZI B;  5GXQ A;  5B31 A;  3B6F D;  3LZ1 B;  3UTB B;  5B33 B;  1M19 B;  5JRG A;  3NQU B;  3MVD A;  3REL D;  1P3B D;  2HIO D;  5DNM B;  3KFU G;  1TZY A;  1KX5 B;  1P3M B;  4X23 D;  3REK A;  4J8W D;  4UUZ A;  1P3L C;  4XZQ A;  1U35 C;  2BYK B;  3O62 B;  5AVC B;  4H9P B;  5B1L A;  3AN2 A;  2NQB C;  2ZY3 A;  5CP6 D;  1R4V A;  1P3G A;  2NZD D;  4J8X C;  3AZM A;  3MGQ A;  3WTP C;  3W96 C;  3B6F C;  1P3A B;  1JFI B;  3W99 C;  5CHL B;  5B0Z C;  4Z2M H;  3AZN B;  4CAY B;  3C1B D;  1S32 C;  5B1M C;  3AYW D;  1P3B C;  1M18 A;  2ZY4 A;  2HIO C;  5BS7 C;  5CPI A;  4KGC D;  1HQ3 B;  4X23 C;  3LJA A;  2F8N G;  2G5H C;  5AV9 B;  5DNN D;  4EO5 C;  5AY8 D;  3AV1 C;  3A1I A;  4WU9 D;  1KX3 C;  3X1T D;  2BYM A;  1ID3 D;  3LEL A;  5B32 C;  3AZE D;  2JE5 A;  3R45 B;  3LZ0 D;  1EQZ B;  2VQR A;  2HUE B;  2NZD C;  2ARO D;  4R8P C;  3B0C T;  1P3L A;  3WKJ D;  1U35 A;  5E5A B;  3C1B C;  3AZG B;  5B2I D;  3AYW C;  1ZLA B;  2NQB A;  3H0M C;  3MGR D;  3H0L C;  4M6B A;  5DNN C;  4Z5T D;  5AY8 C;  4J8X A;  4WU9 C;  2CWE A;  3VH5 T;  3X1T C;  3WTP A;  1ID3 C;  3W96 A;  3B6F A;  1AOI D;  5B0Z A;  3W99 A;  3AZE C;  3MGS C;  3LZ0 C;  1M1A D;  5KDM A;  3WA9 C;  3F6T A;  1S32 A;  5B1M A;  4NE6 A;  4NE3 A;  2Y2I A;  3WAA C;  3NQJ B;  4DRB A;  3MGP B;  1P3B A;  5BS7 A;  2HIO A;  5AVB A;  2CV5 C;  4WNN B;  2W8S A;  4X23 A;  4Z66 D;  1N1J B;  2ARO C;  5AV8 D;  3AV1 A;  1KX3 A;  5B32 A;  3WKJ C;  4YM6 B;  4H9O B;  3W98 D;  2Y2N A;  5B2I C;  3KWQ D;  4ZUX B;  4H9N B;  2G5I C;  2YFV A;  2NZD A;  4Z5T C;  1BH8 A;  5B24 B;  4R8P A;  4HGA C;  3LZ1 D;  3UTB D;  3AV2 D;  3AZF C;  2ZM5 A;  4G91 B;  5B33 D;  3UTA B;  5CPJ B;  1M1A C;  3C1B A;  1B67 A;  5CPK D;  3AYW A;  5DNM D;  1P3M D;  4KUD C;  4WU8 C;  5DNN A;  5AV8 C;  5AY8 A;  2Y2M A;  4LD9 B;  5GSU C;  4WU9 A;  3X1T A;  2DF4 C;  1ID3 A;  2F2A C;  5FUG B;  3O62 D;  4J8V B;  3W98 C;  3AZE A;  3MGS A;  3LZ0 A;  3WA9 A;  5B0Y D;  5B40 B;  4J8U B;  3WAA A;  2CV5 A;  4H9R B;  2PYO C;  3UT9 B;  3EPL A;  