5B0YB

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yB00
2NQBA 3VH5A 3B0CT 3AZKA 5F99A 4QLCD 1S32C 3AZLD 1P3IA 3MGQB 1P3FD 5GSUA 5B0ZD 3C1CA 4NE5A 5AV8A 1N1JA 5AVCB 3UT9B 3AN2C 1M1AC 3REKC 3TU4C 5FUGB 1F66C 5E5AD 3X1UC 3AZJB 1ZLAA 3AZGB 4HGAB 1ULYA 3O62C 1U35D 1JFIA 2HUEB 4R8PD 4J8VD 3X1VD 1AOIC 5B2IC 3MGSB 3VH6A 5BNXA 4QLCB 1P3MC 4XZQC 3REJA 4J8WA 5B33D 5DNMA 5B2JA 3MVDA 5B40C 1M18C 3KUYA 1R4VA 3AZHD 1P3BC 3B0CW 5CPIC 4JJNC 3R45B 4ZUXC 1U35B 1BFMA 5GXQC 3B6GC 3X1SA 1WWSA 3UTBD 5CPKC 3AV1B 3AZMC 5B24A 1WWIA 5DNND 3AFAD 5JA4B 3W96A 3REHA 1ID3D 3B6FC 3LZ0A 5CHLB 1TZYC 3AZHB 1P3LB 5B2IB 3LJAD 3AZNA 1P3GC 3AZFB 4G91B 2F8NA 5BS7C 5JRGB 4Z66D 3KWQB 3MNND 3UTBB 1S32A 5GT3C 3UTAC 5DNNB 3MGRD 5AV5D 3WA9D 4H9OB 5CP6D 5AV6C 3LELB 1ID3B 4ZUXB 1EQZD 3AN2A 4Z5TC 1M1AA 3REKA 3TU4A 3KXBD 1F66A 1HQ3C 1KX3D 3WAAB 3X1UA 4WZSB 3RELD 5B32D 5AV9D 3WTPE 3O62A 3LZ1B 5B31C 4WU8B 1AOIA 4H9NA 2NQBD 5B2IA 4WV4B 5B1MD 3A6NC 3AZKD 5F99D 1P3MA 1KX5B 4XZQA 4LD9B 4NE3A 5CPJB 2HIOC 5GSUD 5CP6B 3C1CD 1M19D 5B40A 1M18A 1EQZB 1P3BA 3VH5T 2IO5B 5CPIA 3REID 3RELB 1P3AB 5B32B 3W98C 1ZLAD 3V9RA 4JJNA 4ZUXA 3UTAB 5GXQA 3X1TC 2NQBB 3B6GA 3AZKB 5F99B 5CPKA 4X23C 3WTPC 3MGPC 3AZMA 3REJD 1P3IB 4G92B 4AWLB 3B0BA 5BT1C 5GSUB 2YFWA 3C1CB 5AV8B 1N1JB 5AY8C 3B6FA 4CAYA 3KUYD 1TZYA 3MGQD 5B0YC 3W97C 1KX4C 3AZIC 4DRBA 1P3GA 1ZLAB 1JFIB 4EO5B 4E44A 5C3IB 1P34C 4KHAA 5BS7A 2NZDC 5BO0A 3X1SD 3AZJD 4YM6C 3AZGD 5GT3A 3REJB 3VH5W 3UTAA 4J8WB 5AV6A 5B2JB 3MGSD 5DNMB 3REHD 3MVDB 2CV5C 3W96D 3KUYB 1P3KC 4Z5TA 2RVQC 3B0DC 1HQ3A 1B6WA 3AZND 5AVBC 2F8ND 5B31A 3AZLC 3X1SB 1P3FC 5AY8B 3A6NA 4NE6A 5B0ZC 4J8UC 1S32D 3AZEC 2AROC 1P3OC 3VH6W 2HIOA 5B24B 4YS3C 3REHB 3W96B 5E5AC 3LZ0B 3AV1D 1M1AD 4KUDC 3REKD 3TU4D 5B1LC 4R8PC 4J8VC 3AZNB 3X1VC 3W98A 4M6BA 5BNVA 1HTAA 2F8NB 5G49A 3X1TA 1P3LD 5B2ID 2FJ7C 1H3OA 1P3MD 5B33C 1S32B 4X23A 4XZQD 3WTPA 3MGPA 3AZFD 2BYKB 2F8NG 5JRGD 3KWQD 5AY8A 3AV2C 1M18D 2PYOC 3AN2B 1M1AB 1KU5A 3REKB 3TU4B 5B0YA 1F66B 3W97A 3X1UB 3AYWC 5CPID 3AZIA 1KX4A 3LELD 2AROB 4ZUXD 3O62B 5GXQD 1P34A 4H9NB 1AOIB 2NZDA 3B6GD 3WAAD 4KGCC 3AFAC 5CPKD 1P3MB 4YM6A 4XZQB 5GT0C 3LZ1D 4WU8D 2CV5A 5B40B 3B6FD 3LJAC 1M18B 1KX5D 1P3KA 1P3BB 4LD9D 3W99C 5CPJD 2BYKA 5CPIB 5AVBA 1Q9CA 4Z66C 3V9RB 3MNNC 4JJNB 5GXQB 3AZLA 3B6GB 3MGRC 1P3FA 5AV5C 3WA9C 5B0ZA 4J8UA 5CPKB 1P3AD 3AZEA 2AROA 3AZMB 1P3OA 4CSRA 4NFTA 3UTAD 4YS3A 2YFWB 5AV6D 1KX3C 3B6FB 4CAYB 5E5AA 1TZYB 4Z5TD 5AV9C 4DRAA 4KUDA 1P3ID 1HQ3D 5B1LA 4R8PA 4J8VA 3X1VA 2YFVA 4H9SC 5AV8D 5B1MC 1P3GB 4XUJC 4WU9C 4KHAB 2FJ7A 5BO0B 3A6ND 5B33A 3WKJC 1M19C 4ZBJC 5GT3B 4Z2MG 5AV6B 1P3PC 3AV2A 2PYOA 3REIC 4Z5TB 2BYMA 4J8XC 4J8WD 4WNNA 1HQ3B 4UUZA 3AYWA 5DNMD 5B2JD 3MVDD 5KDMA 1BH9A 5B31B 4KGCA 3C1BC 3A6NB 3AFAA 5GT0A 2HIOB 5BT1D 5B31G 4H9PA 3MGQC 5AY8D 3LJAA 3W99A 5B24D 5AVCC 5B0YD 3UT9C 3W97D 3AZID 3W98B 4Z66A 3MNNA 3LZ0D 5BNVB 3AZJC 5G49B 3AZGC 4HGAC 3X1TB 1P34D 2NZDD 1H3OB 2HUEC 3NQUA 5AV5A 3MGRA 3WA9A 1A7WA 4H9QA 4YM6D 3MGSC 4X23B 3WTPB 3MGPB 4QLCC 3KSYA 1KX3A 1TAFA 2L5AA 5AV9A 5B0YB 3W97B 1KX4B 3AZIB 5AVBD 4H9SA 1BH8A 5B1MA 4XUJA 3AN2D 4WU9A 1P34B 2NZDB 1U35C 1F66D 3X1UD 4J8UD 4YM6B 3WKJA 1M19A 3AZED 2AROD 1P3OD 3O62D 3NQJA 4YS3D 3AV1C 1AOID 1P3PA 2CV5B 1P3KB 3REIA 4KUDD 4J8XA 3B0DB 4H9RA 2F8NH 3AZHC 5B1LD 5AVBB 1P3LC 5B40D 1P3BD 3AZLB 2FJ7D 3AZFC 4G91C 3C1BA 1P3FB 5B0ZB 4J8UB 5JRGC 1F1EA 3AZEB 1P3OB 3KWQC 4JJND 4CSRB 3UTBC 4YS3B 3MGQA 1B67A 5DNNC 3AV2D 5E5AB 2PYOD 3AZMD 4KUDB 3LELC 1ID3C 5AVCA 3UT9A 5B1LB 4R8PB 4J8VB 3AYWD 3X1VB 2YFVB 5FUGA 3WAAC 3AZJA 1TZYD 3AZGA 2FJ7B 3LZ1C 4KGCD 4WU8C 5B33B 3MGSA 1P3GD 2JSSA 5GT0D 4QLCA 1KX5C 4LD9C 5CPJC 3AV2B 5CP6C 2PYOB 5GT3D 3W99D 2BYMB 4WNNB 1EQZC 4UUZB 4E45A 3AYWB 2IO5C 3KXBC 5KDMB 1BH9B 3RELC 1P3AC 5B32C 3R45A 1U35A 4KGCB 3AFAB 2NQBC 5GT0B 3AZKC 5F99C 5B31D 3AV1A 4H9PB 4G92C 4AWLC 1P3IC 5GSUC 3LJAB 3C1CC 5JA4A 5AV8C 3W99B 2HIOD 4Z2MH 3AZHA 1P3LA 4Z66B 3MNNB 4XUJD 4WU9D 1ZLAC 3AZFA 4EO5C 3NQUB 5AV5B 3MGRB 5C3IC 3WA9B 4H9QB 5JRGA 3W98D 3WKJD 2CWEA 3KWQA 3UTBA 3X1TD 3REJC 3KXBB 4J8WC 1P3PD 5DNNA 1KX3B 4H9OA 5DNMC 5B2JC 4X23D 1TAFB 3WTPD 5AV9B 3MVDC 3LELA 3MGPD 1ID3A 4J8XD 3KUYC 1BH8B 5B1MB 3WAAA 4XUJB 2F8NK 4WU9B 5B32G 3LZ1A 3C1BD 4WU8A 1KX4D 3WKJB 1M19B 4ZBJB 3X1SC 3NQJB 1KX5A 2LY8A 4LD9A 3VH6T 5CPJA 5B24C 1P3PB 5CP6A 3REHC 3W96C 3REIB 4J8XB 4H9RB 3LZ0C 5AVCD 3UT9D 1EQZA 3KXBA 2CV5D 5BNXB 3AZNC 1P3KD 3RELA 1P3AA 5B32A 2RVQD 3C1BB
