5B0YB

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yB00
2AROB 5F99B 1WWSA 5BNVB 3W98A 1P3ID 5GT3A 4G92C 1M1AD 4Z66C 3AZJD 3WKJB 4KUDB 4J8XB 3X1VD 5B1MD 4ZBJB 5AV9B 3LELA 5AVCB 3RELB 5CPKC 1HTAA 3AZED 2F8NH 1EQZC 5B2ID 2NZDD 3W96B 2PYOB 5BNXB 4Z66A 3WTPB 1KX4B 3X1SD 3B6GB 1P3GD 3A6NC 4H9QB 2BYMB 3LZ0A 3NQJA 5GSUD 4UUZA 3MVDD 3AZHC 3MNNC 5KDMA 4ZUXD 2CV5D 5B40A 4LD9A 4H9RA 1P3MB 4WZSB 3W98D 5CHLB 1P3LA 5GT3D 5GXQC 1P3OC 3REIC 4YM6C 5JA4B 1P3KB 5DNMB 2YFWB 3AZHA 1P3PC 3WA9A 3B6FA 4Z2MH 3LELD 4CAYA 3AN2B 4G91B 4J8VB 2IO5C 4H9PB 3AZLB 5CPJB 4WU9B 5BNVA 1P3OA 3MGPC 5B0YC 3REIA 1S32C 4Z66D 1P3PA 3AZNB 3AYWC 1P3BC 3LZ0D 5GT0B 4KGCB 1U35C 5CPIC 3AZKB 1H3OB 5B40D 3MGPA 1M19C 3X1UC 4LD9D 3C1CB 1KX3B 3LZ1A 1S32A 5CP6C 1ZLAC 1P3LD 1KX4A 1P3BA 3C1BC 4H9QA 5B32C 3WTPE 2NQBB 1U35A 5E5AC 4J8UB 3NQUB 3AZHD 3R45B 5AY8B 3V9RB 3B6FD 3WA9D 1BFMA 5AV6B 1M19A 3X1UA 4XUJC 5CP6A 4HGAC 1ZLAA 1P3MA 3UTAB 3TU4B 1P3OD 1TAFB 3LJAA 3REID 3KUYC 3C1BA 3AV1C 5B32A 5B2JC 5E5AA 5JA4A 1P3KA 1P3PD 4NE3A 3MGQB 5AV5C 3X1VC 5AVBC 5B1MC 5BS7C 1AOIB 1TZYB 4Z5TB 3AZEC 3MGPD 4JJNC 3KUYA 3LZ1D 5CPJA 1P3AB 4QLCB 3AV1A 1S32D 4J8WB 4E45A 5G49B 5B2JA 3WAAC 3B0CW 3X1SC 1KX4D 1P3BD 5AV5A 5C3IC 1P3GC 5AVBA 3AZGB 5BS7A 4H9NB 3REHB 5GSUC 1U35D 3VH5A 5FUGB 1N1JB 4WU8C 4KGCA 3MVDC 1M19D 3X1UD 4JJNA 1H3OA 5CP6D 3W99B 1ZLAD 1P3MD 1WWIA 3WAAA 1Q9CA 2BYKB 3LJAD 4X23B 3C1BD 4YS3B 3X1TB 5B33B 5B32D 5E5AD 2FJ7B 1P3KD 4WU8A 1P3FC 2NQBA 3AZIB 3AV2C 3MGRC 3VH5W 1BH9B 5B24C 3UTAA 3KUYD 5CPJD 3TU4A 3AV1D 1TAFA 5B2JD 1HQ3B 1P3FA 4NE6A 4DRAA 5AV5D 1BH8B 4H9OB 5AVBD 3MGQA 3AV2A 3LZ0C 3MGRA 5B0ZB 1AOIA 2JSSA 4KGCD 1R4VA 5B24A 4Z5TA 4JJND 5B40C 4LD9C 1F66B 3WAAD 1P3LC 2HUEC 3UTBB 3VH6A 1KX5B 3B0DB 4WU8D 3REHA 2NQBD 2F8NK 4CSRB 3WA9C 3B6FC 2F8NB 2PYOC 2AROC 5F99C 4XZQB 3TU4D 3REKB 5DNNB 5BO0B 4X23A 3KWQB 1P3FD 3WKJC 2LY8A 3MGQD 3MGRD 3AV2D 3REJB 3VH6W 1KU5A 3AZFB 1AOID 5AV9C 2PYOA 2L5AA 5AVCC 3UT9B 5B24D 4Z5TD 2AROA 3AFAB 3RELC 5F99A 1P34B 3LZ1C 1ID3B 3W96C 5AV8B 3WKJA 3WTPC 1KX4C 3LELC 3B6GC 1HQ3A 4KUDA 1JFIB 4J8XA 4H9SA 5AV9A 3REHD 5AVCA 3RELA 4R8PB 3W97B 5B31B 4XUJB 4M6BA 3W96A 1P3MC 5BNXA 1P3IB 4NE5A 3WTPA 3B6GA 3LJAC 1M1AB 4X23D 2YFVB 2BYMA 3AZJB 5BT1C 1P3KC 4KHAB 5DNMC 3AZMB 3VH5T 2PYOD 4EO5B 4AWLB 3AN2C 4G91C 4J8VC 3MGSB 2AROD 5F99D 3AZLC 2HIOB 5B1LB 5B2IB 5CPJC 4XZQA 4WU9C 2NZDB 5DNNA 5BO0A 5DNMA 3WKJD 5C3IB 5JRGC 4KUDD 1HQ3D 2YFWA 4J8XD 3AZNC 2F8NG 5AV9D 3REJA 3AN2A 5AVCD 4J8VA 5GT0C 3RELD 4H9PA 4KGCC 4ZUXB 2CV5B 3AZLA 3AZKC 1P34A 4WU9A 1F1EA 3C1CC 3W96D 1KX3C 3W98B 3WTPD 3B6GD 3KXBB 5GT3B 5AV8A 3AZNA 3O62B 1M18B 1JFIA 5GT0A 2NQBC 5JRGB 4J8UC 3LELB 3W97A 5AY8C 4R8PA 3AZKA 5AV6C 3C1CA 1KX3A 4WNNB 3UTAC 4G92B 3TU4C 1B6WA 4XZQD 4Z66B 5DNND 5BT1D 4Z2MG 5DNMD 2YFVA 5B31G 4J8UA 3NQUA 4KHAA 3R45A 3VH6T 3MGQC 3AZMA 5AY8A 3V9RA 3REJD 5AV6A 3AN2D 4UUZB 5CPKB 4J8VD 1AOIC 5KDMB 1EQZB 1TZYC 4Z5TC 3MGSA 3AZLD 1P34D 4WU9D 2HIOA 5B1LA 1P3AC 4QLCC 4J8WC 5AV8D 3A6NB 3AZND 3AZGC 5GT0D 3AZHB 3REHC 3MNNB 1TZYA 4R8PD 3AZKD 3W97D 3C1CD 1KX3D 1P3AA 2RVQC 4QLCA 4J8WA 3W99C 5G49A 5GXQB 1P3OB 3REIB 4YM6B 3KXBA 4X23C 4YS3C 3O62A 3AZGA 3X1TC 4H9NA 5B33C 1M18A 1P3PB 2FJ7C 4J8UD 5FUGA 1N1JA 3AZMD 5AY8D 5JRGA 5AV6D 3AZIC 2IO5B 3W99A 3MGSD 3MGPB 3UTAD 5B0YB 4WNNA 1ULYA 2BYKA 3LZ1B 1S32B 2HIOD 4WV4B 5B1LD 4YS3A 3X1TA 5B33A 3AYWB 2FJ7A 1P3BB 4KUDC 1HQ3C 4NFTA 4J8XC 3AZIA 4H9SC 1U35B 4ZBJC 5B0ZC 5CPIB 1TZYD 5CPKA 1M19B 3X1UB 1BH9A 1EQZA 5CP6B 1P3AD 4QLCD 1F66C 1ZLAB 3B0CT 4J8WD 2CWEA 3LJAB 3KXBD 3C1BB 3A6NA 1BH8A 4H9OA 5B32B 3AZGD 3O62D 3B0BA 5E5AB 5B0ZA 1M18D 3UTBC 1KX5C 3B0DC 3MNNA 5JRGD 4HGAB 2RVQD 1F66A 3W99D 3KUYB 5GXQA 3AV1B 4XZQC 4YS3D 5B2JB 3REKC 3X1TD 4YM6A 5DNNC 5B33D 3UTBA 1KX5A 2FJ7D 5AV5B 3KWQC 3X1VB 5AVBB 5B1MB 3AZID 4CSRA 3REJC 3AZEB 3AZFC 5CPKD 2F8NA 4JJNB 3UT9C 1EQZD 3AFAC 4DRBA 1P34C 5B0YA 3REKA 3WAAB 3X1SB 1P3GB 1ID3C 3KWQA 5AV8C 3AYWA 3A6ND 5GSUB 5B0ZD 4WU8B 3AZFA 3MVDB 5CPIA 3MNND 3UT9A 3AFAA 4R8PC 3W97C 1F66D 5B31C 1ID3A 5GXQD 1P3IC 4YM6D 3KSYA 3UTBD 1M1AC 1P3FB 1KX5D 3AZJC 3AV2B 3MGRB 3AZMC 5B31A 4XUJA 2F8ND 4EO5C 5B24B 4AWLC 5B32G 3MGSC 1P3IA 5B0YD 3REKD 4E44A 2HIOC 5B1LC 5B2IC 1M1AA 2NZDC 3KWQD 3AZJA 3AYWD 3LZ0B 3NQJB 3X1VA 5B1MA 1A7WA 3AZFD 5CPID 3UT9D 3AZEA 5B40B 4LD9B 3AFAD 4H9RB 4ZUXC 2CV5C 1B67A 5B2IA 2NZDA 1ID3D 1P3LB 2HUEB 3X1SA 3W98C 1P3GA 3KXBC 5GT3C 3O62C 5GSUA 1M18C 3WA9B 3B6FB 3MVDA 4CAYB 4ZUXA 2CV5A 5B31D 4XUJD
