5B0YB

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yB00
4G91B 3WKJA 3AN2C 3AFAD 3WTPE 1ZLAA 1P3AA 3REJC 3WKJB 1BH8A 3MGPD 1M19D 1P3AB 1ZLAB 4J8XD 1P3KA 5B2IA 5CHLB 1EQZC 1M1AB 4WV4B 1P3KB 5B2IB 5GT3C 5AVBC 4EO5C 3AFAB 3MGPA 1M19A 2FJ7C 1TAFA 4J8XA 3MGPB 3AN2D 1M19B 1TAFB 4J8XB 1P3BC 5B31C 3MNND 3REIC 3C1BC 5DNMC 5CPKC 3MGRD 1EQZD 3AN2A 5GT3D 2NZDC 5GXQA 3AZGA 3MNNA 3AN2B 1AOIC 5B0YC 2FJ7D 3MNNB 4CSRA 3R45A 3VH6W 3MGRA 5AV5A 1P3BD 1N1JB 4NE3A 5B31D 3R45B 3MGRB 5B1LC 3REID 5CPKD 3B0BA 5DNMD 2BYMA 3B6GC 3V9RA 2BYMB 5B31G 4H9OA 2NZDD 3WTPC 3AZHC 3V9RB 1P3LA 4KUDC 4H9OB 3KWQC 1P3BB 5B31B 5B0YD 5CPKA 3X1SC 1P3LB 3REIB 5CPKB 1P3MC 5B1LD 5BO0A 5B40A 3LZ0A 1F66C 3AZFC 4R8PA 5KDMA 5BO0B 5B32C 3B6GD 5GT0C 3VH5T 2CWEA 4HGAC 3WTPD 3AZHD 2JSSA 5GSUA 4KUDD 4YM6C 5B1LA 4AWLB 3AV1D 5GSUB 3X1SD 5B1LB 5AV9D 3B6GA 1KX3C 1P3MD 1P3GC 3B6GB 3WTPA 3AZHA 1F66D 3AZFD 3WTPB 3AZHB 3UTBC 3AV1A 3X1SA 4KUDB 1B67A 5GT0D 5AV9A 3AV1B 5G49A 3X1SB 3TU4D 3RELA 3REKC 5AV9B 1P3FC 4YM6D 3WAAD 5G49B 3AZKC 4G91C 3RELB 3AZFA 3UT9A 1P3MB 4H9SC 1B6WA 3AZFB 3UT9B 1KX3D 2YFVA 1P3GD 1ZLAC 1P3AC 3TU4A 2YFVB 3WAAA 4HGAB 3TU4B 3UTBD 4YM6B 3WAAB 2HIOA 1P3GA 3REKD 1P3FD 3W99D 3AZKD 3VH6T 1P3GB 3MGPC 1M19C 5JRGC 3UTBB 1ZLAD 5CPIC 3REKA 3VH5W 1ID3C 3W99A 4Z2MH 3AZKA 3REKB 1P3FB 3W99B 3AZKB 3MVDC 3AZNC 5GXQC 3AZGC 3MNNC 4ZBJC 3WA9A 4YS3D 3MGRC 1BH8B 4QLCC 3W97A 4NE5A 5AV5C 3WA9B 5JRGD 4G92C 1HTAA 5CPID 4M6BA 5AY8A 1ID3D 1P3PC 5AY8B 3AZJC 4E45A 4YS3A 5JRGA 3MGQA 3MVDD 3AZND 5GXQD 3AZGD 4YS3B 3KSYA 1P3LC 5CPIA 5JRGB 1ID3A 3A6ND 5CPIB 4QLCD 1ID3B 5AV5D 1WWIA 2AROA 3MVDA 3AZNA 5CP6A 3LZ0C 5B40C 5DNND 1P3PD 4R8PC 2BYKA 5B2JD 3MVDB 3AZNB 5GXQB 5CP6B 3AZGB 3AZJD 3A6NA 4ZBJB 2BYKB 4QLCA 1A7WA 1S32C 4CSRB 3A6NB 4AWLC 4JJNC 4QLCB 5GSUC 1P3LD 5AV5B 4G92B 5DNNA 1P3PA 1BH9A 5B2JA 4WNNA 3AZJA 5DNNB 1P3PB 1BH9B 3REHA 5B2JB 4XZQA 3AZJB 5B40D 3LZ0D 3UTAC 2CV5D 1P3OD 4R8PD 3LJAC 1KX4C 3AV1C 5BS7C 3KUYA 5AV9C 1S32D 1H3OA 3RELC 4JJND 4WU9C 5GSUD 2CV5A 1H3OB 1P3OA 3UT9C 5B40B 3LZ0B 5B24A 4J8UD 2CV5B 4R8PB 5KDMB 1P3OB 3AZLD 1S32A 5B24B 3TU4C 4JJNA 3UTAD 1S32B 4ZUXC 3WAAC 5B0ZC 1KX4D 4JJNB 5B33C 4J8UA 2HIOC 3AZLA 3RELD 4WU9D 4J8UB 3UTAA 3AZLB 3UT9D 1KX4A 3VH6A 4DRAA 5BS7A 3UTAB 1KX4B 1P34A 2F8NH 4WU9A 5CPJD 4ZUXD 3W99C 5B0ZD 4WU9B 5B33D 3MGSA 4NFTA 4DRBA 4H9QA 2HIOD 3MGSB 3AZIA 1M18A 4H9QB 3X1VC 2NQBA 3AZIB 1M18B 5CPJA 4ZUXA 3AZEC 5B0ZA 3WA9C 4J8VC 1JFIA 2HUEB 2NQBB 4KHAA 5B33A 3X1UD 4NE6A 1KU5A 5CPJB 4ZUXB 3NQJA 5B0ZB 3W97C 1ULYA 1JFIB 5AV6A 5B33B 3NQJB 4Z5TC 5AY8C 2HIOB 5AV6B 3AV2A 3LZ1A 4YS3C 3X1UA 3LZ1B 3MGQC 3X1VD 3X1UB 3B6FD 4Z2MG 5BT1D 3W98A 3AZED 5B1MD 3WA9D 4J8VD 1KX5D 3W98B 5E5AC 3W97D 4XUJD 2AROC 3X1VA 4Z5TD 5AY8D 5CP6C 3B6FA 3AZEA 5B1MA 3X1VB 2PYOA 4J8VA 5FUGA 3A6NC 1KX5A 3B6FB 3AZEB 5B1MB 4J8VB 5FUGB 3MGQD 4Z66C 1KX5B 4XUJA 3W97B 3B0DC 4Z5TA 5DNNC 4XUJB 5AVCD 5B2JC 4Z5TB 5JA4A 5E5AD 3REHC 5JA4B 4XZQC 2AROD 5CP6D 3W96D 3MGQB 3C1CA 5C3IB 5AVCA 4J8WC 1M1AA 3KUYC 1HQ3C 3C1CB 5E5AA 