chains in the Genus database with same CATH superfamily
2NQBA 3VH5A 3B0CT 3AZKA 5F99A 4QLCD 1S32C 3AZLD 1P3IA 3MGQB 3H0RC 1P3FD 5GSUA 5B0ZD 3C1CA 4NE5A 5AV8A 1N1JA 5AVCB 3UT9B 3AN2C 1M1AC 3REKC 3TU4C 5FUGB 1F66C 2Y2GA 5E5AD 3X1UC 3AZJB 1ZLAA 3AZGB 4HGAB 1ULYA 3O62C 1U35D 1JFIA 2HUEB 4R8PD 4J8VD 3X1VD 1AOIC 5B2IC 3MGSB 3VH6A 5BNXA 4QLCB 1P3MC 4XZQC 3REJA 4J8WA 3EPHA 5B33D 5DNMA 5B2JA 3MVDA 3P5JB 5B40C 1M18C 3KUYA 1R4VA 3AZHD 1P3BC 2ZY4A 2BG1A 3B0CW 5CPIC 4JJNC 3R45B 4ZUXC 1U35B 1BFMA 5GXQC 3B6GC 3X1SA 1WWSA 3UTBD 5CPKC 3AV1B 3AZMC 5B24A 1WWIA 5DNND 3AFAD 5JA4B 3W96A 3REHA 1ID3D 3B6FC 2Y2HA 3LZ0A 5CHLB 1TZYC 3AZHB 1P3LB 5B2IB 2XD1A 3LJAD 3AZNA 1P3GC 3AZFB 4G91B 2F8NA 5BS7C 5JRGB 4Z66D 3KWQB 3MNND 3UTBB 2Y2NA 1S32A 5GT3C 3UTAC 5DNNB 3MGRD 5AV5D 3WA9D 4H9OB 5CP6D 5AV6C 2UWXA 3LELB 1ID3B 4ZUXB 1EQZD 3AN2A 4Z5TC 1M1AA 3REKA 3TU4A 3KXBD 1F66A 1HQ3C 1KX3D 3WAAB 2ZY3A 3X1UA 4WZSB 3RELD 5B32D 5AV9D 3WTPE 3O62A 3LZ1B 5B31C 4WU8B 1AOIA 4H9NA 2NQBD 5B2IA 4WV4B 5B1MD 3A6NC 3AZKD 5F99D 1P3MA 1KX5B 4XZQA 4LD9B 4NE3A 2FFFB 5CPJB 2HIOC 5GSUD 5CP6B 3C1CD 1M19D 5B40A 1M18A 1EQZB 1P3BA 3VH5T 2IO5B 5CPIA 3REID 3RELB 1P3AB 5B32B 3W98C 1ZLAD 3V9RA 4JJNA 4ZUXA 1Z2CB 3UTAB 5GXQA 3X1TC 2NQBB 2RIQA 3B6GA 3AZKB 5F99B 5CPKA 4X23C 3WTPC 3MGPC 3AZMA 3REJD 1P3IB 4G92B 4AWLB 3B0BA 5BT1C 5GSUB 2YFWA 3C1CB 5AV8B 1N1JB 5AY8C 3B6FA 4CAYA 3KUYD 1TZYA 2DQNC 2Y2LA 3H0LC 3MGQD 5B0YC 3W97C 1PZRA 1KX4C 3AZIC 3AL0C 4DRBA 1P3GA 1ZLAB 1JFIB 4EO5B 4E44A 5C3IB 1P34C 4KHAA 5BS7A 2NZDC 5BO0A 3X1SD 3AZJD 4YM6C 3AZGD 5GT3A 3REJB 3VH5W 3UTAA 4J8WB 3EPJA 5AV6A 5B2JB 3MGSD 5DNMB 3REHD 3MVDB 2CV5C 3W96D 3KUYB 1P3KC 2G5HC 4Z5TA 2RVQC 3B0DC 1HQ3A 1B6WA 3AZND 5AVBC 2F8ND 5B31A 3AZLC 3X1SB 1P3FC 5AY8B 3A6NA 4NE6A 5B0ZC 4J8UC 1S32D 3AZEC 2AROC 1P3OC 3VH6W 2HIOA 5B24B 4YS3C 3REHB 3W96B 3A1IA 5E5AC 3LZ0B 3AV1D 1M1AD 4KUDC 3REKD 2ZM5A 3TU4D 5B1LC 4R8PC 4J8VC 3AZNB 3X1VC 3W98A 4M6BA 5BNVA 1HTAA 2F8NB 5G49A 3X1TA 1P3LD 5B2ID 2FJ7C 1H3OA 2ZY5A 1P3MD 5B33C 1S32B 4X23A 4XZQD 3WTPA 3MGPA 3AZFD 2BYKB 2F8NG 5JRGD 3KWQD 5AY8A 3AV2C 1M18D 2PYOC 3AN2B 1M1AB 1KU5A 3REKB 3TU4B 5B0YA 1F66B 3W97A 3X1UB 3AYWC 5CPID 3AZIA 1KX4A 3LELD 2Y2OA 2AROB 4ZUXD 3O62B 5GXQD 1P34A 4H9NB 1AOIB 2NZDA 3B6GD 3WAAD 4KGCC 2DF4C 3AFAC 5CPKD 1P3MB 4YM6A 4XZQB 5GT0C 2Y2IA 2VQRA 3LZ1D 4WU8D 2CV5A 5B40B 3B6FD 3LJAC 1M18B 1KX5D 1P3KA 1P3BB 4LD9D 3W99C 5CPJD 2BYKA 3A1KA 5CPIB 5AVBA 1Q9CA 4Z66C 4UPKA 3V9RB 3MNNC 4JJNB 2Y2PA 5GXQB 2W8SA 3AZLA 3B6GB 3FDDA 3MGRC 1P3FA 5AV5C 3WA9C 5B0ZA 4J8UA 5CPKB 1P3AD 3AZEA 2AROA 3AZMB 1P3OA 4CSRA 1T3UA 4NFTA 3UTAD 4YS3A 2YFWB 5AV6D 1KX3C 3B6FB 4CAYB 5E5AA 1TZYB 4Z5TD 5AV9C 4DRAA 4KUDA 1P3ID 1HQ3D 5B1LA 4R8PA 4J8VA 3X1VA 2YFVA 4H9SC 5AV8D 5B1MC 1P3GB 4XUJC 4WU9C 4KHAB 3F6TA 2FJ7A 5BO0B 3A6ND 5B33A 3IP4C 1M19C 4ZBJC 5GT3B 3WKJC 4Z2MG 5AV6B 1P3PC 3AV2A 1W2EA 2PYOA 3REIC 4Z5TB 2BYMA 4J8XC 4J8WD 4WNNA 1HQ3B 4UUZA 3AYWA 5DNMD 5B2JD 3MVDD 5KDMA 1BH9A 5B31B 4KGCA 3C1BC 3A6NB 3AFAA 5GT0A 2HIOB 5BT1D 5B31G 4H9PA 3MGQC 5AY8D 3LJAA 3W99A 5B24D 5AVCC 5B0YD 3UT9C 2Y2MA 3W97D 3AZID 3W98B 4Z66A 3MNNA 3LZ0D 5BNVB 3AZJC 5G49B 3AZGC 4HGAC 3X1TB 1P34D 2NZDD 1H3OB 2HUEC 3NQUA 5AV5A 3MGRA 3WA9A 1A7WA 4H9QA 4YM6D 3MGSC 4X23B 3WTPB 3MGPB 4QLCC 3KSYA 1KX3A 1TAFA 2L5AA 5AV9A 5B0YB 3KFUG 3W97B 1KX4B 3AZIB 5AVBD 4H9SA 1BH8A 5B1MA 4XUJA 3AN2D 4WU9A 1P34B 2NZDB 1U35C 1F66D 3X1UD 4J8UD 4YM6B 3WKJA 1M19A 4DQYB 2AROD 3AZED 1P3OD 3O62D 3NQJA 4YS3D 3AV1C 1AOID 1P3PA 2CV5B 1P3KB 3REIA 4KUDD 4J8XA 3B0DB 4H9RA 2F8NH 3AZHC 5B1LD 3EG5B 5AVBB 1P3LC 5B40D 3EPLA 1P3BD 3AZLB 2FJ7D 3AZFC 4G91C 3C1BA 1P3FB 2XD5A 5B0ZB 4J8UB 5JRGC 1F1EA 3AZEB 1P3OB 3KWQC 4JJND 4CSRB 3UTBC 4YS3B 2Y2KA 3MGQA 1B67A 5DNNC 3AV2D 5E5AB 2PYOD 3AZMD 4KUDB 3LELC 1ID3C 5AVCA 3UT9A 2Y2QA 5B1LB 4R8PB 4J8VB 3AYWD 3X1VB 2YFVB 5FUGA 3WAAC 3AZJA 1TZYD 3AZGA 2Y2JA 2FJ7B 3LZ1C 3EPKA 4KGCD 4WU8C 5B33B 3MGSA 1P3GD 2JSSA 5GT0D 4QLCA 1KX5C 4LD9C 2ZY2A 5CPJC 3AV2B 5CP6C 2PYOB 5GT3D 3W99D 2BYMB 4WNNB 1EQZC 4UUZB 4E45A 3AYWB 2IO5C 3KXBC 5KDMB 1BH9B 3RELC 1P3AC 5B32C 3R45A 1U35A 4KGCB 2F2AC 3AFAB 2NQBC 5GT0B 4WJ3C 3AZKC 5F99C 5B31D 3AV1A 2J8PA 4H9PB 4G92C 4AWLC 1P3IC 2JE5A 5GSUC 3LJAB 3C1CC 5JA4A 3H0MC 5AV8C 3W99B 2HIOD 4Z2MH 3AZHA 1P3LA 4Z66B 3MNNB 4XUJD 4WU9D 1ZLAC 3AZFA 4EO5C 3NQUB 5AV5B 3MGRB 5C3IC 3WA9B 4H9QB 5JRGA 3W98D 3WKJD 2CWEA 3KWQA 3UTBA 3X1TD 3REJC 3KXBB 4J8WC 1P3PD 5DNNA 1KX3B 4H9OA 5DNMC 5B2JC 4X23D 1TAFB 3WTPD 5AV9B 3MVDC 3LELA 3MGPD 1ID3A 4J8XD 3KUYC 1BH8B 5B1MB 3WAAA 4XUJB 2F8NK 4WU9B 5B32G 3LZ1A 3C1BD 4WU8A 1KX4D 3WKJB 1M19B 4ZBJB 3X1SC 3NQJB 1KX5A 2LY8A 4LD9A 2G5IC 3VH6T 5CPJA 5B24C 1P3PB 5CP6A 3REHC 3W96C 3REIB 4J8XB 4H9RB 3LZ0C 5AVCD 3UT9D 1EQZA 3KXBA 2CV5D 5BNXB 3AZNC 1P3KD 2JCHA 3RELA 5B32A 1P3AA 2RVQD 3C1BB