chains in the Genus database with same CATH superfamily
2AROB 5F99B 1WWSA 5BNVB 3W98A 1P3ID 5GT3A 4G92C 1M1AD 2VQRA 4Z66C 3AZJD 2ZY5A 3WKJB 4KUDB 4J8XB 3X1VD 5B1MD 4ZBJB 5AV9B 3LELA 5AVCB 3RELB 5CPKC 1HTAA 3AZED 2F8NH 1EQZC 5B2ID 2NZDD 3W96B 2PYOB 5BNXB 4Z66A 3WTPB 1KX4B 3X1SD 3B6GB 1P3GD 3A6NC 4H9QB 2BYMB 3LZ0A 3NQJA 5GSUD 4UUZA 3MVDD 3AZHC 3MNNC 5KDMA 4ZUXD 2CV5D 5B40A 4LD9A 4H9RA 1P3MB 4WZSB 3W98D 2F2AC 5CHLB 2Y2KA 1P3LA 5GT3D 5GXQC 1P3OC 3REIC 4YM6C 5JA4B 1P3KB 5DNMB 2YFWB 3AZHA 1P3PC 3WA9A 3B6FA 4Z2MH 3LELD 4CAYA 3AN2B 4G91B 4J8VB 2IO5C 4H9PB 3F6TA 3AZLB 5CPJB 4WU9B 5BNVA 1P3OA 3MGPC 3H0LC 5B0YC 3REIA 1S32C 4Z66D 1P3PA 3A1IA 3AZNB 3AYWC 3EG5B 3LZ0D 1P3BC 5GT0B 4KGCB 1U35C 5CPIC 3AZKB 1H3OB 5B40D 3MGPA 1M19C 3X1UC 4LD9D 3C1CB 1KX3B 3LZ1A 1S32A 5CP6C 1ZLAC 1P3LD 2UWXA 1KX4A 1P3BA 3C1BC 4H9QA 5B32C 3WTPE 2NQBB 1U35A 5E5AC 4J8UB 3NQUB 3AZHD 3R45B 1W2EA 5AY8B 3V9RB 3B6FD 3WA9D 1BFMA 5AV6B 1M19A 3X1UA 4XUJC 3AL0C 5CP6A 4HGAC 1ZLAA 2G5HC 1P3MA 3UTAB 3TU4B 1P3OD 1TAFB 3LJAA 3REID 3KUYC 3C1BA 3AV1C 5B32A 5B2JC 5E5AA 5JA4A 1P3KA 1P3PD 4NE3A 3MGQB 5AV5C 3X1VC 5AVBC 5B1MC 5BS7C 1AOIB 1TZYB 2Y2JA 4Z5TB 2RIQA 3AZEC 3MGPD 2Y2LA 4JJNC 3KUYA 3LZ1D 5CPJA 1P3AB 4QLCB 3AV1A 1S32D 4J8WB 4E45A 5G49B 5B2JA 3WAAC 3B0CW 3X1SC 1KX4D 1P3BD 5AV5A 5C3IC 1P3GC 5AVBA 3AZGB 5BS7A 4H9NB 3REHB 5GSUC 1U35D 3VH5A 5FUGB 1N1JB 4WU8C 4KGCA 3MVDC 1M19D 3X1UD 4JJNA 1H3OA 5CP6D 3W99B 1ZLAD 1P3MD 1WWIA 3WAAA 1Q9CA 2BYKB 3LJAD 4X23B 3C1BD 4YS3B 3X1TB 5B33B 5B32D 3EPLA 5E5AD 2FJ7B 1P3KD 4WU8A 1P3FC 2NQBA 3AZIB 3AV2C 3MGRC 3VH5W 1BH9B 5B24C 3UTAA 3KUYD 5CPJD 3TU4A 3AV1D 1TAFA 2Y2GA 5B2JD 1HQ3B 1P3FA 4NE6A 4DRAA 5AV5D 1BH8B 4H9OB 5AVBD 3MGQA 3AV2A 3LZ0C 3MGRA 5B0ZB 1AOIA 2JSSA 4KGCD 1R4VA 5B24A 4Z5TA 4JJND 5B40C 4LD9C 1F66B 3WAAD 3H0RC 1P3LC 2HUEC 3UTBB 3VH6A 1KX5B 3B0DB 4WU8D 3REHA 2NQBD 2DF4C 2F8NK 4CSRB 3WA9C 3B6FC 2JE5A 2F8NB 2PYOC 2AROC 5F99C 4XZQB 2JCHA 3TU4D 3REKB 5DNNB 3H0MC 5BO0B 4X23A 3KWQB 3EPJA 1P3FD 3WKJC 2LY8A 3MGQD 3MGRD 3AV2D 2J8PA 2Y2MA 3VH6W 3REJB 1KU5A 3AZFB 1AOID 5AV9C 2PYOA 2L5AA 5AVCC 3UT9B 5B24D 4Z5TD 2AROA 3AFAB 3RELC 5F99A 1P34B 3LZ1C 1ID3B 3P5JB 3W96C 5AV8B 3WKJA 3WTPC 1KX4C 3LELC 3B6GC 1HQ3A 4KUDA 2W8SA 1JFIB 4J8XA 4H9SA 5AV9A 3REHD 5AVCA 3RELA 4R8PB 3W97B 5B31B 4XUJB 4M6BA 3W96A 1P3MC 5BNXA 1P3IB 4NE5A 3WTPA 3B6GA 3LJAC 2Y2PA 1M1AB 4X23D 2YFVB 2BYMA 1T3UA 3AZJB 5BT1C 1P3KC 4KHAB 5DNMC 3AZMB 3VH5T 2PYOD 4EO5B 2ZM5A 4AWLB 3AN2C 4G91C 4J8VC 3MGSB 2AROD 5F99D 3AZLC 2HIOB 5B1LB 5B2IB 5CPJC 4XZQA 4WU9C 2NZDB 5DNNA 5BO0A 5DNMA 3WKJD 5C3IB 5JRGC 4KUDD 1HQ3D 2YFWA 4J8XD 3AZNC 2F8NG 3EPKA 5AV9D 3REJA 3AN2A 5AVCD 4J8VA 5GT0C 3RELD 4H9PA 4KGCC 4ZUXB 2CV5B 3AZLA 3AZKC 1P34A 4WU9A 2XD1A 1F1EA 3C1CC 3W96D 1KX3C 3W98B 3WTPD 3KFUG 3B6GD 2ZY4A 3KXBB 5GT3B 5AV8A 3AZNA 3O62B 1M18B 1JFIA 5GT0A 2NQBC 2ZY2A 5JRGB 4J8UC 3LELB 3W97A 5AY8C 4R8PA 3AZKA 5AV6C 3C1CA 1KX3A 4WNNB 3UTAC 4G92B 3TU4C 1B6WA 4XZQD 4Z66B 5DNND 5BT1D 4Z2MG 5DNMD 2YFVA 5B31G 4J8UA 3NQUA 4KHAA 3R45A 3VH6T 3MGQC 3AZMA 2ZY3A 2Y2QA 5AY8A 3V9RA 3REJD 2XD5A 5AV6A 3AN2D 4UUZB 5CPKB 4J8VD 1AOIC 1PZRA 5KDMB 1EQZB 1TZYC 4Z5TC 3MGSA 3AZLD 1P34D 4WU9D 2HIOA 5B1LA 1P3AC 4QLCC 2Y2NA 4J8WC 4WJ3C 5AV8D 3A6NB 3AZND 3AZGC 3A1KA 5GT0D 3AZHB 3REHC 3MNNB 1TZYA 4R8PD 3AZKD 3W97D 3C1CD 1KX3D 1P3AA 2RVQC 4QLCA 4J8WA 3W99C 5G49A 5GXQB 1P3OB 3REIB 4YM6B 3KXBA 4X23C 4YS3C 2BG1A 3O62A 3AZGA 4H9NA 5B33C 3X1TC 1M18A 1P3PB 2FJ7C 4J8UD 5FUGA 1N1JA 3AZMD 5AY8D 5JRGA 5AV6D 3AZIC 2IO5B 3W99A 3MGSD 3MGPB 3UTAD 5B0YB 4WNNA 1ULYA 2BYKA 3LZ1B 1S32B 2HIOD 4WV4B 5B1LD 4YS3A 3X1TA 5B33A 3AYWB 2FJ7A 1P3BB 4KUDC 1HQ3C 4NFTA 4J8XC 3AZIA 4H9SC 2Y2IA 1U35B 4ZBJC 5B0ZC 5CPIB 1TZYD 5CPKA 1M19B 3X1UB 1BH9A 1EQZA 5CP6B 1P3AD 2DQNC 4QLCD 1F66C 1ZLAB 3B0CT 4J8WD 2CWEA 3LJAB 2FFFB 3KXBD 3C1BB 3A6NA 1BH8A 4H9OA 5B32B 3AZGD 3O62D 3B0BA 5E5AB 5B0ZA 1M18D 3UTBC 1KX5C 3B0DC 3MNNA 5JRGD 4HGAB 2RVQD 1F66A 3W99D 3KUYB 5GXQA 3AV1B 4XZQC 4YS3D 5B2JB 3REKC 3X1TD 4YM6A 5DNNC 5B33D 3UTBA 1KX5A 2FJ7D 3EPHA 5AV5B 3KWQC 3X1VB 5AVBB 5B1MB 3AZID 4CSRA 3REJC 4DQYB 3AZEB 3AZFC 5CPKD 2F8NA 4JJNB 3UT9C 1EQZD 3AFAC 4DRBA 1P34C 5B0YA 4UPKA 3REKA 3IP4C 3WAAB 3X1SB 1P3GB 1ID3C 3KWQA 1Z2CB 5AV8C 3AYWA 3A6ND 5GSUB 2G5IC 5B0ZD 4WU8B 3AZFA 3MVDB 5CPIA 3MNND 3UT9A 3AFAA 4R8PC 3W97C 1F66D 5B31C 1ID3A 5GXQD 1P3IC 4YM6D 3KSYA 3UTBD 1M1AC 1P3FB 1KX5D 3AZJC 3AV2B 3MGRB 3AZMC 5B31A 2Y2HA 4XUJA 2F8ND 4EO5C 5B24B 4AWLC 5B32G 3MGSC 1P3IA 5B0YD 3REKD 4E44A 2HIOC 5B1LC 5B2IC 1M1AA 2NZDC 3KWQD 3AZJA 3AYWD 3LZ0B 3NQJB 3X1VA 5B1MA 1A7WA 3AZFD 5CPID 3UT9D 3AZEA 5B40B 4LD9B 3AFAD 4H9RB 4ZUXC 2CV5C 1B67A 5B2IA 2NZDA 1ID3D 1P3LB 2HUEB 3X1SA 3W98C 2Y2OA 1P3GA 3KXBC 5GT3C 3O62C 3FDDA 5GSUA 1M18C 3WA9B 3B6FB 3MVDA 4CAYB 4ZUXA 2CV5A 5B31D 4XUJD