5AVCB 4Z66D 5E5AB 3AFAA 3AYWC 2CV5C 1P3OC 3W96A 2AROB 5B24C 3W96B 3LJAD 3REHD 1TZYD 4XZQD 4Z66A 3VH5A 4H9RA 5F99C 3REJD 4Z66B 3AZMC 4J8WD 1U35C 1P3IC 4H9RB 3B0DB 3KUYD 1HQ3D 4J8UC 3LJAA 3AZLC 1TZYA 4WNNB 2F8NK 2IO5C 3AYWD 3LJAB 3REHB 1TZYB 4XZQB 3REJA 5AVBD 1WWSA 3B0CW 4J8WA 5B24D 3REJB 1HQ3A 1N1JA 5BNXA 4J8WB 4WU8C 1P34C 1EQZA 3KUYB 1HQ3B 5F99D 5BNXB 3AYWA 1EQZB 5GT3A 3AZMD 5BNVA 5AV8C 3O62C 1U35D 3MGSC 1P3ID 5AVBA 3AYWB 4X23C 3C1BD 5GT3B 1BFMA 5BNVB 4LD9C 3AZIC 1M18C 2FJ7A 5AVBB 4EO5B 2NQBC 2HUEC 2FJ7B 5CPJC 1P3BA 4KGCC 5F99A 5B31A 1F1EA 3AZMA 1AOID 1U35A 1P3IA 3REIA 5F99B 3C1BA 5DNMA 3AZMB 4WU8D 5AV6C 1U35B 1P34D 1P3IB 2F8ND 3C1BB 5DNMB 4UUZA 5AV8D 3O62D 3AV2C 2NZDA 3MGSD 2IO5B 4X23D 3LZ1C 1AOIA 4UUZB 3X1UC 4LD9D 5B0YA 2NZDB 3AZID 1M18D 2F8NG 1AOIB 4WU8A 2F8NA 2NQBD 5B0YB 3NQUA 4KGCD 3W98C 4WU8B 1P34B 2F8NB 5AV8A 3NQUB 3O62A 3KWQD 4X23A 3X1TC 5AV8B 3O62B 5AV6D 4LD9A 4X23B 4H9PA 3B6FC 4LD9B 5BT1C 4H9NA 4KGCA 3AV2D 5B1MC 2PYOC 4H9PB 3LZ1D 1KX5C 4KUDA 3KWQA 4H9NB 4KGCB 5B32D 2RVQC 3LELC 3KXBC 4XUJC 4KHAB 3KWQB 2LY8A 1P3MA 3W98D 1F66A 5B32G 3X1TD 3AV2B 5B32A 1F66B 3WKJC 5C3IC 5GT0A 5B32B 3C1CC 4WZSB 5AVCC 2PYOD 5GT0B 4YM6A 1M1AC 2RVQD 3LELD 3KXBD 1P3KC 3X1TA 5B2IC 1KX3A 2L5AA 3B0CT 3AFAC 3X1TB 3W96C 1KX3B 4E44A 4CAYA 3UTBA 3LELA 4J8XC 3KXBA 2PYOB 3WKJD 4CAYB 3LELB 2YFWA 3KXBB 1P3AD 3C1CD 1P3FA 2YFWB 1R4VA 1M1AD 1Q9CA 1P3KD 4H9SA 5B2ID 1TZYC
chains in the Genus database with same CATH superfamily
4G91B 3WKJA 3AN2C 3AFAD 3WTPE 1ZLAA 1P3AA 2G5HC 3REJC 3WKJB 3AL0C 1BH8A 3MGPD 1M19D 1P3AB 1ZLAB 4J8XD 1P3KA 4DQYB 2Y2GA 5B2IA 5CHLB 1EQZC 1M1AB 4WV4B 1P3KB 5B2IB 5GT3C 5AVBC 4EO5C 3AFAB 3MGPA 1M19A 2FJ7C 1TAFA 4J8XA 3MGPB 3AN2D 1M19B 1TAFB 4J8XB 1P3BC 5B31C 3MNND 3REIC 3C1BC 5DNMC 5CPKC 3MGRD 1EQZD 2F2AC 3AN2A 5GT3D 2NZDC 5GXQA 3AZGA 3MNNA 3AN2B 1AOIC 3IP4C 5B0YC 2FJ7D 3MNNB 4CSRA 2ZY3A 3R45A 3VH6W 3MGRA 5AV5A 1P3BD 1N1JB 4NE3A 5B31D 3R45B 3MGRB 5B1LC 3REID 5CPKD 3B0BA 5DNMD 2BYMA 3B6GC 3KFUG 3V9RA 2BYMB 5B31G 4H9OA 2NZDD 3WTPC 3AZHC 3V9RB 1P3LA 4KUDC 4H9OB 3EPHA 3KWQC 1P3BB 5B31B 5B0YD 5CPKA 3X1SC 1P3LB 3REIB 5CPKB 1P3MC 5B1LD 5BO0A 5B40A 3LZ0A 1F66C 3AZFC 4R8PA 5KDMA 5BO0B 5B32C 3B6GD 5GT0C 3VH5T 2CWEA 4HGAC 3WTPD 3AZHD 2JSSA 2Y2NA 5GSUA 4KUDD 4YM6C 5B1LA 2G5IC 4AWLB 3AV1D 5GSUB 3X1SD 5B1LB 2UWXA 5AV9D 3B6GA 1KX3C 2Y2IA 1P3MD 1P3GC 3B6GB 3WTPA 3AZHA 1F66D 3AZFD 3WTPB 3AZHB 3UTBC 3A1KA 3AV1A 3X1SA 4KUDB 1B67A 5GT0D 5AV9A 3AV1B 5G49A 3X1SB 3TU4D 3RELA 3REKC 5AV9B 1P3FC 4YM6D 3WAAD 5G49B 3AZKC 4G91C 3RELB 3AZFA 3UT9A 1P3MB 4H9SC 2BG1A 1B6WA 3AZFB 3UT9B 1KX3D 2YFVA 1P3GD 1ZLAC 1P3AC 3TU4A 2YFVB 3WAAA 4HGAB 3TU4B 3UTBD 2Y2QA 4YM6B 3WAAB 2HIOA 1P3GA 3REKD 1P3FD 3W99D 3AZKD 3VH6T 1P3GB 3MGPC 1M19C 2ZY2A 5JRGC 3UTBB 1ZLAD 5CPIC 3REKA 3H0RC 3VH5W 1ID3C 3W99A 4Z2MH 3AZKA 3REKB 1P3FB 3W99B 3AZKB 3MVDC 3AZNC 5GXQC 3AZGC 3MNNC 4ZBJC 3WA9A 4YS3D 3MGRC 1BH8B 4QLCC 3W97A 4NE5A 5AV5C 3WA9B 5JRGD 4G92C 1HTAA 5CPID 4M6BA 5AY8A 1ID3D 1P3PC 5AY8B 