2ARO A;  3AZN D;  3KUY A;  3UTB C;  3AV2 C;  1KX4 C;  2FJ7 C;  4UPK A;  3WKJ A;  4H9Q A;  1H3O A;  4YS3 D;  5CPK C;  5JA4 A;  1WWS A;  2IO5 B;  5AV5 C;  1P3K A;  1HQ3 D;  1P34 C;  1P3M C;  3X1V C;  3A6N B;  3KXB D;  3REJ B;  2JCH A;  2Y2O A;  3REI B;  1P3O B;  4XUJ B;  5F99 C;  1F1E A;  3AZF A;  5GXQ B;  5B31 B;  1EQZ D;  3B6G D;  5BNX A;  5G49 A;  5B0Y C;  4JJN D;  1F66 D;  5GT0 D;  5B2J C;  4KUD A;  3AZL D;  5JRG B;  4QLC B;  3MVD B;  4WU8 A;  3FDD A;  5AV8 A;  1TZY B;  1HTA A;  2YFW A;  3V9R B;  5GSU A;  1P3F C;  4CSR A;  3REK B;  4UUZ B;  5E5A D;  3W98 A;  2Y2J A;  4YS3 C;  1ZLA D;  4XZQ B;  3REH A;  3AFA D;  3TU4 D;  1P3I C;  3KXB C;  2PYO A;  3AN2 B;  3AZK D;  1P3G B;  3B0D B;  5AV6 C;  3AV2 A;  1KX4 A;  3AZM B;  2FJ7 A;  3MGQ B;  3B6G C;  3X1U D;  1F66 C;  4JJN C;  5CPK A;  5AV5 A;  5GT0 C;  1P34 A;  1P3M A;  2Y2P A;  3X1V A;  3AZL C;  3REL C;  1M18 B;  5CPI B; 
#chains in the Genus database with same CATH homology
 5F99 A;  3LJA B;  4KHA A;  4J8W C;  3AZH D;  5E5A C;  2BYM B;  4G92 B;  4ZUX D;  5B0Y A;  3AFA C;  3TU4 C;  3X1S D;  5B2J A;  2F8N D;  5BNV A;  5CP6 C;  1KU5 A;  1JFI A;  3AZK C;  1P3F A;  3UTA D;  5CPJ D;  1PZR A;  3VH6 T;  3X1U C;  4YS3 A;  1P3L B;  2ZY2 A;  3AZJ D;  1U35 B;  1P3I A;  1TAF A;  4LD9 D;  3KXB A;  4KGC C;  2NQB B;  4J8V D;  3AZH C;  3EPK A;  2F8N K;  5AV6 A;  1P3P D;  4J8X B;  2RVQ D;  3R45 A;  3WTP B;  3W96 B;  3B6F B;  3B6G A;  2RIQ A;  5B0Z B;  1F66 A;  4JJN A;  3W99 B;  5GT0 A;  3UT9 D;  3X1S C;  5KDM B;  5GT3 D;  1S32 B;  5B1M B;  3VH6 A;  4E44 A;  3REL A;  3H0R C;  3AZL A;  1P3B B;  2HIO B;  5AVB B;  5C3I C;  4X23 B;  4J8W A;  5E5A A;  4EO5 B;  3AV1 B;  1KX3 B;  4Z2M G;  2XD5 A;  5B32 B;  3AZJ C;  3MNN D;  5B31 G;  3AFA A;  3TU4 A;  3REJ D;  3VH5 A;  3C1C B;  4LD9 C;  5CP6 A;  3MGR C;  4J8V C;  3AZK A;  2YFV B;  1P3P C;  3W97 D;  2RVQ C;  3AZI D;  2NZD B;  1BH8 B;  4R8P B;  1AOI C;  3X1U A;  3IP4 C;  1M19 D;  5GT3 C;  2Y2K A;  4QLC D;  3MVD D;  3C1B B;  3AYW B;  