chains in the Genus database with same CATH topology
2AROB 5F99B 1WWSA 5BNVB 3W98A 1P3ID 5GT3A 4G92C 1M1AD 2VQRA 4Z66C 3AZJD 2ZY5A 3WKJB 4KUDB 4J8XB 3X1VD 5B1MD 4ZBJB 5AV9B 3LELA 5AVCB 3RELB 5CPKC 1HTAA 3AZED 2F8NH 1EQZC 5B2ID 2NZDD 3W96B 2PYOB 5BNXB 4Z66A 3WTPB 1KX4B 3X1SD 3B6GB 1P3GD 3A6NC 4H9QB 2BYMB 3LZ0A 3NQJA 5GSUD 4UUZA 3MVDD 3AZHC 3MNNC 5KDMA 4ZUXD 2CV5D 5B40A 4LD9A 4H9RA 1P3MB 4WZSB 3W98D 2F2AC 5CHLB 2Y2KA 1P3LA 5GT3D 5GXQC 1P3OC 3REIC 4YM6C 5JA4B 1P3KB 5DNMB 2YFWB 3AZHA 1P3PC 3WA9A 3B6FA 4Z2MH 3LELD 4CAYA 3AN2B 4G91B 4J8VB 2IO5C 4H9PB 3F6TA 3AZLB 5CPJB 4WU9B 5BNVA 1P3OA 3MGPC 3H0LC 5B0YC 3REIA 1S32C 4Z66D 1P3PA 3A1IA 3AZNB 3AYWC 3EG5B 3LZ0D 1P3BC 5GT0B 4KGCB 1U35C 5CPIC 3AZKB 1H3OB 5B40D 3MGPA 1M19C 3X1UC 4LD9D 3C1CB 1KX3B 3LZ1A 1S32A 5CP6C 1ZLAC 1P3LD 2UWXA 1KX4A 1P3BA 3C1BC 4H9QA 5B32C 3WTPE 2NQBB 1U35A 5E5AC 4J8UB 3NQUB 3AZHD 3R45B 1W2EA 5AY8B 3V9RB 3B6FD 3WA9D 1BFMA 5AV6B 1M19A 3X1UA 4XUJC 3AL0C 5CP6A 4HGAC 1ZLAA 2G5HC 1P3MA 3UTAB 3TU4B 1P3OD 1TAFB 3LJAA 3REID 3KUYC 3C1BA 3AV1C 5B32A 5B2JC 5E5AA 5JA4A 1P3KA 1P3PD 4NE3A 3MGQB 5AV5C 3X1VC 5AVBC 5B1MC 5BS7C 1AOIB 1TZYB 2Y2JA 4Z5TB 2RIQA 3AZEC 3MGPD 2Y2LA 4JJNC 3KUYA 3LZ1D 5CPJA 1P3AB 4QLCB 3AV1A 1S32D 4J8WB 4E45A 5G49B 5B2JA 3WAAC 3B0CW 3X1SC 1KX4D 1P3BD 5AV5A 5C3IC 1P3GC 5AVBA 3AZGB 5BS7A 4H9NB 3REHB 5GSUC 1U35D 3VH5A 5FUGB 1N1JB 4WU8C 4KGCA 3MVDC 1M19D 3X1UD 4JJNA 1H3OA 5CP6D 3W99B 1ZLAD 1P3MD 1WWIA 3WAAA 1Q9CA 2BYKB 3LJAD 4X23B 3C1BD 4YS3B 3X1TB 5B33B 5B32D 3EPLA 5E5AD 2FJ7B 1P3KD 4WU8A 1P3FC 2NQBA 3AZIB 3AV2C 3MGRC 3VH5W 1BH9B 5B24C 3UTAA 3KUYD 5CPJD 3TU4A 3AV1D 1TAFA 2Y2GA 5B2JD 1HQ3B 1P3FA 4NE6A 4DRAA 5AV5D 1BH8B 4H9OB 5AVBD 3MGQA 3AV2A 3LZ0C 3MGRA 5B0ZB 1AOIA 2JSSA 4KGCD 1R4VA 5B24A 4Z5TA 4JJND 5B40C 4LD9C 1F66B 3WAAD 3H0RC 1P3LC 2HUEC 3UTBB 3VH6A 1KX5B 3B0DB 4WU8D 3REHA 2NQBD 2DF4C 2F8NK 4CSRB 3WA9C 3B6FC 2JE5A 2F8NB 2PYOC 2AROC 5F99C 4XZQB 2JCHA 3TU4D 3REKB 5DNNB 3H0MC 5BO0B 4X23A 3KWQB 3EPJA 1P3FD 3WKJC 2LY8A 3MGQD 3MGRD 3AV2D 2J8PA 2Y2MA 3VH6W 3REJB 1KU5A 3AZFB 1AOID 5AV9C 2PYOA 2L5AA 5AVCC 3UT9B 5B24D 4Z5TD 2AROA 3AFAB 3RELC 5F99A 1P34B 3LZ1C 1ID3B 3P5JB 3W96C 5AV8B 3WKJA 3WTPC 1KX4C 3LELC 3B6GC 1HQ3A 4KUDA 2W8SA 1JFIB 4J8XA 4H9SA 5AV9A 3REHD 5AVCA 3RELA 4R8PB 3W97B 5B31B 4XUJB 4M6BA 3W96A 1P3MC 5BNXA 1P3IB 4NE5A 3WTPA 3B6GA 3LJAC 2Y2PA 1M1AB 4X23D 2YFVB 2BYMA 1T3UA 3AZJB 5BT1C 1P3KC 4KHAB 5DNMC 3AZMB 3VH5T 2PYOD 4EO5B 2ZM5A 4AWLB 3AN2C 4G91C 4J8VC 3MGSB 2AROD 5F99D 3AZLC 2HIOB 5B1LB 5B2IB 5CPJC 4XZQA 4WU9C 2NZDB 5DNNA 5BO0A 5DNMA 3WKJD 5C3IB 5JRGC 4KUDD 1HQ3D 2YFWA 4J8XD 3AZNC 2F8NG 3EPKA 5AV9D 3REJA 3AN2A 5AVCD 4J8VA 5GT0C 3RELD 4H9PA 4KGCC 4ZUXB 2CV5B 3AZLA 3AZKC 1P34A 4WU9A 2XD1A 1F1EA 3C1CC 3W96D 1KX3C 3W98B 3WTPD 3KFUG 3B6GD 2ZY4A 3KXBB 5GT3B 5AV8A 3AZNA 3O62B 1M18B 1JFIA 5GT0A 2NQBC 2ZY2A 5JRGB 4J8UC 3LELB 3W97A 5AY8C 4R8PA 3AZKA 5AV6C 3C1CA 1KX3A 4WNNB 3UTAC 4G92B 3TU4C 1B6WA 4XZQD 4Z66B 5DNND 5BT1D 4Z2MG 5DNMD 2YFVA 5B31G 4J8UA 3NQUA 4KHAA 3R45A 3VH6T 3MGQC 3AZMA 2ZY3A 2Y2QA 5AY8A 3V9RA 3REJD 2XD5A 5AV6A 3AN2D 4UUZB 5CPKB 4J8VD 1AOIC 1PZRA 5KDMB 1EQZB 1TZYC 4Z5TC 3MGSA 3AZLD 1P34D 4WU9D 2HIOA 5B1LA 1P3AC 4QLCC 2Y2NA 4J8WC 4WJ3C 5AV8D 3A6NB 3AZND 3AZGC 3A1KA 5GT0D 3AZHB 3REHC 3MNNB 1TZYA 4R8PD 3AZKD 3W97D 3C1CD 1KX3D 1P3AA 2RVQC 4QLCA 4J8WA 3W99C 5G49A 5GXQB 1P3OB 3REIB 4YM6B 3KXBA 4X23C 4YS3C 2BG1A 3O62A 3AZGA 4H9NA 5B33C 3X1TC 1M18A 1P3PB 2FJ7C 4J8UD 5FUGA 1N1JA 3AZMD 5AY8D 5JRGA 5AV6D 3AZIC 2IO5B 3W99A 3MGSD 3MGPB 3UTAD 5B0YB 4WNNA 1ULYA 2BYKA 3LZ1B 1S32B 2HIOD 4WV4B 5B1LD 4YS3A 3X1TA 5B33A 3AYWB 2FJ7A 1P3BB 4KUDC 1HQ3C 4NFTA 4J8XC 3AZIA 4H9SC 2Y2IA 1U35B 4ZBJC 5B0ZC 5CPIB 1TZYD 5CPKA 1M19B 3X1UB 1BH9A 1EQZA 5CP6B 1P3AD 2DQNC 4QLCD 1F66C 1ZLAB 3B0CT 4J8WD 2CWEA 3LJAB 2FFFB 3KXBD 3C1BB 3A6NA 1BH8A 4H9OA 5B32B 3AZGD 3O62D 3B0BA 5E5AB 5B0ZA 1M18D 3UTBC 