3AZJC 4E45A 4YS3A 2DF4C 5JRGA 3MGQA 3MVDD 3AZND 5GXQD 3AZGD 4YS3B 3KSYA 1P3LC 5CPIA 5JRGB 1ID3A 2Y2KA 3A6ND 5CPIB 4QLCD 1ID3B 5AV5D 1WWIA 2AROA 3MVDA 3AZNA 3FDDA 5CP6A 3LZ0C 5B40C 5DNND 1P3PD 4R8PC 2BYKA 4UPKA 5B2JD 3MVDB 3AZNB 5GXQB 5CP6B 3AZGB 3AZJD 3A6NA 4ZBJB 2BYKB 4QLCA 1A7WA 3H0LC 1S32C 4CSRB 3A6NB 4AWLC 4JJNC 4QLCB 5GSUC 1P3LD 5AV5B 4G92B 5DNNA 1P3PA 1BH9A 5B2JA 4WNNA 3AZJA 5DNNB 1P3PB 1BH9B 3REHA 5B2JB 3P5JB 2RIQA 4XZQA 3AZJB 5B40D 3LZ0D 3UTAC 2CV5D 1P3OD 4R8PD 2W8SA 3LJAC 1KX4C 4WJ3C 3AV1C 5BS7C 3KUYA 5AV9C 1S32D 1H3OA 3RELC 4JJND 4WU9C 5GSUD 2CV5A 1H3OB 1P3OA 3UT9C 5B40B 3LZ0B 5B24A 4J8UD 2CV5B 4R8PB 5KDMB 1P3OB 3AZLD 1S32A 5B24B 3TU4C 4JJNA 3UTAD 2ZY4A 1S32B 4ZUXC 3WAAC 5B0ZC 1KX4D 4JJNB 5B33C 3H0MC 4J8UA 2HIOC 3AZLA 1T3UA 3RELD 4WU9D 4J8UB 3UTAA 3AZLB 3UT9D 1KX4A 3VH6A 4DRAA 5BS7A 3UTAB 2JE5A 1KX4B 2VQRA 1P34A 2F8NH 4WU9A 5CPJD 4ZUXD 3W99C 5B0ZD 4WU9B 5B33D 3MGSA 4NFTA 3EPLA 4DRBA 4H9QA 2HIOD 3MGSB 3AZIA 1M18A 4H9QB 3X1VC 2NQBA 3AZIB 1M18B 5CPJA 4ZUXA 3AZEC 5B0ZA 3WA9C 4J8VC 1JFIA 2HUEB 2NQBB 4KHAA 5B33A 3X1UD 4NE6A 1KU5A 5CPJB 4ZUXB 3NQJA 5B0ZB 3W97C 1ULYA 1JFIB 5AV6A 5B33B 2J8PA 3NQJB 4Z5TC 5AY8C 2HIOB 5AV6B 3AV2A 3LZ1A 4YS3C 3X1UA 3LZ1B 3MGQC 3X1VD 3X1UB 3B6FD 4Z2MG 5BT1D 3W98A 3AZED 5B1MD 3WA9D 4J8VD 1KX5D 3W98B 5E5AC 3W97D 4XUJD 2AROC 3X1VA 4Z5TD 5AY8D 5CP6C 3B6FA 3AZEA 5B1MA 3X1VB 2PYOA 4J8VA 5FUGA 3A6NC 1KX5A 3B6FB 2ZY5A 3AZEB 5B1MB 4J8VB 5FUGB 3MGQD 4Z66C 1KX5B 4XUJA 2FFFB 3W97B 3B0DC 4Z5TA 5DNNC 4XUJB 5AVCD 2Y2LA 5B2JC 4Z5TB 5JA4A 5E5AD 3REHC 2Y2PA 5JA4B 4XZQC 2AROD 5CP6D 1W2EA 3W96D 3MGQB 3C1CA 5C3IB 5AVCA 4J8WC 1M1AA 3KUYC 1HQ3C 3C1CB 5E5AA 5AVCB 4Z66D 2JCHA 5E5AB 3AFAA 3AYWC 2CV5C 1P3OC 3W96A 2AROB 5B24C 3W96B 3LJAD 3REHD 1TZYD 4XZQD 4Z66A 3VH5A 2XD1A 4H9RA 5F99C 3REJD 4Z66B 3AZMC 4J8WD 1U35C 1P3IC 4H9RB 3B0DB 3KUYD 1HQ3D 4J8UC 3LJAA 3AZLC 1TZYA 4WNNB 2F8NK 2IO5C 3AYWD 3LJAB 3REHB 1TZYB 4XZQB 3REJA 5AVBD 1WWSA 3B0CW 4J8WA 5B24D 3A1IA 3REJB 1HQ3A 1N1JA 5BNXA 4J8WB 4WU8C 1P34C 1EQZA 3KUYB 1HQ3B 5F99D 5BNXB 3AYWA 2XD5A 5GT3A 3AZMD 5BNVA 5AV8C 3O62C 1U35D 3MGSC 1P3ID 1EQZB 5AVBA 3AYWB 4X23C 3C1BD 5GT3B 1BFMA 5BNVB 4LD9C 3AZIC 1M18C 2FJ7A 5AVBB 4EO5B 2NQBC 2HUEC 2FJ7B 5CPJC 1P3BA 4KGCC 5F99A 5B31A 1F1EA 3F6TA 3AZMA 1AOID 1U35A 1P3IA 3REIA 5F99B 3C1BA 2Y2JA 5DNMA 3AZMB 2Y2HA 4WU8D 5AV6C 1U35B 1P34D 1P3IB 2F8ND 3C1BB 5DNMB 4UUZA 5AV8D 3O62D 3AV2C 2NZDA 3MGSD 2IO5B 4X23D 3LZ1C 2ZM5A 4UUZB 1AOIA 3EG5B 3X1UC 4LD9D 5B0YA 2NZDB 3AZID 1M18D 1Z2CB 2F8NG 1AOIB 4WU8A 2F8NA 2NQBD 5B0YB 3NQUA 4KGCD 3W98C 4WU8B 3EPJA 1P34B 2F8NB 5AV8A 3NQUB 3O62A 3KWQD 4X23A 3X1TC 5AV8B 3O62B 5AV6D 4LD9A 4X23B 4H9PA 3B6FC 4LD9B 5BT1C 4H9NA 4KGCA 3AV2D 5B1MC 2PYOC 4H9PB 3LZ1D 1KX5C 4KUDA 3KWQA 4H9NB 4KGCB 5B32D 2RVQC 3LELC 3KXBC 4XUJC 4KHAB 3KWQB 2LY8A 1P3MA 3W98D 1PZRA 1F66A 5B32G 3X1TD 2DQNC 3AV2B 5B32A 1F66B 3WKJC 5C3IC 5GT0A 5B32B 3EPKA 3C1CC 4WZSB 5AVCC 2PYOD 5GT0B 4YM6A 1M1AC 2RVQD 3LELD 2Y2OA 3KXBD 1P3KC 3X1TA 5B2IC 1KX3A 2L5AA 3B0CT 3AFAC 3X1TB 3W96C 1KX3B 4E44A 4CAYA 3UTBA 3LELA 4J8XC 3KXBA 2PYOB 3WKJD 2Y2MA 4CAYB 3LELB 2YFWA 3KXBB 1P3AD 3C1CD 1P3FA 2YFWB 1R4VA 1M1AD 1Q9CA 1P3KD 4H9SA 5B2ID 1TZYC