1KX5 D;  5BO0 B;  4AWL B;  4KGC A;  2Y2H A;  4Z66 C;  3AZH A;  5DNN B;  4WU9 B;  3X1T B;  1ID3 B;  5AVC D;  2ZY5 A;  3MNN C;  3KWQ C;  3AZE B;  3MGS B;  3WTP E;  3X1S A;  3LZ0 B;  3REJ C;  3AN2 D;  2F8N A;  3WA9 B;  1P3G D;  3WAA B;  1T3U A;  2CV5 B;  3MGQ D;  3W97 C;  3AZI C;  1P3A D;  4WV4 B;  3LZ1 C;  2ARO B;  4H9S C;  3KUY B;  5B33 C;  1M19 C;  3WKJ B;  4H9Q B;  3AZJ A;  5BT1 D;  1H3O B;  4QLC C;  5B2I A;  5DNM C;  1KX5 C;  5JA4 B;  1P3K B;  4LD9 A;  5AV9 D;  3B0B A;  3MGR A;  4J8V A;  4Z5T A;  2JSS A;  1P3P A;  2J8P A;  3O62 C;  1AOI A;  5AVC C;  3AZF B;  2XD1 A;  2UWX A;  4ZBJ B;  1M1A A;  5GT3 A;  5BNX B;  4KUD B;  2F8N H;  4Z66 A;  1P3A C;  3AZN C;  4WU8 B;  1P3L D;  2YFW B;  5GSU B;  4CSR B;  1U35 D;  3AZG D;  1ULY A;  3MNN A;  3W98 B;  3KWQ A;  3REJ A;  1HQ3 C;  1BH9 A;  3REH B;  5AV9 C;  4J8X D;  5B1L B;  3W97 A;  3VH6 W;  3WTP D;  4G92 C;  3B0C W;  3AZI A;  2PYO B;  4WZS B;  3LZ1 A;  3UTB A;  3W99 D;  5B0Z D;  4H9S A;  3AV2 B;  1KX4 B;  2FJ7 B;  5B33 A;  1M19 A;  1S32 D;  5B1M D;  3NQU A;  5B32 G;  1EQZ C;  3MGP D;  2HUE C;  4QLC A;  5DNM A;  5CPK B;  1KX5 A;  5AVB D;  5AV5 B;  3V9R A;  1P34 B;  3X1V B;  3VH5 W;  3AV1 D;  1KX3 D;  4WJ3 C;  5B32 D;  5F99 B;  4YM6 D;  2BYK A;  4KHA B;  3AL0 C;  3O62 A;  3AZG C;  5AVC A;  3LEL B;  3C1C D;  1ZLA C;  4H9P A;  1W2E A;  4NE5 A;  5B0Y B;  5B2J B;  5BNV B;  5B24 D;  1Q9C A;  4R8P D;  1P3A A;  1B6W A;  3AZN A;  1A7W A;  4CAY A;  1P3F B;  2DQN C;  2LY8 A;  3MGP C;  4YS3 B;  5AVB C;  1HQ3 A;  5AV9 A;  3A1K A;  1P3I B;  1TAF B;  3KXB B;  4YM6 C;  5AV6 B;  3KSY A;  3MGS D;  3C1C C;  3WA9 D;  4ZUX C;  5B40 D;  4J8U D;  1EQZ A;  3B6G B;  3WAA D;  1F66 B;  4JJN B;  2CV5 D;  5GT0 B;  5B24 C;  3AZL B;  3REL B;  2L5A A;  3KUY D;  3UTA C;  4G91 C;  5CPJ C;  3P5J B;  4J8W B;  3AZG A;  1ZLA A;  1P3K D;  4AWL C;  3A6N D;  3AFA B;  3TU4 B;  3REI D;  1P3O D;  4XUJ D;  5CP6 B;  3AZK B;  3AZF D;  5GXQ D;  5B31 D;  4J8U C;  5B40 C;  3NQJ A;  3MGP A;  3X1U B;  4KUD D;  