chains in the Genus database with same CATH topology
2NQBA 3VH5A 3B0CT 3AZKA 5F99A 4QLCD 1S32C 3AZLD 1P3IA 3MGQB 3H0RC 1P3FD 5GSUA 5B0ZD 3C1CA 4NE5A 5AV8A 1N1JA 5AVCB 3UT9B 3AN2C 1M1AC 3REKC 3TU4C 5FUGB 1F66C 2Y2GA 5E5AD 3X1UC 3AZJB 1ZLAA 3AZGB 4HGAB 1ULYA 3O62C 1U35D 1JFIA 2HUEB 4R8PD 4J8VD 3X1VD 1AOIC 5B2IC 3MGSB 3VH6A 5BNXA 4QLCB 1P3MC 4XZQC 3REJA 4J8WA 3EPHA 5B33D 5DNMA 5B2JA 3MVDA 3P5JB 5B40C 1M18C 3KUYA 1R4VA 3AZHD 1P3BC 2ZY4A 2BG1A 3B0CW 5CPIC 4JJNC 3R45B 4ZUXC 1U35B 1BFMA 5GXQC 3B6GC 3X1SA 1WWSA 3UTBD 5CPKC 3AV1B 3AZMC 5B24A 1WWIA 5DNND 3AFAD 5JA4B 3W96A 3REHA 1ID3D 3B6FC 2Y2HA 3LZ0A 5CHLB 1TZYC 3AZHB 1P3LB 5B2IB 2XD1A 3LJAD 3AZNA 1P3GC 3AZFB 4G91B 2F8NA 5BS7C 5JRGB 4Z66D 3KWQB 3MNND 3UTBB 2Y2NA 1S32A 5GT3C 3UTAC 5DNNB 3MGRD 5AV5D 3WA9D 4H9OB 5CP6D 5AV6C 2UWXA 3LELB 1ID3B 4ZUXB 1EQZD 3AN2A 4Z5TC 1M1AA 3REKA 3TU4A 3KXBD 1F66A 1HQ3C 1KX3D 3WAAB 2ZY3A 3X1UA 4WZSB 3RELD 5B32D 5AV9D 3WTPE 3O62A 3LZ1B 5B31C 4WU8B 1AOIA 4H9NA 2NQBD 5B2IA 4WV4B 5B1MD 3A6NC 3AZKD 5F99D 1P3MA 1KX5B 4XZQA 4LD9B 4NE3A 2FFFB 5CPJB 2HIOC 5GSUD 5CP6B 3C1CD 1M19D 5B40A 1M18A 1EQZB 1P3BA 3VH5T 2IO5B 5CPIA 3REID 3RELB 1P3AB 5B32B 3W98C 1ZLAD 3V9RA 4JJNA 4ZUXA 1Z2CB 3UTAB 5GXQA 3X1TC 2NQBB 2RIQA 3B6GA 3AZKB 5F99B 5CPKA 4X23C 3WTPC 3MGPC 3AZMA 3REJD 1P3IB 4G92B 4AWLB 3B0BA 5BT1C 5GSUB 2YFWA 3C1CB 5AV8B 1N1JB 5AY8C 3B6FA 4CAYA 3KUYD 1TZYA 2DQNC 2Y2LA 3H0LC 3MGQD 5B0YC 3W97C 1PZRA 1KX4C 3AZIC 3AL0C 4DRBA 1P3GA 1ZLAB 1JFIB 4EO5B 4E44A 5C3IB 1P34C 4KHAA 5BS7A 2NZDC 5BO0A 3X1SD 3AZJD 4YM6C 3AZGD 5GT3A 3REJB 3VH5W 3UTAA 4J8WB 3EPJA 5AV6A 5B2JB 3MGSD 5DNMB 3REHD 3MVDB 2CV5C 3W96D 3KUYB 1P3KC 2G5HC 4Z5TA 2RVQC 3B0DC 1HQ3A 1B6WA 3AZND 5AVBC 2F8ND 5B31A 3AZLC 3X1SB 1P3FC 5AY8B 3A6NA 4NE6A 5B0ZC 4J8UC 1S32D 3AZEC 2AROC 1P3OC 3VH6W 2HIOA 5B24B 4YS3C 3REHB 3W96B 3A1IA 5E5AC 3LZ0B 3AV1D 1M1AD 4KUDC 3REKD 2ZM5A 3TU4D 5B1LC 4R8PC 4J8VC 3AZNB 3X1VC 3W98A 4M6BA 5BNVA 1HTAA 2F8NB 5G49A 3X1TA 1P3LD 5B2ID 2FJ7C 1H3OA 2ZY5A 1P3MD 5B33C 1S32B 4X23A 4XZQD 3WTPA 3MGPA 3AZFD 2BYKB 2F8NG 5JRGD 3KWQD 5AY8A 3AV2C 1M18D 2PYOC 3AN2B 1M1AB 1KU5A 3REKB 3TU4B 5B0YA 1F66B 3W97A 3X1UB 3AYWC 5CPID 3AZIA 1KX4A 3LELD 2Y2OA 2AROB 4ZUXD 3O62B 5GXQD 1P34A 4H9NB 1AOIB 2NZDA 3B6GD 3WAAD 4KGCC 2DF4C 3AFAC 5CPKD 1P3MB 4YM6A 4XZQB 5GT0C 2Y2IA 2VQRA 3LZ1D 4WU8D 2CV5A 5B40B 3B6FD 3LJAC 1M18B 1KX5D 1P3KA 1P3BB 4LD9D 3W99C 5CPJD 2BYKA 3A1KA 5CPIB 5AVBA 1Q9CA 4Z66C 4UPKA 3V9RB 3MNNC 4JJNB 2Y2PA 5GXQB 2W8SA 3AZLA 3B6GB 3FDDA 3MGRC 1P3FA 5AV5C 3WA9C 5B0ZA 4J8UA 5CPKB 1P3AD 3AZEA 2AROA 3AZMB 1P3OA 4CSRA 1T3UA 4NFTA 3UTAD 4YS3A 2YFWB 5AV6D 1KX3C 3B6FB 4CAYB 5E5AA 1TZYB 4Z5TD 5AV9C 4DRAA 4KUDA 1P3ID 1HQ3D 5B1LA 4R8PA 4J8VA 3X1VA 2YFVA 4H9SC 5AV8D 5B1MC 1P3GB 4XUJC 4WU9C 4KHAB 3F6TA 2FJ7A 5BO0B 3A6ND 5B33A 3IP4C 1M19C 4ZBJC 5GT3B 3WKJC 4Z2MG 5AV6B 1P3PC 3AV2A 1W2EA 2PYOA 3REIC 4Z5TB 2BYMA 4J8XC 4J8WD 4WNNA 1HQ3B 4UUZA 3AYWA 5DNMD 5B2JD 3MVDD 5KDMA 1BH9A 5B31B 4KGCA 3C1BC 3A6NB 3AFAA 5GT0A 2HIOB 5BT1D 5B31G 4H9PA 3MGQC 5AY8D 3LJAA 3W99A 5B24D 5AVCC 5B0YD 3UT9C 2Y2MA 3W97D 3AZID 3W98B 4Z66A 3MNNA 3LZ0D 5BNVB 3AZJC 5G49B 3AZGC 4HGAC 3X1TB 1P34D 2NZDD 1H3OB 2HUEC 3NQUA 5AV5A 3MGRA 3WA9A 1A7WA 4H9QA 4YM6D 3MGSC 4X23B 3WTPB 3MGPB 4QLCC 3KSYA 1KX3A 1TAFA 2L5AA 5AV9A 5B0YB 3KFUG 3W97B 1KX4B 3AZIB 5AVBD 4H9SA 1BH8A 5B1MA 4XUJA 3AN2D 4WU9A 1P34B 2NZDB 1U35C 1F66D 3X1UD 4J8UD 4YM6B 3WKJA 1M19A 4DQYB 2AROD 3AZED 1P3OD 3O62D 3NQJA 4YS3D 3AV1C 1AOID 1P3PA 2CV5B 1P3KB 3REIA 4KUDD 4J8XA 3B0DB 4H9RA 2F8NH 3AZHC 5B1LD 3EG5B 5AVBB 1P3LC 5B40D 3EPLA 1P3BD 3AZLB 2FJ7D 3AZFC 4G91C 3C1BA 1P3FB 2XD5A 5B0ZB 4J8UB 5JRGC 1F1EA 3AZEB 1P3OB 3KWQC 4JJND 4CSRB 3UTBC 4YS3B 2Y2KA 3MGQA 1B67A 5DNNC 3AV2D 5E5AB 2PYOD 3AZMD 4KUDB 3LELC 1ID3C 5AVCA 3UT9A 2Y2QA 5B1LB 4R8PB 4J8VB 3AYWD 3X1VB 2YFVB 5FUGA 3WAAC 3AZJA 1TZYD 3AZGA 2Y2JA 2FJ7B 3LZ1C 3EPKA 4KGCD 4WU8C 5B33B 3MGSA 1P3GD 2JSSA 5GT0D 4QLCA 1KX5C 4LD9C 2ZY2A 5CPJC 3AV2B 5CP6C 2PYOB 5GT3D 3W99D 2BYMB 4WNNB 1EQZC 4UUZB 4E45A 3AYWB 2IO5C 3KXBC 5KDMB 1BH9B 3RELC 1P3AC 5B32C 3R45A 1U35A 4KGCB 2F2AC 3AFAB 2NQBC 5GT0B 4WJ3C 3AZKC 5F99C 5B31D 3AV1A 2J8PA 4H9PB 4G92C 4AWLC 1P3IC 2JE5A 5GSUC 3LJAB 3C1CC 5JA4A 3H0MC 5AV8C 3W99B 2HIOD 4Z2MH 3AZHA 1P3LA 4Z66B 3MNNB 4XUJD 4WU9D 1ZLAC 3AZFA 4EO5C 3NQUB 5AV5B 3MGRB 5C3IC 3WA9B 4H9QB 5JRGA 3W98D 3WKJD 2CWEA 3KWQA 3UTBA 3X1TD 3REJC 3KXBB 4J8WC 1P3PD 5DNNA 1KX3B 4H9OA 5DNMC 5B2JC 4X23D 1TAFB 3WTPD 5AV9B 3MVDC 3LELA 3MGPD 1ID3A 4J8XD 3KUYC 1BH8B 5B1MB 3WAAA 4XUJB 2F8NK 4WU9B 5B32G 3LZ1A 3C1BD 4WU8A 1KX4D 3WKJB 1M19B 4ZBJB 3X1SC 3NQJB 1KX5A 2LY8A 4LD9A 2G5IC 3VH6T 5CPJA 5B24C 1P3PB 5CP6A 3REHC 3W96C 3REIB 4J8XB 4H9RB 3LZ0C 5AVCD 3UT9D 1EQZA 3KXBA 2CV5D 5BNXB 3AZNC 1P3KD 2JCHA 3RELA 5B32A 1P3AA 2RVQD 3C1BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB A;  3VH5 A;  3B0C T;  3AZK A;  5F99 A;  4QLC D;  1S32 C;  3AZL D;  1P3I A;  3MGQ B;  1P3F D;  5GSU A;  5B0Z D;  3C1C A;  4NE5 A;  5AV8 A;  1N1J A;  5AVC B;  3UT9 B;  3AN2 C;  1M1A C;  3REK C;  3TU4 C;  5FUG B;  1F66 C;  5E5A D;  3X1U C;  3AZJ B;  1ZLA A;  3AZG B;  4HGA B;  1ULY A;  3O62 C;  1U35 D;  1JFI A;  2HUE B;  4R8P D;  4J8V D;  3X1V D;  1AOI C;  5B2I C;  3MGS B;  3VH6 A;  5BNX A;  4QLC B;  1P3M C;  4XZQ C;  3REJ A;  4J8W A;  5B33 D;  5DNM A;  5B2J A;  3MVD A;  5B40 C;  1M18 C;  3KUY A;  1R4V A;  3AZH D;  1P3B C;  3B0C W;  5CPI C;  4JJN C;  3R45 B;  4ZUX C;  1U35 B;  1BFM A;  5GXQ C;  3B6G C;  3X1S A;  1WWS A;  3UTB D;  5CPK C;  3AV1 B;  3AZM C;  5B24 A;  1WWI A;  5DNN D;  3AFA D;  5JA4 B;  3W96 A;  3REH A;  1ID3 D;  3B6F C;  3LZ0 A;  5CHL B;  1TZY C;  3AZH B;  1P3L B;  5B2I B;  3LJA D;  3AZN A;  1P3G C;  3AZF B;  4G91 B;  2F8N A;  5BS7 C;  5JRG B;  4Z66 D;  3KWQ B;  3MNN D;  3UTB B;  1S32 A;  5GT3 C;  3UTA C;  5DNN B;  3MGR D;  5AV5 D;  3WA9 D;  4H9O B;  5CP6 D;  5AV6 C;  3LEL B;  1ID3 B;  4ZUX B;  1EQZ D;  3AN2 A;  4Z5T C;  1M1A A;  3REK A;  3TU4 A;  3KXB D;  1F66 A;  1HQ3 C;  1KX3 D;  3WAA B;  3X1U A;  4WZS B;  3REL D;  5B32 D;  5AV9 D;  3WTP E;  3O62 A;  3LZ1 B;  5B31 C;  4WU8 B;  1AOI A;  4H9N A;  2NQB D;  5B2I A;  4WV4 B;  5B1M D;  3A6N C;  3AZK D;  5F99 D;  1P3M A;  1KX5 B;  4XZQ A;  4LD9 B;  4NE3 A;  5CPJ B;  2HIO C;  5GSU D;  5CP6 B;  3C1C D;  1M19 D;  5B40 A;  1M18 A;  1EQZ B;  1P3B A;  3VH5 T;  2IO5 B;  5CPI A;  3REI D;  3REL B;  1P3A B;  5B32 B;  3W98 C;  1ZLA D;  3V9R A;  4JJN A;  4ZUX A;  3UTA B;  5GXQ A;  3X1T C;  2NQB B;  3B6G A;  3AZK B;  5F99 B;  5CPK A;  4X23 C;  3WTP C;  3MGP C;  3AZM A;  3REJ D;  1P3I B;  4G92 B;  4AWL B;  3B0B A;  5BT1 C;  5GSU B;  2YFW A;  3C1C B;  5AV8 B;  1N1J B;  5AY8 C;  3B6F A;  4CAY A;  3KUY D;  1TZY A;  3MGQ D;  5B0Y C;  3W97 C;  1KX4 C;  3AZI C;  4DRB A;  1P3G A;  1ZLA B;  1JFI B;  4EO5 B;  4E44 A;  5C3I B;  1P34 C;  4KHA A;  5BS7 A;  2NZD C;  5BO0 A;  3X1S D;  3AZJ D;  4YM6 C;  3AZG D;  5GT3 A;  3REJ B;  3VH5 W;  3UTA A;  4J8W B;  5AV6 A;  5B2J B;  3MGS D;  5DNM B;  3REH D;  3MVD B;  2CV5 C;  3W96 D;  3KUY B;  1P3K C;  4Z5T A;  2RVQ C;  3B0D C;  1HQ3 A;  1B6W A;  3AZN D;  5AVB C;  2F8N D;  5B31 A;  3AZL C;  3X1S B;  1P3F C;  5AY8 B;  3A6N A;  4NE6 A;  5B0Z C;  4J8U C;  1S32 D;  3AZE C;  2ARO C;  1P3O C;  3VH6 W;  2HIO A;  5B24 B;  4YS3 C;  3REH B;  3W96 B;  5E5A C;  3LZ0 B;  3AV1 D;  1M1A D;  4KUD C;  3REK D;  3TU4 D;  5B1L C;  4R8P C;  4J8V C;  3AZN B;  3X1V C;  3W98 A;  4M6B A;  5BNV A;  1HTA A;  2F8N B;  5G49 A;  3X1T A;  1P3L D;  5B2I D;  2FJ7 C;  1H3O A;  1P3M D;  5B33 C;  1S32 B;  4X23 A;  4XZQ D;  3WTP A;  3MGP A;  3AZF D;  2BYK B;  2F8N G;  5JRG D;  3KWQ D;  5AY8 A;  3AV2 C;  1M18 D;  2PYO C;  3AN2 B;  1M1A B;  1KU5 A;  3REK B;  3TU4 B;  5B0Y A;  1F66 B;  3W97 A;  3X1U B;  3AYW C;  5CPI D;  3AZI A;  1KX4 A;  3LEL D;  2ARO B;  4ZUX D;  3O62 B;  5GXQ D;  1P34 A;  4H9N B;  1AOI B;  2NZD A;  3B6G D;  3WAA D;  4KGC C;  3AFA C;  5CPK D;  1P3M B;  4YM6 A;  4XZQ B;  5GT0 C;  3LZ1 D;  4WU8 D;  2CV5 A;  5B40 B;  3B6F D;  3LJA C;  1M18 B;  1KX5 D;  1P3K A;  1P3B B;  4LD9 D;  3W99 C;  5CPJ D;  2BYK A;  5CPI B;  5AVB A;  1Q9C A;  4Z66 C;  3V9R B;  3MNN C;  4JJN B;  5GXQ B;  3AZL A;  3B6G B;  3MGR C;  1P3F A;  5AV5 C;  3WA9 C;  5B0Z A;  4J8U A;  5CPK