chains in the Genus database with same CATH topology
4G91B 3WKJA 3AN2C 3AFAD 3WTPE 1ZLAA 1P3AA 2G5HC 3REJC 3WKJB 3AL0C 1BH8A 3MGPD 1M19D 1P3AB 1ZLAB 4J8XD 1P3KA 4DQYB 2Y2GA 5B2IA 5CHLB 1EQZC 1M1AB 4WV4B 1P3KB 5B2IB 5GT3C 5AVBC 4EO5C 3AFAB 3MGPA 1M19A 2FJ7C 1TAFA 4J8XA 3MGPB 3AN2D 1M19B 1TAFB 4J8XB 1P3BC 5B31C 3MNND 3REIC 3C1BC 5DNMC 5CPKC 3MGRD 1EQZD 2F2AC 3AN2A 5GT3D 2NZDC 5GXQA 3AZGA 3MNNA 3AN2B 1AOIC 3IP4C 5B0YC 2FJ7D 3MNNB 4CSRA 2ZY3A 3R45A 3VH6W 3MGRA 5AV5A 1P3BD 1N1JB 4NE3A 5B31D 3R45B 3MGRB 5B1LC 3REID 5CPKD 3B0BA 5DNMD 2BYMA 3B6GC 3KFUG 3V9RA 2BYMB 5B31G 4H9OA 2NZDD 3WTPC 3AZHC 3V9RB 1P3LA 4KUDC 4H9OB 3EPHA 3KWQC 1P3BB 5B31B 5B0YD 5CPKA 3X1SC 1P3LB 3REIB 5CPKB 1P3MC 5B1LD 5BO0A 5B40A 3LZ0A 1F66C 3AZFC 4R8PA 5KDMA 5BO0B 5B32C 3B6GD 5GT0C 3VH5T 2CWEA 4HGAC 3WTPD 3AZHD 2JSSA 2Y2NA 5GSUA 4KUDD 4YM6C 5B1LA 2G5IC 4AWLB 3AV1D 5GSUB 3X1SD 5B1LB 2UWXA 5AV9D 3B6GA 1KX3C 2Y2IA 1P3MD 1P3GC 3B6GB 3WTPA 3AZHA 1F66D 3AZFD 3WTPB 3AZHB 3UTBC 3A1KA 3AV1A 3X1SA 4KUDB 1B67A 5GT0D 5AV9A 3AV1B 5G49A 3X1SB 3TU4D 3RELA 3REKC 5AV9B 1P3FC 4YM6D 3WAAD 5G49B 3AZKC 4G91C 3RELB 3AZFA 3UT9A 1P3MB 4H9SC 2BG1A 1B6WA 3AZFB 3UT9B 1KX3D 2YFVA 1P3GD 1ZLAC 1P3AC 3TU4A 2YFVB 3WAAA 4HGAB 3TU4B 3UTBD 2Y2QA 4YM6B 3WAAB 2HIOA 1P3GA 3REKD 1P3FD 3W99D 3AZKD 3VH6T 1P3GB 3MGPC 1M19C 2ZY2A 5JRGC 3UTBB 1ZLAD 5CPIC 3REKA 3H0RC 3VH5W 1ID3C 3W99A 4Z2MH 3AZKA 3REKB 1P3FB 3W99B 3AZKB 3MVDC 3AZNC 5GXQC 3AZGC 3MNNC 4ZBJC 3WA9A 4YS3D 3MGRC 1BH8B 4QLCC 3W97A 4NE5A 5AV5C 3WA9B 5JRGD 4G92C 1HTAA 5CPID 4M6BA 5AY8A 1ID3D 1P3PC 5AY8B 3AZJC 4E45A 4YS3A 2DF4C 5JRGA 3MGQA 3MVDD 3AZND 5GXQD 3AZGD 4YS3B 3KSYA 1P3LC 5CPIA 5JRGB 1ID3A 2Y2KA 3A6ND 5CPIB 4QLCD 1ID3B 5AV5D 1WWIA 2AROA 3MVDA 3AZNA 3FDDA 5CP6A 3LZ0C 5B40C 5DNND 1P3PD 4R8PC 2BYKA 4UPKA 5B2JD 3MVDB 3AZNB 5GXQB 5CP6B 3AZGB 3AZJD 3A6NA 4ZBJB 2BYKB 4QLCA 1A7WA 3H0LC 1S32C 4CSRB 3A6NB 4AWLC 4JJNC 4QLCB 5GSUC 1P3LD 5AV5B 4G92B 5DNNA 1P3PA 1BH9A 5B2JA 4WNNA 3AZJA 5DNNB 1P3PB 1BH9B 3REHA 5B2JB 3P5JB 2RIQA 4XZQA 3AZJB 5B40D 3LZ0D 3UTAC 2CV5D 1P3OD 4R8PD 2W8SA 3LJAC 1KX4C 4WJ3C 3AV1C 5BS7C 3KUYA 5AV9C 1S32D 1H3OA 3RELC 4JJND 4WU9C 5GSUD 2CV5A 1H3OB 1P3OA 3UT9C 5B40B 3LZ0B 5B24A 4J8UD 2CV5B 4R8PB 5KDMB 1P3OB 3AZLD 1S32A 5B24B 3TU4C 4JJNA 3UTAD 2ZY4A 1S32B 4ZUXC 3WAAC 5B0ZC 1KX4D 4JJNB 5B33C 3H0MC 4J8UA 2HIOC 3AZLA 1T3UA 3RELD 4WU9D 4J8UB 3UTAA 3AZLB 3UT9D 1KX4A 3VH6A 4DRAA 5BS7A 3UTAB 2JE5A 1KX4B 2VQRA 1P34A 2F8NH 4WU9A 5CPJD 4ZUXD 3W99C 5B0ZD 4WU9B 5B33D 3MGSA 4NFTA 3EPLA 4DRBA 4H9QA 2HIOD 3MGSB 3AZIA 1M18A 4H9QB 3X1VC 2NQBA 3AZIB 1M18B 5CPJA 4ZUXA 3AZEC 5B0ZA 3WA9C 4J8VC 1JFIA 2HUEB 2NQBB 4KHAA 5B33A 3X1UD 4NE6A 1KU5A 5CPJB 4ZUXB 3NQJA 5B0ZB 3W97C 1ULYA 1JFIB 5AV6A 5B33B 2J8PA 3NQJB 4Z5TC 5AY8C 2HIOB 5AV6B 3AV2A 3LZ1A 4YS3C 3X1UA 3LZ1B 3MGQC 3X1VD 3X1UB 