3UT9 C;  4WNN A;  5JRG D;  1N1J A;  3EPJ A;  4WU8 D;  1TZY D;  3KUY C;  5GSU D;  3REK D;  4KGC B;  2Y2Q A;  1WWI A;  4YM6 A;  4H9O A;  3AZH B;  5AY8 B;  2IO5 C;  4XZQ D;  3C1C A;  1P3K C;  4ZUX A;  4H9N A;  4NFT A;  3REH D;  2FFF B;  4E45 A;  3A6N C;  5B1L D;  3REI C;  3X1S B;  4XUJ C;  1P3O C;  2F8N B;  2PYO D;  5B24 A;  1KX4 D;  4DRA A;  3AZM D;  2FJ7 D;  3UTA A;  5CPJ A;  5C3I B;  4ZBJ C;  5GXQ C;  5B31 C;  2Y2G A;  5AV5 D;  5BO0 A;  1P34 D;  5JRG C;  3X1V D;  3AZJ B;  3MVD C;  1M18 D;  5CPI D;  5B2I B;  1TZY C;  3LJA D;  5F99 D;  3REK C;  5FUG A;  3MGR B;  4Z5T B;  1BFM A;  3LEL D;  1P3P B;  4XZQ C;  4HGA B;  2BG1 A;  5B40 A;  4J8U A;  4DQY B;  3REH C;  3EG5 B;  1AOI B;  4H9R A;  5B2J D;  3UT9 A;  1M1A B;  5B1L C;  3AN2 C;  5GT3 B;  5G49 B;  1P3G C;  3B0D C;  3AZM C;  1P3F D;  3MGQ C;  4Z66 B;  5AV8 B;  5BT1 C;  3A6N A;  3MNN B;  1P3I D;  1M18 C;  2Y2L A;  5CPI C;  3KWQ B;  2NQB D;  3REI A;  1P3O A;  1Z2C B;  4XUJ A;  3LJA C;  1BH9 B;  5AV6 D;  3EPH A;  3LEL C;  3W97 B;  3W96 D;  3AZI B;  5GXQ A;  5B31 A;  3B6F D;  3LZ1 B;  3UTB B;  5B33 B;  1M19 B;  5JRG A;  3NQU B;  3MVD A;  3REL D;  1P3B D;  2HIO D;  5DNM B;  3KFU G;  1TZY A;  1KX5 B;  1P3M B;  4X23 D;  3REK A;  4J8W D;  4UUZ A;  1P3L C;  4XZQ A;  1U35 C;  2BYK B;  3O62 B;  5AVC B;  4H9P B;  5B1L A;  3AN2 A;  2NQB C;  2ZY3 A;  5CP6 D;  1R4V A;  1P3G A;  2NZD D;  4J8X C;  3AZM A;  3MGQ A;  3WTP C;  3W96 C;  3B6F C;  1P3A B;  1JFI B;  3W99 C;  5CHL B;  5B0Z C;  4Z2M H;  3AZN B;  4CAY B;  3C1B D;  1S32 C;  5B1M C;  3AYW D;  1P3B C;  1M18 A;  2ZY4 A;  2HIO C;  5BS7 C;  5CPI A;  4KGC D;  1HQ3 B;  4X23 C;  3LJA A;  2F8N G;  2G5H C;  5AV9 B;  5DNN D;  4EO5 C;  5AY8 D;  3AV1 C;  3A1I A;  4WU9 D;  1KX3 C;  3X1T D;  2BYM A;  1ID3 D;  3LEL A;  5B32 C;  3AZE D;  2JE5 A;  3R45 B;  3LZ0 D;  1EQZ B;  2VQR A;  2HUE B;  2NZD C;  2ARO D;  4R8P C;  3B0C T;  1P3L A;  3WKJ D;  1U35 A;  5E5A B;  3C1B C;  3AZG B;  5B2I D;  3AYW C;  1ZLA B;  2NQB A;  3H0M C;  3MGR