B;  1P3A D;  3AZE A;  2ARO A;  3AZM B;  1P3O A;  4CSR A;  4NFT A;  3UTA D;  4YS3 A;  2YFW B;  5AV6 D;  1KX3 C;  3B6F B;  4CAY B;  5E5A A;  1TZY B;  4Z5T D;  5AV9 C;  4DRA A;  4KUD A;  1P3I D;  1HQ3 D;  5B1L A;  4R8P A;  4J8V A;  3X1V A;  2YFV A;  4H9S C;  5AV8 D;  5B1M C;  1P3G B;  4XUJ C;  4WU9 C;  4KHA B;  2FJ7 A;  5BO0 B;  3A6N D;  5B33 A;  3WKJ C;  1M19 C;  4ZBJ C;  5GT3 B;  4Z2M G;  5AV6 B;  1P3P C;  3AV2 A;  2PYO A;  3REI C;  4Z5T B;  2BYM A;  4J8X C;  4J8W D;  4WNN A;  1HQ3 B;  4UUZ A;  3AYW A;  5DNM D;  5B2J D;  3MVD D;  5KDM A;  1BH9 A;  5B31 B;  4KGC A;  3C1B C;  3A6N B;  3AFA A;  5GT0 A;  2HIO B;  5BT1 D;  5B31 G;  4H9P A;  3MGQ C;  5AY8 D;  3LJA A;  3W99 A;  5B24 D;  5AVC C;  5B0Y D;  3UT9 C;  3W97 D;  3AZI D;  3W98 B;  4Z66 A;  3MNN A;  3LZ0 D;  5BNV B;  3AZJ C;  5G49 B;  3AZG C;  4HGA C;  3X1T B;  1P34 D;  2NZD D;  1H3O B;  2HUE C;  3NQU A;  5AV5 A;  3MGR A;  3WA9 A;  1A7W A;  4H9Q A;  4YM6 D;  3MGS C;  4X23 B;  3WTP B;  3MGP B;  4QLC C;  3KSY A;  1KX3 A;  1TAF A;  2L5A A;  5AV9 A;  5B0Y B;  3W97 B;  1KX4 B;  3AZI B;  5AVB D;  4H9S A;  1BH8 A;  5B1M A;  4XUJ A;  3AN2 D;  4WU9 A;  1P34 B;  2NZD B;  1U35 C;  1F66 D;  3X1U D;  4J8U D;  4YM6 B;  3WKJ A;  1M19 A;  3AZE D;  2ARO D;  1P3O D;  3O62 D;  3NQJ A;  4YS3 D;  3AV1 C;  1AOI D;  1P3P A;  2CV5 B;  1P3K B;  3REI A;  4KUD D;  4J8X A;  3B0D B;  4H9R A;  2F8N H;  3AZH C;  5B1L D;  5AVB B;  1P3L C;  5B40 D;  1P3B D;  3AZL B;  2FJ7 D;  3AZF C;  4G91 C;  3C1B A;  1P3F B;  5B0Z B;  4J8U B;  5JRG C;  1F1E A;  3AZE B;  1P3O B;  3KWQ C;  4JJN D;  4CSR B;  3UTB C;  4YS3 B;  3MGQ A;  1B67 A;  5DNN C;  3AV2 D;  5E5A B;  2PYO D;  3AZM D;  4KUD B;  3LEL C;  1ID3 C;  5AVC A;  3UT9 A;  5B1L B;  4R8P B;  4J8V B;  3AYW D;  3X1V B;  2YFV B;  5FUG A;  3WAA C;  3AZJ A;  1TZY D;  3AZG A;  2FJ7 B;  3LZ1 C;  4KGC D;  4WU8 C;  5B33 B;  3MGS A;  1P3G D;  2JSS A;  5GT0 D;  4QLC A;  1KX5 C;  4LD9 C;  5CPJ C;  3AV2 B;  5CP6 C;  2PYO B;  5GT3 D;  3W99 D;  2BYM B;  4WNN B;  1EQZ C;  4UUZ B;  4E45 A;  3AYW B;  2IO5 C;  3KXB C;  5KDM B;  1BH9 B;  3REL C;  1P3A C;  5B32 C;  3R45 A;  1U35 A;  4KGC B;  3AFA B;  2NQB C;  5GT0 B;  3AZK C;  5F99 C;  5B31 D;  3AV1 A;  4H9P B;  4G92 C;  4AWL C;  1P3I C;  5GSU C;  3LJA B;  3C1C C;  5JA4 A;  5AV8 C;  3W99 B;  2HIO D;  4Z2M H;  3AZH A;  1P3L A;  4Z66 B;  3MNN B;  4XUJ D;  4WU9 D;  1ZLA C;  3AZF A;  4EO5 C;  3NQU B;  5AV5 B;  3MGR B;  5C3I C;  3WA9 B;  4H9Q B;  5JRG A;  3W98 D;  3WKJ D;  2CWE A;  3KWQ A;  3UTB A;  3X1T D;  3REJ C;  3KXB B;  4J8W C;  1P3P D;  5DNN A;  1KX3 B;  4H9O A;  5DNM C;  5B2J C;  4X23 D;  1TAF B;  3WTP D;  5AV9 B;  3MVD C;  3LEL A;  3MGP D;  1ID3 A;  4J8X D;  3KUY C;  1BH8 B;  5B1M B;  3WAA A;  4XUJ B;  2F8N K;  4WU9 B;  5B32 G;  3LZ1 A;  3C1B D;  4WU8 A;  1KX4 D;  3WKJ B;  1M19 B;  4ZBJ B;  3X1S C;  3NQJ B;  1KX5 A;  2LY8 A;  4LD9 A;  3VH6 T;  5CPJ A;  5B24 C;  1P3P B;  5CP6 A;  3REH C;  3W96 C;  3REI B;  4J8X B;  4H9R B;  3LZ0 C;  5AVC D;  3UT9 D;  1EQZ A;  3KXB A;  2CV5 D;  5BNX B;  3AZN C;  1P3K D;  3REL A;  1P3A A;  5B32 A;  2RVQ D;  3C1B B; 
#chains in the Genus database with same CATH topology
 2NQB A;  3VH5 A;  3B0C T;  3AZK A;  5F99 A;  4QLC D;  1S32 C;  3AZL D;  1P3I A;  3MGQ B;  3H0R C;  1P3F D;  5GSU A;  5B0Z D;  3C1C A;  4NE5 A;  5AV8 A;  1N1J A;  5AVC B;  3UT9 B;  3AN2 C;  1M1A C;  3REK C;  3TU4 C;  5FUG B;  1F66 C;  2Y2G A;  5E5A D;  3X1U C;  3AZJ B;  1ZLA A;  3AZG B;  4HGA B;  1ULY A;  3O62 C;  1U35 D;  1JFI A;  2HUE B;  4R8P D;  4J8V D;  3X1V D;  1AOI C;  5B2I C;  3MGS B;  3VH6 A;  5BNX A;  4QLC B;  1P3M C;  4XZQ C;  3REJ A;  4J8W A;  3EPH A;  5B33 D;  5DNM A;  5B2J A;  3MVD A;  3P5J B;  5B40 C;  1M18 C;  3KUY A;  1R4V A;  3AZH D;  1P3B C;  2ZY4 A;  2BG1 A;  3B0C W;  5CPI C;  4JJN C;  3R45 B;  4ZUX C;  1U35 B;  1BFM A;  5GXQ C;  3B6G C;  3X1S A;  1WWS A;  3UTB D;  5CPK C;  3AV1 B;  3AZM C;  5B24 A;  1WWI A;  5DNN D;  3AFA D;  5JA4 B;  3W96 A;  3REH A;  1ID3 D;  3B6F C;  2Y2H A;  3LZ0 A;  5CHL B;  1TZY C;  3AZH B;  1P3L B;  5B2I B;  2XD1 A;  3LJA D;  3AZN A;  1P3G C;  3AZF B;  4G91 B;  2F8N A;  5BS7 C;  5JRG B;  4Z66 D;  3KWQ B;  3MNN D;  3UTB B;  2Y2N A;  1S32 A;  5GT3 C;  3UTA C;  5DNN B;  3MGR D;  5AV5 D;  3WA9 D;  4H9O B;  5CP6 D;  5AV6 C;  2UWX A;  3LEL B;  1ID3 B;  4ZUX B;  