3B6FD 4Z2MG 5BT1D 3W98A 3AZED 5B1MD 3WA9D 4J8VD 1KX5D 3W98B 5E5AC 3W97D 4XUJD 2AROC 3X1VA 4Z5TD 5AY8D 5CP6C 3B6FA 3AZEA 5B1MA 3X1VB 2PYOA 4J8VA 5FUGA 3A6NC 1KX5A 3B6FB 2ZY5A 3AZEB 5B1MB 4J8VB 5FUGB 3MGQD 4Z66C 1KX5B 4XUJA 2FFFB 3W97B 3B0DC 4Z5TA 5DNNC 4XUJB 5AVCD 2Y2LA 5B2JC 4Z5TB 5JA4A 5E5AD 3REHC 2Y2PA 5JA4B 4XZQC 2AROD 5CP6D 1W2EA 3W96D 3MGQB 3C1CA 5C3IB 5AVCA 4J8WC 1M1AA 3KUYC 1HQ3C 3C1CB 5E5AA 5AVCB 4Z66D 2JCHA 5E5AB 3AFAA 3AYWC 2CV5C 1P3OC 3W96A 2AROB 5B24C 3W96B 3LJAD 3REHD 1TZYD 4XZQD 4Z66A 3VH5A 2XD1A 4H9RA 5F99C 3REJD 4Z66B 3AZMC 4J8WD 1U35C 1P3IC 4H9RB 3B0DB 3KUYD 1HQ3D 4J8UC 3LJAA 3AZLC 1TZYA 4WNNB 2F8NK 2IO5C 3AYWD 3LJAB 3REHB 1TZYB 4XZQB 3REJA 5AVBD 1WWSA 3B0CW 4J8WA 5B24D 3A1IA 3REJB 1HQ3A 1N1JA 5BNXA 4J8WB 4WU8C 1P34C 1EQZA 3KUYB 1HQ3B 5F99D 5BNXB 3AYWA 2XD5A 5GT3A 3AZMD 5BNVA 5AV8C 3O62C 1U35D 3MGSC 1P3ID 1EQZB 5AVBA 3AYWB 4X23C 3C1BD 5GT3B 1BFMA 5BNVB 4LD9C 3AZIC 1M18C 2FJ7A 5AVBB 4EO5B 2NQBC 2HUEC 2FJ7B 5CPJC 1P3BA 4KGCC 5F99A 5B31A 1F1EA 3F6TA 3AZMA 1AOID 1U35A 1P3IA 3REIA 5F99B 3C1BA 2Y2JA 5DNMA 3AZMB 2Y2HA 4WU8D 5AV6C 1U35B 1P34D 1P3IB 2F8ND 3C1BB 5DNMB 4UUZA 5AV8D 3O62D 3AV2C 2NZDA 3MGSD 2IO5B 4X23D 3LZ1C 2ZM5A 4UUZB 1AOIA 3EG5B 3X1UC 4LD9D 5B0YA 2NZDB 3AZID 1M18D 1Z2CB 2F8NG 1AOIB 4WU8A 2F8NA 2NQBD 5B0YB 3NQUA 4KGCD 3W98C 4WU8B 3EPJA 1P34B 2F8NB 5AV8A 3NQUB 3O62A 3KWQD 4X23A 3X1TC 5AV8B 3O62B 5AV6D 4LD9A 4X23B 4H9PA 3B6FC 4LD9B 5BT1C 4H9NA 4KGCA 3AV2D 5B1MC 2PYOC 4H9PB 3LZ1D 1KX5C 4KUDA 3KWQA 4H9NB 4KGCB 5B32D 2RVQC 3LELC 3KXBC 4XUJC 4KHAB 3KWQB 2LY8A 1P3MA 3W98D 1PZRA 1F66A 5B32G 3X1TD 2DQNC 3AV2B 5B32A 1F66B 3WKJC 5C3IC 5GT0A 5B32B 3EPKA 3C1CC 4WZSB 5AVCC 2PYOD 5GT0B 4YM6A 1M1AC 2RVQD 3LELD 2Y2OA 3KXBD 1P3KC 3X1TA 5B2IC 1KX3A 2L5AA 3B0CT 3AFAC 3X1TB 3W96C 1KX3B 4E44A 4CAYA 3UTBA 3LELA 4J8XC 3KXBA 2PYOB 3WKJD 2Y2MA 4CAYB 3LELB 2YFWA 3KXBB 1P3AD 3C1CD 1P3FA 2YFWB 1R4VA 1M1AD 1Q9CA 1P3KD 4H9SA 5B2ID 1TZYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G91 B;  3WKJ A;  3AN2 C;  3AFA D;  3WTP E;  1ZLA A;  1P3A A;  3REJ C;  3WKJ B;  1BH8 A;  3MGP D;  1M19 D;  1P3A B;  1ZLA B;  4J8X D;  1P3K A;  5B2I A;  5CHL B;  1EQZ C;  1M1A B;  4WV4 B;  1P3K B;  5B2I B;  5GT3 C;  5AVB C;  4EO5 C;  3AFA B;  3MGP A;  1M19 A;  2FJ7 C;  1TAF A;  4J8X A;  3MGP B;  3AN2 D;  1M19 B;  1TAF B;  4J8X B;  1P3B C;  5B31 C;  3MNN D;  3REI C;  3C1B C;  5DNM C;  5CPK C;  3MGR D;  1EQZ D;  3AN2 A;  5GT3 D;  2NZD C;  5GXQ A;  3AZG A;  3MNN A;  3AN2 B;  1AOI C;  5B0Y C;  2FJ7 D;  3MNN B;  4CSR A;  3R45 A;  3VH6 W;  3MGR A;  5AV5 A;  1P3B D;  1N1J B;  4NE3 A;  5B31 D;  3R45 B;  3MGR B;  5B1L C;  3REI D;  5CPK D;  3B0B A;  5DNM D;  2BYM A;  3B6G C;  3V9R A;  2BYM B;  5B31 G;  4H9O A;  2NZD D;  3WTP C;  3AZH C;  3V9R B;  1P3L A;  4KUD C;  4H9O B;  3KWQ C;  1P3B B;  5B31 B;  5B0Y D;  5CPK A;  3X1S C;  1P3L B;  3REI B;  5CPK B;  1P3M C;  5B1L D;  5BO0 A;  5B40 A;  3LZ0 A;  1F66 C;  3AZF C;  4R8P A;  5KDM A;  5BO0 B;  5B32 C;  3B6G D;  