1KX5C 3B0DC 3MNNA 5JRGD 4HGAB 2RVQD 1F66A 3W99D 3KUYB 5GXQA 3AV1B 4XZQC 4YS3D 5B2JB 3REKC 3X1TD 4YM6A 5DNNC 5B33D 3UTBA 1KX5A 2FJ7D 3EPHA 5AV5B 3KWQC 3X1VB 5AVBB 5B1MB 3AZID 4CSRA 3REJC 4DQYB 3AZEB 3AZFC 5CPKD 2F8NA 4JJNB 3UT9C 1EQZD 3AFAC 4DRBA 1P34C 5B0YA 4UPKA 3REKA 3IP4C 3WAAB 3X1SB 1P3GB 1ID3C 3KWQA 1Z2CB 5AV8C 3AYWA 3A6ND 5GSUB 2G5IC 5B0ZD 4WU8B 3AZFA 3MVDB 5CPIA 3MNND 3UT9A 3AFAA 4R8PC 3W97C 1F66D 5B31C 1ID3A 5GXQD 1P3IC 4YM6D 3KSYA 3UTBD 1M1AC 1P3FB 1KX5D 3AZJC 3AV2B 3MGRB 3AZMC 5B31A 2Y2HA 4XUJA 2F8ND 4EO5C 5B24B 4AWLC 5B32G 3MGSC 1P3IA 5B0YD 3REKD 4E44A 2HIOC 5B1LC 5B2IC 1M1AA 2NZDC 3KWQD 3AZJA 3AYWD 3LZ0B 3NQJB 3X1VA 5B1MA 1A7WA 3AZFD 5CPID 3UT9D 3AZEA 5B40B 4LD9B 3AFAD 4H9RB 4ZUXC 2CV5C 1B67A 5B2IA 2NZDA 1ID3D 1P3LB 2HUEB 3X1SA 3W98C 2Y2OA 1P3GA 3KXBC 5GT3C 3O62C 3FDDA 5GSUA 1M18C 3WA9B 3B6FB 3MVDA 4CAYB 4ZUXA 2CV5A 5B31D 4XUJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO B;  5F99 B;  1WWS A;  5BNV B;  3W98 A;  1P3I D;  5GT3 A;  4G92 C;  1M1A D;  4Z66 C;  3AZJ D;  3WKJ B;  4KUD B;  4J8X B;  3X1V D;  5B1M D;  4ZBJ B;  5AV9 B;  3LEL A;  5AVC B;  3REL B;  5CPK C;  1HTA A;  3AZE D;  2F8N H;  1EQZ C;  5B2I D;  2NZD D;  3W96 B;  2PYO B;  5BNX B;  4Z66 A;  3WTP B;  1KX4 B;  3X1S D;  3B6G B;  1P3G D;  3A6N C;  4H9Q B;  2BYM B;  3LZ0 A;  3NQJ A;  5GSU D;  4UUZ A;  3MVD D;  3AZH C;  3MNN C;  5KDM A;  4ZUX D;  2CV5 D;  5B40 A;  4LD9 A;  4H9R A;  1P3M B;  4WZS B;  3W98 D;  5CHL B;  1P3L A;  5GT3 D;  5GXQ C;  1P3O C;  3REI C;  4YM6 C;  5JA4 B;  1P3K B;  5DNM B;  2YFW B;  3AZH A;  1P3P C;  3WA9 A;  3B6F A;  4Z2M H;  3LEL D;  4CAY A;  3AN2 B;  4G91 B;  4J8V B;  2IO5 C;  4H9P B;  3AZL B;  5CPJ B;  4WU9 B;  5BNV A;  1P3O A;  3MGP C;  5B0Y C;  3REI A;  1S32 C;  4Z66 D;  1P3P A;  3AZN B;  3AYW C;  1P3B C;  3LZ0 D;  5GT0 B;  4KGC B;  1U35 C;  5CPI C;  3AZK B;  1H3O B;  5B40 D;  3MGP A;  1M19 C;  3X1U C;  4LD9 D;  3C1C B;  1KX3 B;  3LZ1 A;  1S32 A;  5CP6 C;  1ZLA C;  1P3L D;  1KX4 A;  1P3B A;  3C1B C;  4H9Q A;  5B32 C;  3WTP E;  2NQB B;  1U35 A;  5E5A C;  4J8U B;  3NQU B;  3AZH D;  3R45 B;  5AY8 B;  3V9R B;  3B6F D;  3WA9 D;  1BFM A;  5AV6 B;  1M19 A;  3X1U A;  4XUJ C;  5CP6 A;  4HGA C;  1ZLA A;  1P3M A;  3UTA B;  3TU4 B;  1P3O D;  1TAF B;  3LJA A;  3REI D;  3KUY C;  3C1B A;  3AV1 C;  5B32 A;  5B2J C;  5E5A A;  5JA4 A;  1P3K A;  1P3P D;  4NE3 A;  3MGQ B;  5AV5 C;  3X1V C;  5AVB C;  5B1M C;  5BS7 C;  1AOI B;  1TZY B;  4Z5T B;  3AZE C;  3MGP D;  4JJN C;  3KUY A;  3LZ1 D;  5CPJ A;  1P3A B;  4QLC B;  3AV1 A;  1S32 D;  4J8W B;  4E45 A;  5G49 B;  5B2J A;  3WAA C;  3B0C W;  3X1S C;  1KX4 D;  1P3B D;  5AV5 A;  5C3I C;  1P3G C;  5AVB A;  3AZG B;  5BS7 A;  4H9N B;  3REH B;  5GSU C;  1U35 D;  3VH5 A;  5FUG B;  1N1J B;  4WU8 C;  4KGC A;  3MVD C;  1M19 D;  3X1U D;  4JJN A;  1H3O A;  5CP6 D;  3W99 B;  1ZLA D;  1P3M D;  1WWI A;  3WAA A;  1Q9C A;  2BYK B;  3LJA D;  4X23 B;  3C1B D;  4YS3 B;  3X1T B;  5B33 B;  5B32 D;  5E5A D;  2FJ7 B;  1P3K D;  4WU8 A;  1P3F C;  2NQB A;  3AZI B;  3AV2 C;  3MGR C;  3VH5 W;  1BH9 B;  5B24 C;  3UTA A;  3KUY D;  5CPJ D;  3TU4 A;  3AV1 D;  1TAF A;  5B2J D;  1HQ3 B;  1P3F A;  4NE6 A;  4DRA A;  5AV5 D;  1BH8 B;  4H9O B;  5AVB D;  3MGQ A;  3AV2 A;  3LZ0 C;  3MGR A;  5B0Z B;  1AOI A;  2JSS A;  4KGC D;  1R4V A;  5B24 A;  4Z5T A;  4JJN D;  5B40 C;  4LD9 C;  1F66 B;  3WAA D;  1P3L C;  2HUE C;  3UTB B;  3VH6 A;  1KX5 B;  3B0D B;  4WU8 D;  3REH A;  2NQB D;  2F8N K;  4CSR B;  3WA9 C;  3B6F C;  2F8N B;  2PYO C;  2ARO C;  5F99 C;  4XZQ B;  3TU4 D;  3REK B;  5DNN B;  5BO0 B;  4X23 A;  3KWQ B;  1P3F D;  3WKJ C;  2LY8 A;  3MGQ D;  3MGR D;  3AV2 D;  3REJ B;  3VH6 W;  1KU5 A;  3AZF B;  1AOI D;  5AV9 C;  2PYO A;  2L5A A;  5AVC C;  3UT9 B;  5B24 D;  4Z5T D;  2ARO A;  3AFA B;  3REL C;  5F99 A;  1P34 B;  3LZ1 C;  1ID3 B;  3W96 C;  5AV8 B;  3WKJ A;  3WTP C;  1KX4 C;  3LEL C;  3B6G C;  1HQ3 A;  4KUD A;  1JFI B;  4J8X A;  4H9S A;  5AV9 A;  3REH D;  5AVC A;  3REL A;  4R8P B;  3W97 B;  5B31 B;  4XUJ B;  4M6B A;  3W96 A;  1P3M C;  5BNX A;  1P3I B;  4NE5 A;  3WTP A;  3B6G A;  3LJA C;  1M1A B;  4X23 D;  2YFV B;  2BYM A;  3AZJ B;  5BT1 C;  1P3K C;  4KHA B;  5DNM C;  3AZM B;  3VH5 T;  2PYO D;  4EO5 B;  4AWL B;  3AN2 C;  4G91 C;  4J8V C;  3MGS B;  2ARO D;  5F99 D;  3AZL C;  2HIO B;  5B1L B;  5B2I B;  5CPJ C;  4XZQ A;  4WU9 C;  2NZD B;  5DNN A;  5BO0 A;  5DNM A;  3WKJ D;  5C3I B;  5JRG C;  4KUD D;  1HQ3 D;  2YFW A;  4J8X D;  3AZN C;  2F8N G;  5AV9 D;  3REJ A;  3AN2 A;  5AVC D;  4J8V A;  5GT0 C;  3REL D;  4H9P A;  4KGC C;  4ZUX B;  2CV5 B;  3AZL A;  3AZK C;  1P34 A;  4WU9 A;  1F1E A;  3C1C C;  3W96 D;  1KX3 C;  3W98 B;  3WTP D;  3B6G D;  3KXB B;  5GT3 B;  5AV8 A;  3AZN A;  3O62 B;  1M18 B;  1JFI A;  5GT0 A;  2NQB C;  5JRG B;  4J8U C;  3LEL B;  3W97 A;  5AY8 C;  4R8P A;  3AZK A;  5AV6 C;  3C1C A;  1KX3 A;  4WNN B;  3UTA C;  4G92 B;  3TU4 C;  1B6W A;  4XZQ D;  4Z66 B;  5DNN D;  5BT1 D;  4Z2M G;  5DNM D;  2YFV A;  5B31 G;  4J8U A;  3NQU A;  4KHA A;  3R45 A;  3VH6 T;  3MGQ C;  3AZM A;  5AY8 A;  3V9R A;  3REJ D;  5AV6 A;  3AN2 D;  4UUZ B;  5CPK B;  4J8V D;  1AOI C;  5KDM B;  1EQZ B;  1TZY C;  4Z5T C;  3MGS A;  3AZL D;  1P34 D;  4WU9 D;  2HIO A;  5B1L A;  1P3A C;  4QLC C;  4J8W C;  5AV8 D;  3A6N B;  3AZN D;  3AZG C;  5GT0 D;  3AZH B;  3REH C;  3MNN B;  1TZY A;  4R8P D;  3AZK D;  3W97 D;  3C1C D;  1KX3 D;  1P3A A;  2RVQ C;  4QLC A;  4J8W A;  3W99 C;  5G49 A;  5GXQ B;  1P3O B;  3REI B;  4YM6 B;  3KXB A;  4X23 C;  4YS3 C;  3O62 A;  3AZG A;  3X1T C;  4H9N A;  5B33 C;  1M18 A;  1P3P B;  2FJ7 C;  4J8U D;  5FUG A;  1N1J A;  3AZM D;  5AY8 D;  5JRG A;  5AV6 D;  3AZI C;  2IO5 B;  3W99 A;  3MGS D;  3MGP B;  3UTA D;  5B0Y B;  4WNN A;  1ULY A;  2BYK A;  3LZ1 B;  1S32 B;  2HIO D;  4WV4 B;  5B1L D;  4YS3 A;  3X1T A;  5B33 A;  3AYW B;  2FJ7 A;  1P3B B;  4KUD C;  1HQ3 C;  4NFT A;  4J8X C;  3AZI A;  4H9S C;  1U35 B;  4ZBJ C;  5B0Z C;  5CPI B;  1TZY D;  5CPK A;  1M19 B;  3X1U B;  1BH9 A;  1EQZ A;  5CP6 B;  1P3A D;  4QLC D;  1F66 C;  1ZLA B;  3B0C T;  4J8W D;  2CWE A;  3LJA B;  3KXB D;  3C1B B;  3A6N A;  1BH8 A;  4H9O A;  5B32 B;  3AZG D;  3O62 D;  3B0B A;  5E5A B;  5B0Z A;  1M18 D;  3UTB C;  1KX5 C;  3B0D C;  3MNN A;  5JRG D;  4HGA B;  2RVQ D;  1F66 A;  3W99 D;  3KUY B;  5GXQ A;  3AV1 B;  4XZQ C;  4YS3 D;  5B2J B;  3REK C;  3X1T D;  4YM6 A;  5DNN C;  5B33 D;  3UTB A;  1KX5 A;  2FJ7 D;  5AV5 B;  3KWQ C;  3X1V B;  5AVB B;  5B1M B;  3AZI D;  4CSR A;  3REJ C;  3AZE B;  3AZF C;  5CPK D;  2F8N A;  4JJN B;  3UT9 C;  1EQZ D;  3AFA C;  4DRB A;  1P34 C;  5B0Y A;  3REK A;  3WAA B;  3X1S B;  1P3G B;  1ID3 C;  3KWQ A;  5AV8 C;  3AYW A;  3A6N D;  5GSU B;  5B0Z D;  4WU8 B;  3AZF A;  3MVD B;  5CPI A;  3MNN D;  3UT9 A;  3AFA A;  4R8P C;  3W97 C;  1F66 D;  5B31 C;  1ID3 A;  5GXQ D;  1P3I C;  4YM6 D;  3KSY A;  3UTB D;  1M1A C;  1P3F B;  1KX5 D;  3AZJ C;  3AV2 B;  3MGR B;  3AZM C;  5B31 A;  4XUJ A;  2F8N D;  4EO5 C;  5B24 B;  4AWL C;  5B32 G;  3MGS C;  1P3I A;  5B0Y D;  3REK D;  4E44 A;  2HIO C;  5B1L C;  5B2I C;  1M1A A;  2NZD C;  3KWQ D;  3AZJ A;  3AYW D;  3LZ0 B;  3NQJ B;  3X1V A;  5B1M A;  1A7W A;  3AZF D;  5CPI D;  3UT9 D;  3AZE A;  5B40 B;  4LD9 B;  3AFA D;  4H9R B;  4ZUX C;  2CV5 C;  1B67 A;  5B2I A;  2NZD A;  1ID3 D;  1P3L B;  2HUE B;  3X1S A;  3W98 C;  1P3G A;  3KXB C;  5GT3 C;  3O62 C;  5GSU A;  1M18 C;  3WA9 B;  3B6F B;  3MVD A;  4CAY B;  4ZUX A;  2CV5 A;  5B31 D;  4XUJ D; 
#chains in the Genus database with same CATH topology
 2ARO B;  5F99 B;  1WWS A;  5BNV B;  3W98 A;  1P3I D;  5GT3 A;  4G92 C;  1M1A D;  2VQR A;  4Z66 C;  3AZJ D;  2ZY5 A;  3WKJ B;  4KUD B;  4J8X B;  3X1V D;  5B1M D;  4ZBJ B;  5AV9 B;  3LEL A;  5AVC B;  3REL B;  5CPK C;  1HTA A;  3AZE D;  2F8N H;  1EQZ C;  5B2I D;  2NZD D;  3W96 B;  2PYO B;  5BNX B;  4Z66 A;  3WTP B;  1KX4 B;  3X1S D;  3B6G B;  1P3G D;  3A6N C;  4H9Q B;  2BYM B;  3LZ0 A;  3NQJ A;  5GSU D;  4UUZ A;  3MVD D;  3AZH C;  3MNN C;  5KDM A;  4ZUX D;  2CV5 D;  5B40 A;  4LD9 A;  4H9R A;  1P3M B;  4WZS B;  3W98 D;  2F2A C;  5CHL B;  2Y2K A;  1P3L A;  5GT3 D;  5GXQ C;  1P3O C;  3REI C;  4YM6 C;  5JA4 B;  1P3K B;  5DNM B;  2YFW B;  3AZH A;  1P3P C;  3WA9 A;  3B6F A;  4Z2M H;  3LEL D;  4CAY A;  3AN2 B;  4G91 B;  4J8V B;  2IO5 C;  4H9P B;  3F6T A;  3AZL B;  5CPJ B;  4WU9 B;  5BNV A;  1P3O A;  3MGP C;  3H0L C;  5B0Y C;  3REI A;  1S32 C;  4Z66 D;  1P3P A;  3A1I A;  3AZN B;  3AYW C;  3EG5 B;  3LZ0 D;  1P3B C;  5GT0 B;  4KGC B;  1U35 C;  5CPI C;  3AZK B;  1H3O B;  5B40 D;  3MGP A;  1M19 C;  3X1U C;  4LD9 D;  3C1C B;  1KX3 B;  3LZ1 A;  1S32 A;  5CP6 C;  1ZLA C;  1P3L D;  2UWX A;  1KX4 A;  1P3B A;  3C1B C;  