1EQZ D;  3AN2 A;  4Z5T C;  1M1A A;  3REK A;  3TU4 A;  3KXB D;  1F66 A;  1HQ3 C;  1KX3 D;  3WAA B;  2ZY3 A;  3X1U A;  4WZS B;  3REL D;  5B32 D;  5AV9 D;  3WTP E;  3O62 A;  3LZ1 B;  5B31 C;  4WU8 B;  1AOI A;  4H9N A;  2NQB D;  5B2I A;  4WV4 B;  5B1M D;  3A6N C;  3AZK D;  5F99 D;  1P3M A;  1KX5 B;  4XZQ A;  4LD9 B;  4NE3 A;  2FFF B;  5CPJ B;  2HIO C;  5GSU D;  5CP6 B;  3C1C D;  1M19 D;  5B40 A;  1M18 A;  1EQZ B;  1P3B A;  3VH5 T;  2IO5 B;  5CPI A;  3REI D;  3REL B;  1P3A B;  5B32 B;  3W98 C;  1ZLA D;  3V9R A;  4JJN A;  4ZUX A;  1Z2C B;  3UTA B;  5GXQ A;  3X1T C;  2NQB B;  2RIQ A;  3B6G A;  3AZK B;  5F99 B;  5CPK A;  4X23 C;  3WTP C;  3MGP C;  3AZM A;  3REJ D;  1P3I B;  4G92 B;  4AWL B;  3B0B A;  5BT1 C;  5GSU B;  2YFW A;  3C1C B;  5AV8 B;  1N1J B;  5AY8 C;  3B6F A;  4CAY A;  3KUY D;  1TZY A;  2DQN C;  2Y2L A;  3H0L C;  3MGQ D;  5B0Y C;  3W97 C;  1PZR A;  1KX4 C;  3AZI C;  3AL0 C;  4DRB A;  1P3G A;  1ZLA B;  1JFI B;  4EO5 B;  4E44 A;  5C3I B;  1P34 C;  4KHA A;  5BS7 A;  2NZD C;  5BO0 A;  3X1S D;  3AZJ D;  4YM6 C;  3AZG D;  5GT3 A;  3REJ B;  3VH5 W;  3UTA A;  4J8W B;  3EPJ A;  5AV6 A;  5B2J B;  3MGS D;  5DNM B;  3REH D;  3MVD B;  2CV5 C;  3W96 D;  3KUY B;  1P3K C;  2G5H C;  4Z5T A;  2RVQ C;  3B0D C;  1HQ3 A;  1B6W A;  3AZN D;  5AVB C;  2F8N D;  5B31 A;  3AZL C;  3X1S B;  1P3F C;  5AY8 B;  3A6N A;  4NE6 A;  5B0Z C;  4J8U C;  1S32 D;  3AZE C;  2ARO C;  1P3O C;  3VH6 W;  2HIO A;  5B24 B;  4YS3 C;  3REH B;  3W96 B;  3A1I A;  5E5A C;  3LZ0 B;  3AV1 D;  1M1A D;  4KUD C;  3REK D;  2ZM5 A;  3TU4 D;  5B1L C;  4R8P C;  4J8V C;  3AZN B;  3X1V C;  3W98 A;  4M6B A;  5BNV A;  1HTA A;  2F8N B;  5G49 A;  3X1T A;  1P3L D;  5B2I D;  2FJ7 C;  1H3O A;  2ZY5 A;  1P3M D;  5B33 C;  1S32 B;  4X23 A;  4XZQ D;  3WTP A;  3MGP A;  3AZF D;  2BYK B;  2F8N G;  5JRG D;  3KWQ D;  5AY8 A;  3AV2 C;  1M18 D;  2PYO C;  3AN2 B;  1M1A B;  1KU5 A;  3REK B;  3TU4 B;  5B0Y A;  1F66 B;  3W97 A;  3X1U B;  3AYW C;  5CPI D;  3AZI A;  1KX4 A;  3LEL D;  2Y2O A;  2ARO B;  4ZUX D;  3O62 B;  5GXQ D;  1P34 A;  4H9N B;  1AOI B;  2NZD A;  3B6G D;  3WAA D;  4KGC C;  2DF4 C;  3AFA C;  5CPK D;  1P3M B;  4YM6 A;  4XZQ B;  5GT0 C;  2Y2I A;  2VQR A;  3LZ1 D;  4WU8 D;  2CV5 A;  5B40 B;  3B6F D;  3LJA C;  1M18 B;  1KX5 D;  1P3K A;  1P3B B;  4LD9 D;  3W99 C;  5CPJ D;  2BYK A;  3A1K A;  5CPI B;  5AVB A;  1Q9C A;  4Z66 C;  4UPK A;  3V9R B;  3MNN C;  4JJN B;  2Y2P A;  5GXQ B;  2W8S A;  3AZL A;  3B6G B;  3FDD A;  3MGR C;  1P3F A;  5AV5 C;  3WA9 C;  5B0Z A;  4J8U A;  5CPK B;  1P3A D;  3AZE A;  2ARO A;  3AZM B;  1P3O A;  4CSR A;  1T3U A;  4NFT A;  3UTA D;  4YS3 A;  2YFW B;  5AV6 D;  1KX3 C;  3B6F B;  4CAY B;  5E5A A;  1TZY B;  4Z5T D;  5AV9 C;  4DRA A;  4KUD A;  1P3I D;  1HQ3 D;  5B1L A;  4R8P A;  4J8V A;  3X1V A;  2YFV A;  4H9S C;  5AV8 D;  5B1M C;  1P3G B;  4XUJ C;  4WU9 C;  4KHA B;  3F6T A;  2FJ7 A;  5BO0 B;  3A6N D;  5B33 A;  3IP4 C;  1M19 C;  4ZBJ C;  5GT3 B;  3WKJ C;  4Z2M G;  5AV6 B;  1P3P C;  3AV2 A;  1W2E A;  2PYO A;  3REI C;  4Z5T B;  2BYM A;  4J8X C;  4J8W D;  4WNN A;  1HQ3 B;  4UUZ A;  3AYW A;  5DNM D;  5B2J D;  3MVD D;  5KDM A;  1BH9 A;  5B31 B;  4KGC A;  3C1B C;  3A6N B;  3AFA A;  5GT0 A;  2HIO B;  5BT1 D;  5B31 G;  4H9P A;  3MGQ C;  5AY8 D;  3LJA A;  3W99 A;  5B24 D;  5AVC C;  5B0Y D;  3UT9 C;  2Y2M A;  3W97 D;  3AZI D;  3W98 B;  4Z66 A;  3MNN A;  3LZ0 D;  5BNV B;  3AZJ C;  5G49 B;  3AZG C;  4HGA C;  3X1T B;  1P34 D;  2NZD D;  1H3O B;  2HUE C;  3NQU A;  5AV5 A;  3MGR A;  3WA9 A;  1A7W A;  4H9Q A;  4YM6 D;  3MGS C;  4X23 B;  3WTP B;  3MGP B;  4QLC C;  3KSY A;  1KX3 A;  1TAF A;  2L5A A;  5AV9 A;  5B0Y B;  3KFU G;  3W97 B;  1KX4 B;  3AZI B;  5AVB D;  4H9S A;  1BH8 A;  5B1M A;  4XUJ A;  3AN2 D;  4WU9 A;  1P34 B;  2NZD B;  1U35 C;  1F66 D;  3X1U D;  4J8U D;  4YM6 B;  3WKJ A;  1M19 A;  4DQY B;  2ARO D;  3AZE D;  1P3O D;  3O62 D;  3NQJ A;  4YS3 D;  3AV1 C;  1AOI D;  1P3P A;  2CV5 B;  1P3K B;  3REI A;  4KUD D;  4J8X A;  3B0D B;  4H9R A;  2F8N H;  3AZH C;  5B1L D;  3EG5 B;  5AVB B;  1P3L C;  5B40 D;  3EPL A;  1P3B D;  3AZL B;  2FJ7 D;  3AZF C;  4G91 C;  3C1B A;  1P3F B;  2XD5 A;  5B0Z B;  4J8U B;  5JRG C;  1F1E A;  3AZE B;  1P3O B;  3KWQ C;  4JJN D;  4CSR B;  3UTB C;  4YS3 B;  2Y2K A;  3MGQ A;  1B67 A;  5DNN C;  3AV2 D;  5E5A B;  2PYO D;  3AZM D;  4KUD