5GT0 C;  3VH5 T;  2CWE A;  4HGA C;  3WTP D;  3AZH D;  2JSS A;  5GSU A;  4KUD D;  4YM6 C;  5B1L A;  4AWL B;  3AV1 D;  5GSU B;  3X1S D;  5B1L B;  5AV9 D;  3B6G A;  1KX3 C;  1P3M D;  1P3G C;  3B6G B;  3WTP A;  3AZH A;  1F66 D;  3AZF D;  3WTP B;  3AZH B;  3UTB C;  3AV1 A;  3X1S A;  4KUD B;  1B67 A;  5GT0 D;  5AV9 A;  3AV1 B;  5G49 A;  3X1S B;  3TU4 D;  3REL A;  3REK C;  5AV9 B;  1P3F C;  4YM6 D;  3WAA D;  5G49 B;  3AZK C;  4G91 C;  3REL B;  3AZF A;  3UT9 A;  1P3M B;  4H9S C;  1B6W A;  3AZF B;  3UT9 B;  1KX3 D;  2YFV A;  1P3G D;  1ZLA C;  1P3A C;  3TU4 A;  2YFV B;  3WAA A;  4HGA B;  3TU4 B;  3UTB D;  4YM6 B;  3WAA B;  2HIO A;  1P3G A;  3REK D;  1P3F D;  3W99 D;  3AZK D;  3VH6 T;  1P3G B;  3MGP C;  1M19 C;  5JRG C;  3UTB B;  1ZLA D;  5CPI C;  3REK A;  3VH5 W;  1ID3 C;  3W99 A;  4Z2M H;  3AZK A;  3REK B;  1P3F B;  3W99 B;  3AZK B;  3MVD C;  3AZN C;  5GXQ C;  3AZG C;  3MNN C;  4ZBJ C;  3WA9 A;  4YS3 D;  3MGR C;  1BH8 B;  4QLC C;  3W97 A;  4NE5 A;  5AV5 C;  3WA9 B;  5JRG D;  4G92 C;  1HTA A;  5CPI D;  4M6B A;  5AY8 A;  1ID3 D;  1P3P C;  5AY8 B;  3AZJ C;  4E45 A;  4YS3 A;  5JRG A;  3MGQ A;  3MVD D;  3AZN D;  5GXQ D;  3AZG D;  4YS3 B;  3KSY A;  1P3L C;  5CPI A;  5JRG B;  1ID3 A;  3A6N D;  5CPI B;  4QLC D;  1ID3 B;  5AV5 D;  1WWI A;  2ARO A;  3MVD A;  3AZN A;  5CP6 A;  3LZ0 C;  5B40 C;  5DNN D;  1P3P D;  4R8P C;  2BYK A;  5B2J D;  3MVD B;  3AZN B;  5GXQ B;  5CP6 B;  3AZG B;  3AZJ D;  3A6N A;  4ZBJ B;  2BYK B;  4QLC A;  1A7W A;  1S32 C;  4CSR B;  3A6N B;  4AWL C;  4JJN C;  4QLC B;  5GSU C;  1P3L D;  5AV5 B;  4G92 B;  5DNN A;  1P3P A;  1BH9 A;  5B2J A;  4WNN A;  3AZJ A;  5DNN B;  1P3P B;  1BH9 B;  3REH A;  5B2J B;  4XZQ A;  3AZJ B;  5B40 D;  3LZ0 D;  3UTA C;  2CV5 D;  1P3O D;  4R8P D;  3LJA C;  1KX4 C;  3AV1 C;  5BS7 C;  3KUY A;  5AV9 C;  1S32 D;  1H3O A;  3REL C;  4JJN D;  4WU9 C;  5GSU D;  2CV5 A;  1H3O B;  1P3O A;  3UT9 C;  5B40 B;  3LZ0 B;  5B24 A;  4J8U D;  2CV5 B;  4R8P B;  5KDM B;  1P3O B;  3AZL D;  1S32 A;  5B24 B;  3TU4 C;  4JJN A;  3UTA D;  1S32 B;  4ZUX C;  3WAA C;  5B0Z C;  1KX4 D;  4JJN B;  5B33 C;  4J8U A;  2HIO C;  3AZL A;  3REL D;  4WU9 D;  4J8U B;  3UTA A;  3AZL B;  3UT9 D;  1KX4 A;  3VH6 A;  4DRA A;  5BS7 A;  3UTA B;  1KX4 B;  1P34 A;  2F8N H;  4WU9 A;  5CPJ D;  4ZUX D;  3W99 C;  5B0Z D;  4WU9 B;  5B33 D;  3MGS A;  4NFT A;  4DRB A;  4H9Q A;  2HIO D;  3MGS B;  3AZI A;  1M18 A;  4H9Q B;  3X1V C;  2NQB A;  3AZI B;  1M18 B;  5CPJ A;  4ZUX A;  3AZE C;  5B0Z A;  3WA9 C;  4J8V C;  1JFI A;  2HUE B;  2NQB B;  4KHA A;  5B33 A;  3X1U D;  4NE6 A;  1KU5 A;  5CPJ B;  4ZUX B;  3NQJ A;  5B0Z B;  3W97 C;  1ULY A;  1JFI B;  5AV6 A;  5B33 B;  3NQJ B;  4Z5T C;  5AY8 C;  2HIO B;  5AV6 B;  3AV2 A;  3LZ1 A;  4YS3 C;  3X1U A;  3LZ1 B;  3MGQ C;  3X1V D;  3X1U B;  3B6F D;  4Z2M G;  5BT1 D;  3W98 A;  3AZE D;  5B1M D;  3WA9 D;  4J8V D;  1KX5 D;  3W98 B;  5E5A C;  3W97 D;  4XUJ D;  2ARO C;  3X1V A;  4Z5T D;  5AY8 D;  5CP6 C;  3B6F A;  3AZE A;  