D;  3H0L C;  4M6B A;  5DNN C;  4Z5T D;  5AY8 C;  4J8X A;  4WU9 C;  2CWE A;  3VH5 T;  3X1T C;  3WTP A;  1ID3 C;  3W96 A;  3B6F A;  1AOI D;  5B0Z A;  3W99 A;  3AZE C;  3MGS C;  3LZ0 C;  1M1A D;  5KDM A;  3WA9 C;  3F6T A;  1S32 A;  5B1M A;  4NE6 A;  4NE3 A;  2Y2I A;  3WAA C;  3NQJ B;  4DRB A;  3MGP B;  1P3B A;  5BS7 A;  2HIO A;  5AVB A;  2CV5 C;  4WNN B;  2W8S A;  4X23 A;  4Z66 D;  1N1J B;  2ARO C;  5AV8 D;  3AV1 A;  1KX3 A;  5B32 A;  3WKJ C;  4YM6 B;  4H9O B;  3W98 D;  2Y2N A;  5B2I C;  3KWQ D;  4ZUX B;  4H9N B;  2G5I C;  2YFV A;  2NZD A;  4Z5T C;  1BH8 A;  5B24 B;  4R8P A;  4HGA C;  3LZ1 D;  3UTB D;  3AV2 D;  3AZF C;  2ZM5 A;  4G91 B;  5B33 D;  3UTA B;  5CPJ B;  1M1A C;  3C1B A;  1B67 A;  5CPK D;  3AYW A;  5DNM D;  1P3M D;  4KUD C;  4WU8 C;  5DNN A;  5AV8 C;  5AY8 A;  2Y2M A;  4LD9 B;  5GSU C;  4WU9 A;  3X1T A;  2DF4 C;  1ID3 A;  2F2A C;  5FUG B;  3O62 D;  4J8V B;  3W98 C;  3AZE A;  3MGS A;  3LZ0 A;  3WA9 A;  5B0Y D;  5B40 B;  4J8U B;  3WAA A;  2CV5 A;  4H9R B;  2PYO C;  3UT9 B;  3EPL A;  2ARO A;  3AZN D;  3KUY A;  3UTB C;  3AV2 C;  1KX4 C;  2FJ7 C;  4UPK A;  3WKJ A;  4H9Q A;  1H3O A;  4YS3 D;  5CPK C;  5JA4 A;  1WWS A;  2IO5 B;  5AV5 C;  1P3K A;  1HQ3 D;  1P34 C;  1P3M C;  3X1V C;  3A6N B;  3KXB D;  3REJ B;  2JCH A;  2Y2O A;  3REI B;  1P3O B;  4XUJ B;  5F99 C;  1F1E A;  3AZF A;  5GXQ B;  5B31 B;  1EQZ D;  3B6G D;  5BNX A;  5G49 A;  5B0Y C;  4JJN D;  1F66 D;  5GT0 D;  5B2J C;  4KUD A;  3AZL D;  5JRG B;  4QLC B;  3MVD B;  4WU8 A;  3FDD A;  5AV8 A;  1TZY B;  1HTA A;  2YFW A;  3V9R B;  5GSU A;  1P3F C;  4CSR A;  3REK B;  4UUZ B;  5E5A D;  3W98 A;  2Y2J A;  4YS3 C;  1ZLA D;  4XZQ B;  3REH A;  3AFA D;  3TU4 D;  1P3I C;  3KXB C;  2PYO A;  3AN2 B;  3AZK D;  1P3G B;  3B0D B;  5AV6 C;  3AV2 A;  1KX4 A;  3AZM B;  2FJ7 A;  3MGQ B;  3B6G C;  3X1U D;  1F66 C;  4JJN C;  5CPK A;  5AV5 A;  5GT0 C;  1P34 A;  1P3M A;  2Y2P A;  3X1V A;  3AZL C;  3REL C;  1M18 B;  5CPI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...