B;  3LEL C;  1ID3 C;  5AVC A;  3UT9 A;  2Y2Q A;  5B1L B;  4R8P B;  4J8V B;  3AYW D;  3X1V B;  2YFV B;  5FUG A;  3WAA C;  3AZJ A;  1TZY D;  3AZG A;  2Y2J A;  2FJ7 B;  3LZ1 C;  3EPK A;  4KGC D;  4WU8 C;  5B33 B;  3MGS A;  1P3G D;  2JSS A;  5GT0 D;  4QLC A;  1KX5 C;  4LD9 C;  2ZY2 A;  5CPJ C;  3AV2 B;  5CP6 C;  2PYO B;  5GT3 D;  3W99 D;  2BYM B;  4WNN B;  1EQZ C;  4UUZ B;  4E45 A;  3AYW B;  2IO5 C;  3KXB C;  5KDM B;  1BH9 B;  3REL C;  1P3A C;  5B32 C;  3R45 A;  1U35 A;  4KGC B;  2F2A C;  3AFA B;  2NQB C;  5GT0 B;  4WJ3 C;  3AZK C;  5F99 C;  5B31 D;  3AV1 A;  2J8P A;  4H9P B;  4G92 C;  4AWL C;  1P3I C;  2JE5 A;  5GSU C;  3LJA B;  3C1C C;  5JA4 A;  3H0M C;  5AV8 C;  3W99 B;  2HIO D;  4Z2M H;  3AZH A;  1P3L A;  4Z66 B;  3MNN B;  4XUJ D;  4WU9 D;  1ZLA C;  3AZF A;  4EO5 C;  3NQU B;  5AV5 B;  3MGR B;  5C3I C;  3WA9 B;  4H9Q B;  5JRG A;  3W98 D;  3WKJ D;  2CWE A;  3KWQ A;  3UTB A;  3X1T D;  3REJ C;  3KXB B;  4J8W C;  1P3P D;  5DNN A;  1KX3 B;  4H9O A;  5DNM C;  5B2J C;  4X23 D;  1TAF B;  3WTP D;  5AV9 B;  3MVD C;  3LEL A;  3MGP D;  1ID3 A;  4J8X D;  3KUY C;  1BH8 B;  5B1M B;  3WAA A;  4XUJ B;  2F8N K;  4WU9 B;  5B32 G;  3LZ1 A;  3C1B D;  4WU8 A;  1KX4 D;  3WKJ B;  1M19 B;  4ZBJ B;  3X1S C;  3NQJ B;  1KX5 A;  2LY8 A;  4LD9 A;  2G5I C;  3VH6 T;  5CPJ A;  5B24 C;  1P3P B;  5CP6 A;  3REH C;  3W96 C;  3REI B;  4J8X B;  4H9R B;  3LZ0 C;  5AVC D;  3UT9 D;  1EQZ A;  3KXB A;  2CV5 D;  5BNX B;  3AZN C;  1P3K D;  2JCH A;  3REL A;  5B32 A;  1P3A A;  2RVQ D;  3C1B B; 
#chains in the Genus database with same CATH homology
 2NQB A;  3VH5 A;  3B0C T;  3AZK A;  5F99 A;  4QLC D;  1S32 C;  3AZL D;  1P3I A;  3MGQ B;  3H0R C;  1P3F D;  5GSU A;  5B0Z D;  3C1C A;  4NE5 A;  5AV8 A;  1N1J A;  5AVC B;  3UT9 B;  3AN2 C;  1M1A C;  3REK C;  3TU4 C;  5FUG B;  1F66 C;  2Y2G A;  5E5A D;  3X1U C;  3AZJ B;  1ZLA A;  3AZG B;  4HGA B;  1ULY A;  3O62 C;  1U35 D;  1JFI A;  2HUE B;  4R8P D;  4J8V D;  3X1V D;  1AOI C;  5B2I C;  3MGS B;  3VH6 A;  5BNX A;  4QLC B;  1P3M C;  4XZQ C;  3REJ A;  4J8W A;  3EPH A;  5B33 D;  5DNM A;  5B2J A;  3MVD A;  3P5J B;  5B40 C;  1M18 C;  3KUY A;  1R4V A;  3AZH D;  1P3B C;  2ZY4 A;  2BG1 A;  3B0C W;  5CPI C;  4JJN C;  3R45 B;  4ZUX C;  1U35 B;  1BFM A;  5GXQ C;  3B6G C;  3X1S A;  1WWS A;  3UTB D;  5CPK C;  3AV1 B;  3AZM C;  5B24 A;  1WWI A;  5DNN D;  3AFA D;  5JA4 B;  3W96 A;  3REH A;  1ID3 D;  3B6F C;  2Y2H A;  3LZ0 A;  5CHL B;  1TZY C;  3AZH B;  1P3L B;  5B2I B;  2XD1 A;  3LJA D;  3AZN A;  1P3G C;  3AZF B;  4G91 B;  2F8N A;  5BS7 C;  5JRG B;  4Z66 D;  3KWQ B;  3MNN D;  3UTB B;  2Y2N A;  1S32 A;  5GT3 C;  3UTA C;  5DNN B;  3MGR D;  5AV5 D;  3WA9 D;  4H9O B;  5CP6 D;  5AV6 C;  2UWX A;  3LEL B;  1ID3 B;  4ZUX B;  1EQZ D;  3AN2 A;  4Z5T C;  1M1A A;  3REK A;  3TU4 A;  3KXB D;  1F66 A;  1HQ3 C;  1KX3 D;  3WAA B;  2ZY3 A;  3X1U A;  4WZS B;  3REL D;  5B32 D;  5AV9 D;  3WTP E;  3O62 A;  3LZ1 B;  5B31 C;  4WU8 B;  1AOI A;  4H9N A;  2NQB D;  5B2I A;  4WV4 B;  5B1M D;  3A6N C;  3AZK D;  5F99 D;  1P3M A;  1KX5 B;  4XZQ A;  4LD9 B;  4NE3 A;  2FFF B;  5CPJ B;  2HIO C;  5GSU D;  5CP6 B;  3C1C D;  1M19 D;  5B40 A;  1M18 A;  1EQZ B;  1P3B A;  3VH5 T;  2IO5 B;  5CPI A;  3REI D;  3REL B;  1P3A B;  5B32 B;  3W98 C;  1ZLA D;  3V9R A;  4JJN A;  4ZUX A;  1Z2C B;  3UTA B;  5GXQ A;  3X1T C;  2NQB B;  2RIQ A;  3B6G A;  3AZK B;  5F99 B;  5CPK A;  4X23 C;  3WTP C;  3MGP C;  3AZM A;  3REJ D;  1P3I B;  4G92 B;  4AWL B;  3B0B A;  5BT1 C;  5GSU B;  2YFW A;  3C1C B;  5AV8 B;  1N1J B;  5AY8 C;  3B6F A;  4CAY A;  3KUY D;  1TZY A;  2DQN C;  2Y2L A;  3H0L C;  3MGQ D;  5B0Y C;  3W97 C;  1PZR A;  1KX4 C;  3AZI C;  3AL0 C;  4DRB A;  1P3G A;  1ZLA B;  1JFI B;  4EO5 B;  4E44 A;  5C3I B;  1P34 C;  4KHA A;  5BS7 A;  2NZD C;  5BO0 A;  3X1S D;  3AZJ D;  4YM6 C;  3AZG D;  5GT3 A;  3REJ B;  3VH5 W;  3UTA A;  4J8W B;  3EPJ A;  5AV6 A;  5B2J B;  3MGS D;  5DNM B;  3REH D;  3MVD B;  2CV5 C;  3W96 D;  3KUY B;  1P3K C;  2G5H C;  4Z5T A;  2RVQ C;  3B0D C;  1HQ3 A;  1B6W A;  3AZN D;  5AVB C;  2F8N D;  5B31 A;  3AZL C;  3X1S B;  1P3F C;  5AY8 B;  3A6N A;  4NE6 A;  5B0Z C;  4J8U C;  1S32 D;  3AZE C;  2ARO C;  1P3O C;  3VH6 W;  2HIO A;  5B24 B;  4YS3 C;  3REH B;  3W96 B;  3A1I A;  5E5A C;  3LZ0 B;  3AV1 D;  1M1A D;  4KUD C;  3REK D;  2ZM5 A;  3TU4 D;  5B1L C;  