5B1M A;  3X1V B;  2PYO A;  4J8V A;  5FUG A;  3A6N C;  1KX5 A;  3B6F B;  3AZE B;  5B1M B;  4J8V B;  5FUG B;  3MGQ D;  4Z66 C;  1KX5 B;  4XUJ A;  3W97 B;  3B0D C;  4Z5T A;  5DNN C;  4XUJ B;  5AVC D;  5B2J C;  4Z5T B;  5JA4 A;  5E5A D;  3REH C;  5JA4 B;  4XZQ C;  2ARO D;  5CP6 D;  3W96 D;  3MGQ B;  3C1C A;  5C3I B;  5AVC A;  4J8W C;  1M1A A;  3KUY C;  1HQ3 C;  3C1C B;  5E5A A;  5AVC B;  4Z66 D;  5E5A B;  3AFA A;  3AYW C;  2CV5 C;  1P3O C;  3W96 A;  2ARO B;  5B24 C;  3W96 B;  3LJA D;  3REH D;  1TZY D;  4XZQ D;  4Z66 A;  3VH5 A;  4H9R A;  5F99 C;  3REJ D;  4Z66 B;  3AZM C;  4J8W D;  1U35 C;  1P3I C;  4H9R B;  3B0D B;  3KUY D;  1HQ3 D;  4J8U C;  3LJA A;  3AZL C;  1TZY A;  4WNN B;  2F8N K;  2IO5 C;  3AYW D;  3LJA B;  3REH B;  1TZY B;  4XZQ B;  3REJ A;  5AVB D;  1WWS A;  3B0C W;  4J8W A;  5B24 D;  3REJ B;  1HQ3 A;  1N1J A;  5BNX A;  4J8W B;  4WU8 C;  1P34 C;  1EQZ A;  3KUY B;  1HQ3 B;  5F99 D;  5BNX B;  3AYW A;  1EQZ B;  5GT3 A;  3AZM D;  5BNV A;  5AV8 C;  3O62 C;  1U35 D;  3MGS C;  1P3I D;  5AVB A;  3AYW B;  4X23 C;  3C1B D;  5GT3 B;  1BFM A;  5BNV B;  4LD9 C;  3AZI C;  1M18 C;  2FJ7 A;  5AVB B;  4EO5 B;  2NQB C;  2HUE C;  2FJ7 B;  5CPJ C;  1P3B A;  4KGC C;  5F99 A;  5B31 A;  1F1E A;  3AZM A;  1AOI D;  1U35 A;  1P3I A;  3REI A;  5F99 B;  3C1B A;  5DNM A;  3AZM B;  4WU8 D;  5AV6 C;  1U35 B;  1P34 D;  1P3I B;  2F8N D;  3C1B B;  5DNM B;  4UUZ A;  5AV8 D;  3O62 D;  3AV2 C;  2NZD A;  3MGS D;  2IO5 B;  4X23 D;  3LZ1 C;  1AOI A;  4UUZ B;  3X1U C;  4LD9 D;  5B0Y A;  2NZD B;  3AZI D;  1M18 D;  2F8N G;  1AOI B;  4WU8 A;  2F8N A;  2NQB D;  5B0Y B;  3NQU A;  4KGC D;  3W98 C;  4WU8 B;  1P34 B;  2F8N B;  5AV8 A;  3NQU B;  3O62 A;  3KWQ D;  4X23 A;  3X1T C;  5AV8 B;  3O62 B;  5AV6 D;  4LD9 A;  4X23 B;  4H9P A;  3B6F C;  4LD9 B;  5BT1 C;  4H9N A;  4KGC A;  3AV2 D;  5B1M C;  2PYO C;  4H9P B;  3LZ1 D;  1KX5 C;  4KUD A;  3KWQ A;  4H9N B;  4KGC B;  5B32 D;  2RVQ C;  3LEL C;  3KXB C;  4XUJ C;  4KHA B;  3KWQ B;  2LY8 A;  1P3M A;  3W98 D;  1F66 A;  5B32 G;  3X1T D;  3AV2 B;  5B32 A;  1F66 B;  3WKJ C;  5C3I C;  5GT0 A;  5B32 B;  3C1C C;  4WZS B;  5AVC C;  2PYO D;  5GT0 B;  4YM6 A;  1M1A C;  2RVQ D;  3LEL D;  3KXB D;  1P3K C;  3X1T A;  5B2I C;  1KX3 A;  2L5A A;  3B0C T;  3AFA C;  3X1T B;  3W96 C;  1KX3 B;  4E44 A;  4CAY A;  3UTB A;  3LEL A;  4J8X C;  3KXB A;  2PYO B;  3WKJ D;  4CAY B;  3LEL B;  2YFW A;  3KXB B;  1P3A D;  3C1C D;  1P3F A;  2YFW B;  1R4V A;  1M1A D;  1Q9C A;  1P3K D;  4H9S A;  5B2I D;  1TZY C; 
#chains in the Genus database with same CATH topology