4H9Q A;  5B32 C;  3WTP E;  2NQB B;  1U35 A;  5E5A C;  4J8U B;  3NQU B;  3AZH D;  3R45 B;  1W2E A;  5AY8 B;  3V9R B;  3B6F D;  3WA9 D;  1BFM A;  5AV6 B;  1M19 A;  3X1U A;  4XUJ C;  3AL0 C;  5CP6 A;  4HGA C;  1ZLA A;  2G5H C;  1P3M A;  3UTA B;  3TU4 B;  1P3O D;  1TAF B;  3LJA A;  3REI D;  3KUY C;  3C1B A;  3AV1 C;  5B32 A;  5B2J C;  5E5A A;  5JA4 A;  1P3K A;  1P3P D;  4NE3 A;  3MGQ B;  5AV5 C;  3X1V C;  5AVB C;  5B1M C;  5BS7 C;  1AOI B;  1TZY B;  2Y2J A;  4Z5T B;  2RIQ A;  3AZE C;  3MGP D;  2Y2L A;  4JJN C;  3KUY A;  3LZ1 D;  5CPJ A;  1P3A B;  4QLC B;  3AV1 A;  1S32 D;  4J8W B;  4E45 A;  5G49 B;  5B2J A;  3WAA C;  3B0C W;  3X1S C;  1KX4 D;  1P3B D;  5AV5 A;  5C3I C;  1P3G C;  5AVB A;  3AZG B;  5BS7 A;  4H9N B;  3REH B;  5GSU C;  1U35 D;  3VH5 A;  5FUG B;  1N1J B;  4WU8 C;  4KGC A;  3MVD C;  1M19 D;  3X1U D;  4JJN A;  1H3O A;  5CP6 D;  3W99 B;  1ZLA D;  1P3M D;  1WWI A;  3WAA A;  1Q9C A;  2BYK B;  3LJA D;  4X23 B;  3C1B D;  4YS3 B;  3X1T B;  5B33 B;  5B32 D;  3EPL A;  5E5A D;  2FJ7 B;  1P3K D;  4WU8 A;  1P3F C;  2NQB A;  3AZI B;  3AV2 C;  3MGR C;  3VH5 W;  1BH9 B;  5B24 C;  3UTA A;  3KUY D;  5CPJ D;  3TU4 A;  3AV1 D;  1TAF A;  2Y2G A;  5B2J D;  1HQ3 B;  1P3F A;  4NE6 A;  4DRA A;  5AV5 D;  1BH8 B;  4H9O B;  5AVB D;  3MGQ A;  3AV2 A;  3LZ0 C;  3MGR A;  5B0Z B;  1AOI A;  2JSS A;  4KGC D;  1R4V A;  5B24 A;  4Z5T A;  4JJN D;  5B40 C;  4LD9 C;  1F66 B;  3WAA D;  3H0R C;  1P3L C;  2HUE C;  3UTB B;  3VH6 A;  1KX5 B;  3B0D B;  4WU8 D;  3REH A;  2NQB D;  2DF4 C;  2F8N K;  4CSR B;  3WA9 C;  3B6F C;  2JE5 A;  2F8N B;  2PYO C;  2ARO C;  5F99 C;  4XZQ B;  2JCH A;  3TU4 D;  3REK B;  5DNN B;  3H0M C;  5BO0 B;  4X23 A;  3KWQ B;  3EPJ A;  1P3F D;  3WKJ C;  2LY8 A;  3MGQ D;  3MGR D;  3AV2 D;  2J8P A;  2Y2M A;  3VH6 W;  3REJ B;  1KU5 A;  3AZF B;  1AOI D;  5AV9 C;  2PYO A;  2L5A A;  5AVC C;  3UT9 B;  5B24 D;  4Z5T D;  2ARO A;  3AFA B;  3REL C;  5F99 A;  1P34 B;  3LZ1 C;  1ID3 B;  3P5J B;  3W96 C;  5AV8 B;  3WKJ A;  3WTP C;  1KX4 C;  3LEL C;  3B6G C;  1HQ3 A;  4KUD A;  2W8S A;  1JFI B;  4J8X A;  4H9S A;  5AV9 A;  3REH D;  5AVC A;  3REL A;  4R8P B;  3W97 B;  5B31 B;  4XUJ B;  4M6B A;  3W96 A;  1P3M C;  5BNX A;  1P3I B;  4NE5 A;  3WTP A;  3B6G A;  3LJA C;  2Y2P A;  1M1A B;  4X23 D;  2YFV B;  2BYM A;  1T3U A;  3AZJ B;  5BT1 C;  1P3K C;  4KHA B;  5DNM C;  3AZM B;  3VH5 T;  2PYO D;  4EO5 B;  2ZM5 A;  4AWL B;  3AN2 C;  4G91 C;  4J8V C;  3MGS B;  2ARO D;  5F99 D;  3AZL C;  2HIO B;  5B1L B;  5B2I B;  5CPJ C;  4XZQ A;  4WU9 C;  2NZD B;  5DNN A;  5BO0 A;  5DNM A;  3WKJ D;  5C3I B;  5JRG C;  4KUD D;  1HQ3 D;  2YFW A;  4J8X D;  3AZN C;  2F8N G;  3EPK A;  5AV9 D;  3REJ A;  3AN2 A;  5AVC D;  4J8V A;  5GT0 C;  3REL D;  4H9P A;  4KGC C;  4ZUX B;  2CV5 B;  3AZL A;  3AZK C;  1P34 A;  4WU9 A;  2XD1 A;  1F1E A;  3C1C C;  3W96 D;  1KX3 C;  3W98 B;  3WTP D;  3KFU G;  3B6G D;  2ZY4 A;  3KXB B;  5GT3 B;  5AV8 A;  3AZN A;  3O62 B;  1M18 B;  1JFI A;  5GT0 A;  2NQB C;  2ZY2 A;  5JRG B;  4J8U C;  3LEL B;  3W97 A;  5AY8 C;  4R8P A;  3AZK A;  5AV6 C;  3C1C A;  1KX3 A;  4WNN B;  3UTA C;  4G92 B;  3TU4 C;  1B6W A;  4XZQ D;  4Z66 B;  5DNN D;  5BT1 D;  4Z2M G;  5DNM D;  2YFV A;  5B31 G;  4J8U A;  3NQU A;  4KHA A;  3R45 A;  3VH6 T;  3MGQ C;  3AZM A;  2ZY3 A;  2Y2Q A;  5AY8 A;  3V9R A;  3REJ D;  2XD5 A;  5AV6 A;  3AN2 D;  4UUZ B;  5CPK B;  4J8V D;  1AOI C;  1PZR A;  5KDM B;  1EQZ B;  1TZY C;  4Z5T C;  3MGS A;  3AZL D;  1P34 D;  4WU9 D;  2HIO A;  5B1L A;  1P3A C;  4QLC C;  2Y2N A;  4J8W C;  4WJ3 C;  5AV8 D;  3A6N B;  3AZN D;  3AZG C;  3A1K A;  5GT0 D;  3AZH B;  3REH C;  3MNN B;  1TZY A;  4R8P D;  3AZK D;  3W97 D;  3C1C D;  1KX3 D;  1P3A A;  2RVQ C;  4QLC A;  4J8W A;  3W99 C;  5G49 A;  5GXQ B;  1P3O B;  3REI B;  4YM6 B;  3KXB A;  4X23 C;  4YS3 C;  2BG1 A;  3O62 A;  3AZG A;  4H9N A;  5B33 C;  3X1T C;  1M18 A;  1P3P B;  2FJ7 C;  4J8U D;  5FUG A;  1N1J A;  3AZM D;  5AY8 D;  5JRG A;  5AV6 D;  3AZI C;  2IO5 B;  3W99 A;  3MGS D;  3MGP B;  3UTA D;  5B0Y B;  4WNN A;  1ULY A;  2BYK A;  3LZ1 B;  1S32 B;  2HIO D;  4WV4 B;  5B1L D;  4YS3 A;  3X1T A;  5B33 A;  3AYW B;  2FJ7 A;  1P3B B;  4KUD C;  1HQ3 C;  4NFT A;  4J8X C;  3AZI A;  4H9S C;  2Y2I A;  1U35 B;  4ZBJ C;  5B0Z C;  5CPI B;  1TZY D;  5CPK A;  1M19 B;  3X1U B;  1BH9 A;  1EQZ A;  5CP6 B;  1P3A D;  2DQN