4R8P C;  4J8V C;  3AZN B;  3X1V C;  3W98 A;  4M6B A;  5BNV A;  1HTA A;  2F8N B;  5G49 A;  3X1T A;  1P3L D;  5B2I D;  2FJ7 C;  1H3O A;  2ZY5 A;  1P3M D;  5B33 C;  1S32 B;  4X23 A;  4XZQ D;  3WTP A;  3MGP A;  3AZF D;  2BYK B;  2F8N G;  5JRG D;  3KWQ D;  5AY8 A;  3AV2 C;  1M18 D;  2PYO C;  3AN2 B;  1M1A B;  1KU5 A;  3REK B;  3TU4 B;  5B0Y A;  1F66 B;  3W97 A;  3X1U B;  3AYW C;  5CPI D;  3AZI A;  1KX4 A;  3LEL D;  2Y2O A;  2ARO B;  4ZUX D;  3O62 B;  5GXQ D;  1P34 A;  4H9N B;  1AOI B;  2NZD A;  3B6G D;  3WAA D;  4KGC C;  2DF4 C;  3AFA C;  5CPK D;  1P3M B;  4YM6 A;  4XZQ B;  5GT0 C;  2Y2I A;  2VQR A;  3LZ1 D;  4WU8 D;  2CV5 A;  5B40 B;  3B6F D;  3LJA C;  1M18 B;  1KX5 D;  1P3K A;  1P3B B;  4LD9 D;  3W99 C;  5CPJ D;  2BYK A;  3A1K A;  5CPI B;  5AVB A;  1Q9C A;  4Z66 C;  4UPK A;  3V9R B;  3MNN C;  4JJN B;  2Y2P A;  5GXQ B;  2W8S A;  3AZL A;  3B6G B;  3FDD A;  3MGR C;  1P3F A;  5AV5 C;  3WA9 C;  5B0Z A;  4J8U A;  5CPK B;  1P3A D;  3AZE A;  2ARO A;  3AZM B;  1P3O A;  4CSR A;  1T3U A;  4NFT A;  3UTA D;  4YS3 A;  2YFW B;  5AV6 D;  1KX3 C;  3B6F B;  4CAY B;  5E5A A;  1TZY B;  4Z5T D;  5AV9 C;  4DRA A;  4KUD A;  1P3I D;  1HQ3 D;  5B1L A;  4R8P A;  4J8V A;  3X1V A;  2YFV A;  4H9S C;  5AV8 D;  5B1M C;  1P3G B;  4XUJ C;  4WU9 C;  4KHA B;  3F6T A;  2FJ7 A;  5BO0 B;  3A6N D;  5B33 A;  3IP4 C;  1M19 C;  4ZBJ C;  5GT3 B;  3WKJ C;  4Z2M G;  5AV6 B;  1P3P C;  3AV2 A;  1W2E A;  2PYO A;  3REI C;  4Z5T B;  2BYM A;  4J8X C;  4J8W D;  4WNN A;  1HQ3 B;  4UUZ A;  3AYW A;  5DNM D;  5B2J D;  3MVD D;  5KDM A;  1BH9 A;  5B31 B;  4KGC A;  3C1B C;  3A6N B;  3AFA A;  5GT0 A;  2HIO B;  5BT1 D;  5B31 G;  4H9P A;  3MGQ C;  5AY8 D;  3LJA A;  3W99 A;  5B24 D;  5AVC C;  5B0Y D;  3UT9 C;  2Y2M A;  3W97 D;  3AZI D;  3W98 B;  4Z66 A;  3MNN A;  3LZ0 D;  5BNV B;  3AZJ C;  5G49 B;  3AZG C;  4HGA C;  3X1T B;  1P34 D;  2NZD D;  1H3O B;  2HUE C;  3NQU A;  5AV5 A;  3MGR A;  3WA9 A;  1A7W A;  4H9Q A;  4YM6 D;  3MGS C;  4X23 B;  3WTP B;  3MGP B;  4QLC C;  3KSY A;  1KX3 A;  1TAF A;  2L5A A;  5AV9 A;  5B0Y B;  3KFU G;  3W97 B;  1KX4 B;  3AZI B;  5AVB D;  4H9S A;  1BH8 A;  5B1M A;  4XUJ A;  3AN2 D;  4WU9 A;  1P34 B;  2NZD B;  1U35 C;  1F66 D;  3X1U D;  4J8U D;  4YM6 B;  3WKJ A;  1M19 A;  4DQY B;  2ARO D;  3AZE D;  1P3O D;  3O62 D;  3NQJ A;  4YS3 D;  3AV1 C;  1AOI D;  1P3P A;  2CV5 B;  1P3K B;  3REI A;  4KUD D;  4J8X A;  3B0D B;  4H9R A;  2F8N H;  3AZH C;  5B1L D;  3EG5 B;  5AVB B;  1P3L C;  5B40 D;  3EPL A;  1P3B D;  3AZL B;  2FJ7 D;  3AZF C;  4G91 C;  3C1B A;  1P3F B;  2XD5 A;  5B0Z B;  4J8U B;  5JRG C;  1F1E A;  3AZE B;  1P3O B;  3KWQ C;  4JJN D;  4CSR B;  3UTB C;  4YS3 B;  2Y2K A;  3MGQ A;  1B67 A;  5DNN C;  3AV2 D;  5E5A B;  2PYO D;  3AZM D;  4KUD B;  3LEL C;  1ID3 C;  5AVC A;  3UT9 A;  2Y2Q A;  5B1L B;  4R8P B;  4J8V B;  3AYW D;  3X1V B;  2YFV B;  5FUG A;  3WAA C;  3AZJ A;  1TZY D;  3AZG A;  2Y2J A;  2FJ7 B;  3LZ1 C;  3EPK A;  4KGC D;  4WU8 C;  5B33 B;  3MGS A;  1P3G D;  2JSS A;  5GT0 D;  4QLC A;  1KX5 C;  4LD9 C;  2ZY2 A;  5CPJ C;  3AV2 B;  5CP6 C;  2PYO B;  5GT3 D;  3W99 D;  2BYM B;  4WNN B;  1EQZ C;  4UUZ B;  4E45 A;  3AYW B;  2IO5 C;  3KXB C;  5KDM B;  1BH9 B;  3REL C;  1P3A C;  5B32 C;  3R45 A;  1U35 A;  4KGC B;  2F2A C;  3AFA B;  2NQB C;  5GT0 B;  4WJ3 C;  3AZK C;  5F99 C;  5B31 D;  3AV1 A;  2J8P A;  4H9P B;  4G92 C;  4AWL C;  1P3I C;  2JE5 A;  5GSU C;  3LJA B;  3C1C C;  5JA4 A;  3H0M C;  5AV8 C;  3W99 B;  2HIO D;  4Z2M H;  3AZH A;  1P3L A;  4Z66 B;  3MNN B;  4XUJ D;  4WU9 D;  1ZLA C;  3AZF A;  4EO5 C;  3NQU B;  5AV5 B;  3MGR B;  5C3I C;  3WA9 B;  4H9Q B;  5JRG A;  3W98 D;  3WKJ D;  2CWE A;  3KWQ A;  3UTB A;  3X1T D;  3REJ C;  3KXB B;  4J8W C;  1P3P D;  5DNN A;  1KX3 B;  4H9O A;  5DNM C;  5B2J C;  4X23 D;  1TAF B;  3WTP D;  5AV9 B;  3MVD C;  3LEL A;  3MGP D;  1ID3 A;  4J8X D;  3KUY C;  1BH8 B;  5B1M B;  3WAA A;  4XUJ B;  2F8N K;  4WU9 B;  5B32 G;  3LZ1 A;  3C1B D;  4WU8 A;  1KX4 D;  3WKJ B;  1M19 B;  4ZBJ B;  3X1S C;  3NQJ B;  1KX5 A;  2LY8 A;  4LD9 A;  2G5I C;  3VH6 T;  5CPJ A;  5B24 C;  1P3P B;  5CP6 A;  3REH C;  3W96 C;  3REI B;  4J8X B;  4H9R B;  3LZ0 C;  5AVC D;  3UT9 D;  1EQZ A;  3KXB A;  2CV5 D;  5BNX B;  3AZN C;  1P3K D;  2JCH A;  3REL A;  5B32 A;  1P3A A;  2RVQ D;  3C1B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...