C;  4QLC D;  1F66 C;  1ZLA B;  3B0C T;  4J8W D;  2CWE A;  3LJA B;  2FFF B;  3KXB D;  3C1B B;  3A6N A;  1BH8 A;  4H9O A;  5B32 B;  3AZG D;  3O62 D;  3B0B A;  5E5A B;  5B0Z A;  1M18 D;  3UTB C;  1KX5 C;  3B0D C;  3MNN A;  5JRG D;  4HGA B;  2RVQ D;  1F66 A;  3W99 D;  3KUY B;  5GXQ A;  3AV1 B;  4XZQ C;  4YS3 D;  5B2J B;  3REK C;  3X1T D;  4YM6 A;  5DNN C;  5B33 D;  3UTB A;  1KX5 A;  2FJ7 D;  3EPH A;  5AV5 B;  3KWQ C;  3X1V B;  5AVB B;  5B1M B;  3AZI D;  4CSR A;  3REJ C;  4DQY B;  3AZE B;  3AZF C;  5CPK D;  2F8N A;  4JJN B;  3UT9 C;  1EQZ D;  3AFA C;  4DRB A;  1P34 C;  5B0Y A;  4UPK A;  3REK A;  3IP4 C;  3WAA B;  3X1S B;  1P3G B;  1ID3 C;  3KWQ A;  1Z2C B;  5AV8 C;  3AYW A;  3A6N D;  5GSU B;  2G5I C;  5B0Z D;  4WU8 B;  3AZF A;  3MVD B;  5CPI A;  3MNN D;  3UT9 A;  3AFA A;  4R8P C;  3W97 C;  1F66 D;  5B31 C;  1ID3 A;  5GXQ D;  1P3I C;  4YM6 D;  3KSY A;  3UTB D;  1M1A C;  1P3F B;  1KX5 D;  3AZJ C;  3AV2 B;  3MGR B;  3AZM C;  5B31 A;  2Y2H A;  4XUJ A;  2F8N D;  4EO5 C;  5B24 B;  4AWL C;  5B32 G;  3MGS C;  1P3I A;  5B0Y D;  3REK D;  4E44 A;  2HIO C;  5B1L C;  5B2I C;  1M1A A;  2NZD C;  3KWQ D;  3AZJ A;  3AYW D;  3LZ0 B;  3NQJ B;  3X1V A;  5B1M A;  1A7W A;  3AZF D;  5CPI D;  3UT9 D;  3AZE A;  5B40 B;  4LD9 B;  3AFA D;  4H9R B;  4ZUX C;  2CV5 C;  1B67 A;  5B2I A;  2NZD A;  1ID3 D;  1P3L B;  2HUE B;  3X1S A;  3W98 C;  2Y2O A;  1P3G A;  3KXB C;  5GT3 C;  3O62 C;  3FDD A;  5GSU A;  1M18 C;  3WA9 B;  3B6F B;  3MVD A;  4CAY B;  4ZUX A;  2CV5 A;  5B31 D;  4XUJ D; 
#chains in the Genus database with same CATH homology
 2ARO B;  5F99 B;  1WWS A;  5BNV B;  3W98 A;  1P3I D;  5GT3 A;  4G92 C;  1M1A D;  2VQR A;  4Z66 C;  3AZJ D;  2ZY5 A;  3WKJ B;  4KUD B;  4J8X B;  3X1V D;  5B1M D;  4ZBJ B;  5AV9 B;  3LEL A;  5AVC B;  3REL B;  5CPK C;  1HTA A;  3AZE D;  2F8N H;  1EQZ C;  5B2I D;  2NZD D;  3W96 B;  2PYO B;  5BNX B;  4Z66 A;  3WTP B;  1KX4 B;  3X1S D;  3B6G B;  1P3G D;  3A6N C;  4H9Q B;  2BYM B;  3LZ0 A;  3NQJ A;  5GSU D;  4UUZ A;  3MVD D;  3AZH C;  3MNN C;  5KDM A;  4ZUX D;  2CV5 D;  5B40 A;  4LD9 A;  4H9R A;  1P3M B;  4WZS B;  3W98 D;  2F2A C;  5CHL B;  2Y2K A;  1P3L A;  5GT3 D;  5GXQ C;  1P3O C;  3REI C;  4YM6 C;  5JA4 B;  1P3K B;  5DNM B;  2YFW B;  3AZH A;  1P3P C;  3WA9 A;  3B6F A;  4Z2M H;  3LEL D;  4CAY A;  3AN2 B;  4G91 B;  4J8V B;  2IO5 C;  4H9P B;  3F6T A;  3AZL B;  5CPJ B;  4WU9 B;  5BNV A;  1P3O A;  3MGP C;  3H0L C;  5B0Y C;  3REI A;  1S32 C;  4Z66 D;  1P3P A;  3A1I A;  3AZN B;  3AYW C;  3EG5 B;  3LZ0 D;  1P3B C;  5GT0 B;  4KGC B;  1U35 C;  5CPI C;  3AZK B;  1H3O B;  5B40 D;  3MGP A;  1M19 C;  3X1U C;  4LD9 D;  3C1C B;  1KX3 B;  3LZ1 A;  1S32 A;  5CP6 C;  1ZLA C;  1P3L D;  2UWX A;  1KX4 A;  1P3B A;  3C1B C;  4H9Q A;  5B32 C;  3WTP E;  2NQB B;  1U35 A;  5E5A C;  4J8U B;  3NQU B;  3AZH D;  3R45 B;  1W2E A;  5AY8 B;  3V9R B;  3B6F D;  3WA9 D;  1BFM A;  5AV6 B;  1M19 A;  3X1U A;  4XUJ C;  3AL0 C;  5CP6 A;  4HGA C;  1ZLA A;  2G5H C;  1P3M A;  3UTA B;  3TU4 B;  1P3O D;  1TAF B;  3LJA A;  3REI D;  3KUY C;  3C1B A;  3AV1 C;  5B32 A;  5B2J C;  5E5A A;  5JA4 A;  1P3K A;  1P3P D;  4NE3 A;  3MGQ B;  5AV5 C;  3X1V C;  5AVB C;  5B1M C;  5BS7 C;  1AOI B;  1TZY B;  2Y2J A;  4Z5T B;  2RIQ A;  3AZE C;  3MGP D;  2Y2L A;  4JJN C;  3KUY A;  3LZ1 D;  5CPJ A;  1P3A B;  4QLC B;  3AV1 A;  1S32 D;  4J8W B;  4E45 A;  5G49 B;  5B2J A;  3WAA C;  3B0C W;  3X1S C;  1KX4 D;  1P3B D;  5AV5 A;  5C3I C;  1P3G C;  5AVB A;  3AZG B;  5BS7 A;  4H9N B;  3REH B;  5GSU C;  1U35 D;  3VH5 A;  5FUG B;  1N1J B;  4WU8 C;  4KGC A;  3MVD C;  1M19 D;  3X1U D;  4JJN A;  1H3O A;  5CP6 D;  3W99 B;  1ZLA D;  1P3M D;  1WWI A;  3WAA A;  1Q9C A;  2BYK B;  3LJA D;  4X23 B;  3C1B D;  4YS3 B;  3X1T B;  5B33 B;  5B32 D;  3EPL A;  5E5A D;  2FJ7 B;  1P3K D;  4WU8 A;  1P3F C;  2NQB A;  3AZI B;  3AV2 C;  3MGR C;  3VH5 W;  1BH9 B;  5B24 C;  3UTA A;  3KUY D;  5CPJ D;  3TU4 A;  3AV1 D;  1TAF A;  2Y2G A;  5B2J D;  1HQ3 B;  1P3F A;  4NE6 A;  4DRA A;  5AV5 D;  1BH8 B;  4H9O B;  5AVB D;  3MGQ A;  3AV2 A;  3LZ0 C;  3MGR A;  5B0Z B;  1AOI A;  2JSS A;  4KGC D;  1R4V A;  5B24 A;  4Z5T A;  4JJN D;  5B40 C;  4LD9 C;  1F66 B;  3WAA D;  3H0R C;  1P3L C;  2HUE C;  3UTB B;  3VH6 A;  1KX5 B;  3B0D B;  4WU8 D;  3REH A;  2NQB D;  2DF4 C;  2F8N K;  4CSR B;  3WA9 C;  3B6F C;  2JE5 A;  2F8N B;  2PYO C;  2ARO C;  5F99 C;  4XZQ B;  2JCH A;  3TU4 D;  3REK B;  5DNN B;  3H0M C;  5BO0 B;  4X23 A;  3KWQ B;  3EPJ A;  1P3F D;  3WKJ C;  2LY8 A;  3MGQ D;  3MGR D;  3AV2 D;  2J8P A;  2Y2M A;  3VH6 W;  3REJ B;  1KU5 A;  3AZF B;  1AOI D;  5AV9 C;  2PYO A;  2L5A A;  5AVC C;  3UT9 B;  5B24 D;  4Z5T D;  2ARO A;  3AFA B;  3REL C;  5F99 A;  1P34 B;  3LZ1 C;  1ID3 B;  3P5J B;  3W96 C;  5AV8 B;  3WKJ A;  3WTP C;  1KX4 C;  3LEL C;  3B6G C;  1HQ3 A;  4KUD A;  2W8S A;  1JFI B;  4J8X A;  4H9S A;  5AV9 A;  3REH D;  5AVC A;  3REL A;  4R8P B;  3W97 B;  5B31 B;  4XUJ B;  4M6B A;  3W96 A;  1P3M C;  5BNX A;  1P3I B;  4NE5 A;  3WTP A;  3B6G A;  3LJA C;  2Y2P A;  1M1A B;  4X23 D;  2YFV B;  2BYM A;  1T3U A;  3AZJ B;  5BT1 C;  1P3K C;  4KHA B;  5DNM C;  3AZM B;  3VH5 T;  2PYO D;  4EO5 B;  2ZM5 A;  4AWL B;  3AN2 C;  4G91 C;  4J8V C;  3MGS B;  2ARO D;  5F99 D;  3AZL C;  2HIO B;  5B1L B;  5B2I B;  5CPJ C;  4XZQ A;  4WU9 C;  2NZD B;  5DNN A;  5BO0 A;  5DNM A;  3WKJ D;  5C3I B;  5JRG C;  4KUD D;  1HQ3 D;  2YFW A;  4J8X D;  3AZN C;  2F8N G;  3EPK A;  5AV9 D;  3REJ A;  3AN2 A;  5AVC D;  4J8V A;  5GT0 C;  3REL D;  4H9P A;  4KGC C;  4ZUX B;  2CV5 B;  3AZL A;  3AZK C;  1P34 A;  4WU9 A;  2XD1 A;  1F1E A;  3C1C C;  3W96 D;  1KX3 C;  3W98 B;  3WTP D;  3KFU G;  3B6G D;  2ZY4 A;  3KXB B;  5GT3 B;  5AV8 A;  3AZN A;  3O62 B;  1M18 B;  1JFI A;  5GT0 A;  2NQB C;  2ZY2 A;  5JRG B;  4J8U C;  3LEL B;  3W97 A;  5AY8 C;  4R8P A;  3AZK A;  5AV6 C;  3C1C A;  1KX3 A;  4WNN B;  3UTA C;  4G92 B;  3TU4 C;  1B6W A;  4XZQ D;  4Z66 B;  5DNN D;  5BT1 D;  4Z2M G;  5DNM D;  2YFV A;  5B31 G;  4J8U A;  3NQU A;  4KHA A;  3R45 A;  3VH6 T;  3MGQ C;  3AZM A;  2ZY3 A;  2Y2Q A;  5AY8 A;  3V9R A;  3REJ D;  2XD5 A;  5AV6 A;  3AN2 D;  4UUZ B;  5CPK B;  4J8V D;  1AOI C;  1PZR A;  5KDM B;  1EQZ B;  1TZY C;  4Z5T C;  3MGS A;  3AZL D;  1P34 D;  4WU9 D;  2HIO A;  5B1L A;  1P3A C;  4QLC C;  2Y2N A;  4J8W C;  4WJ3 C;  5AV8 D;  3A6N B;  3AZN D;  3AZG C;  3A1K A;  5GT0 D;  3AZH B;  3REH C;  3MNN B;  1TZY A;  4R8P D;  3AZK D;  3W97 D;  3C1C D;  1KX3 D;  1P3A A;  2RVQ C;  4QLC A;  4J8W A;  3W99 C;  5G49 A;  5GXQ B;  1P3O B;  3REI B;  4YM6 B;  3KXB A;  4X23 C;  4YS3 C;  2BG1 A;  3O62 A;  3AZG A;  4H9N A;  5B33 C;  3X1T C;  1M18 A;  1P3P B;  2FJ7 C;  4J8U D;  5FUG A;  1N1J A;  3AZM D;  5AY8 D;  5JRG A;  5AV6 D;  3AZI C;  2IO5 B;  3W99 A;  3MGS D;  3MGP B;  3UTA D;  5B0Y B;  4WNN A;  1ULY A;  2BYK A;  3LZ1 B;  1S32 B;  2HIO D;  4WV4 B;  5B1L D;  4YS3 A;  3X1T A;  5B33 A;  3AYW B;  2FJ7 A;  1P3B B;  4KUD C;  1HQ3 C;  4NFT A;  4J8X C;  3AZI A;  4H9S C;  2Y2I A;  1U35 B;  4ZBJ C;  5B0Z C;  5CPI B;  1TZY D;  5CPK A;  1M19 B;  3X1U B;  1BH9 A;  1EQZ A;  5CP6 B;  1P3A D;  2DQN C;  4QLC D;  1F66 C;  1ZLA B;  3B0C T;  4J8W D;  2CWE A;  3LJA B;  2FFF B;  3KXB D;  3C1B B;  3A6N A;  1BH8 A;  4H9O A;  5B32 B;  3AZG D;  3O62 D;  3B0B A;  5E5A B;  5B0Z A;  1M18 D;  3UTB C;  1KX5 C;  3B0D C;  3MNN A;  5JRG D;  4HGA B;  2RVQ D;  1F66 A;  3W99 D;  3KUY B;  5GXQ A;  3AV1 B;  4XZQ C;  4YS3 D;  5B2J B;  3REK C;  3X1T D;  4YM6 A;  5DNN C;  5B33 D;  3UTB A;  1KX5 A;  2FJ7 D;  3EPH A;  5AV5 B;  3KWQ C;  3X1V B;  5AVB B;  5B1M B;  3AZI D;  4CSR A;  3REJ C;  4DQY B;  3AZE B;  3AZF C;  5CPK D;  2F8N A;  4JJN B;  3UT9 C;  1EQZ D;  3AFA C;  4DRB A;  1P34 C;  5B0Y A;  4UPK A;  3REK A;  3IP4 C;  3WAA B;  3X1S B;  1P3G B;  1ID3 C;  3KWQ A;  1Z2C B;  5AV8 C;  3AYW A;  3A6N D;  5GSU B;  2G5I C;  5B0Z D;  4WU8 B;  3AZF A;  3MVD B;  5CPI A;  3MNN D;  3UT9 A;  3AFA A;  4R8P C;  3W97 C;  1F66 D;  5B31 C;  1ID3 A;  5GXQ D;  1P3I C;  4YM6 D;  3KSY A;  3UTB D;  1M1A C;  1P3F B;  1KX5 D;  3AZJ C;  3AV2 B;  3MGR B;  3AZM C;  5B31 A;  2Y2H A;  4XUJ A;  2F8N D;  4EO5 C;  5B24 B;  4AWL C;  5B32 G;  3MGS C;  1P3I A;  5B0Y D;  3REK D;  4E44 A;  2HIO C;  5B1L C;  5B2I C;  1M1A A;  2NZD C;  3KWQ D;  3AZJ A;  3AYW D;  3LZ0 B;  3NQJ B;  3X1V A;  5B1M A;  1A7W A;  3AZF D;  5CPI D;  3UT9 D;  3AZE A;  5B40 B;  4LD9 B;  3AFA D;  4H9R B;  4ZUX C;  2CV5 C;  1B67 A;  5B2I A;  2NZD A;  1ID3 D;  1P3L B;  2HUE B;  3X1S A;  3W98 C;  2Y2O A;  1P3G A;  3KXB C;  5GT3 C;  3O62 C;  3FDD A;  5GSU A;  1M18 C;  3WA9 B;  3B6F B;  3MVD A;  4CAY B;  4ZUX A;  2CV5 A;  5B31 D;  4XUJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...