 4G91 B;  3WKJ A;  3AN2 C;  3AFA D;  3WTP E;  1ZLA A;  1P3A A;  2G5H C;  3REJ C;  3WKJ B;  3AL0 C;  1BH8 A;  3MGP D;  1M19 D;  1P3A B;  1ZLA B;  4J8X D;  1P3K A;  4DQY B;  2Y2G A;  5B2I A;  5CHL B;  1EQZ C;  1M1A B;  4WV4 B;  1P3K B;  5B2I B;  5GT3 C;  5AVB C;  4EO5 C;  3AFA B;  3MGP A;  1M19 A;  2FJ7 C;  1TAF A;  4J8X A;  3MGP B;  3AN2 D;  1M19 B;  1TAF B;  4J8X B;  1P3B C;  5B31 C;  3MNN D;  3REI C;  3C1B C;  5DNM C;  5CPK C;  3MGR D;  1EQZ D;  2F2A C;  3AN2 A;  5GT3 D;  2NZD C;  5GXQ A;  3AZG A;  3MNN A;  3AN2 B;  1AOI C;  3IP4 C;  5B0Y C;  2FJ7 D;  3MNN B;  4CSR A;  2ZY3 A;  3R45 A;  3VH6 W;  3MGR A;  5AV5 A;  1P3B D;  1N1J B;  4NE3 A;  5B31 D;  3R45 B;  3MGR B;  5B1L C;  3REI D;  5CPK D;  3B0B A;  5DNM D;  2BYM A;  3B6G C;  3KFU G;  3V9R A;  2BYM B;  5B31 G;  4H9O A;  2NZD D;  3WTP C;  3AZH C;  3V9R B;  1P3L A;  4KUD C;  4H9O B;  3EPH A;  3KWQ C;  1P3B B;  5B31 B;  5B0Y D;  5CPK A;  3X1S C;  1P3L B;  3REI B;  5CPK B;  1P3M C;  5B1L D;  5BO0 A;  5B40 A;  3LZ0 A;  1F66 C;  3AZF C;  4R8P A;  5KDM A;  5BO0 B;  5B32 C;  3B6G D;  5GT0 C;  3VH5 T;  2CWE A;  4HGA C;  3WTP D;  3AZH D;  2JSS A;  2Y2N A;  5GSU A;  4KUD D;  4YM6 C;  5B1L A;  2G5I C;  4AWL B;  3AV1 D;  5GSU B;  3X1S D;  5B1L B;  2UWX A;  5AV9 D;  3B6G A;  1KX3 C;  2Y2I A;  1P3M D;  1P3G C;  3B6G B;  3WTP A;  3AZH A;  1F66 D;  3AZF D;  3WTP B;  3AZH B;  3UTB C;  3A1K A;  3AV1 A;  3X1S A;  4KUD B;  1B67 A;  5GT0 D;  5AV9 A;  3AV1 B;  5G49 A;  3X1S B;  3TU4 D;  3REL A;  3REK C;  5AV9 B;  1P3F C;  4YM6 D;  3WAA D;  5G49 B;  3AZK C;  4G91 C;  3REL B;  3AZF A;  3UT9 A;  1P3M B;  4H9S C;  2BG1 A;  1B6W A;  3AZF B;  3UT9 B;  1KX3 D;  2YFV A;  1P3G D;  1ZLA C;  1P3A C;  3TU4 A;  2YFV B;  3WAA A;  4HGA B;  3TU4 B;  3UTB D;  2Y2Q A;  4YM6 B;  3WAA B;  2HIO A;  1P3G A;  3REK D;  1P3F D;  3W99 D;  3AZK D;  3VH6 T;  1P3G B;  3MGP C;  1M19 C;  2ZY2 A;  5JRG C;  3UTB B;  1ZLA D;  5CPI C;  3REK A;  3H0R C;  3VH5 W;  1ID3 C;  3W99 A;  4Z2M H;  3AZK A;  3REK B;  1P3F B;  3W99 B;  3AZK B;  3MVD C;  3AZN C;  5GXQ C;  3AZG C;  3MNN C;  4ZBJ C;  3WA9 A;  4YS3 D;  3MGR C;  1BH8 B;  4QLC C;  3W97 A;  4NE5 A;  5AV5 C;  3WA9 B;  5JRG D;  4G92 C;  1HTA A;  5CPI D;  4M6B A;  5AY8 A;  1ID3 D;  1P3P C;  5AY8 B;  3AZJ C;  4E45 A;  4YS3 A;  2DF4 C;  5JRG A;  3MGQ A;  3MVD D;  3AZN D;  5GXQ D;  3AZG D;  4YS3 B;  3KSY A;  1P3L C;  5CPI A;  5JRG B;  1ID3 A;  2Y2K A;  3A6N D;  5CPI B;  4QLC D;  1ID3 B;  5AV5 D;  1WWI A;  2ARO A;  3MVD A;  3AZN A;  3FDD A;  5CP6 A;  3LZ0 C;  5B40 C;  5DNN D;  1P3P D;  4R8P C;  2BYK A;  4UPK A;  5B2J D;  3MVD B;  3AZN B;  5GXQ B;  5CP6 B;  3AZG B;  3AZJ D;  3A6N A;  4ZBJ B;  2BYK B;  4QLC A;  1A7W A;  3H0L C;  1S32 C;  4CSR B;  3A6N B;  4AWL C;  4JJN C;  4QLC B;  5GSU C;  1P3L D;  5AV5 B;  4G92 B;  5DNN A;  1P3P A;  1BH9 A;  5B2J A;  4WNN A;  3AZJ A;  5DNN B;  1P3P B;  1BH9 B;  3REH A;  5B2J B;  3P5J B;  2RIQ A;  4XZQ A;  3AZJ B;  5B40 D;  3LZ0 D;  3UTA C;  2CV5 D;  1P3O D;  4R8P D;  2W8S A;  3LJA C;  1KX4 C;  4WJ3 C;  3AV1 C;  5BS7 C;  3KUY A;  5AV9 C;  1S32 D;  1H3O A;  3REL C;  4JJN D;  4WU9 C;  5GSU D;  2CV5 A;  1H3O B;  1P3O A;  3UT9 C;  5B40 B;  3LZ0 B;  5B24 A;  4J8U D;  2CV5 B;  4R8P B;  5KDM B;  1P3O B;  3AZL D;  1S32 A;  5B24 B;  3TU4 C;  4JJN A;  3UTA D;  2ZY4 A;  1S32 B;  4ZUX C;  3WAA C;  5B0Z C;  1KX4 D;  4JJN B;  5B33 C;  3H0M C;  4J8U A;  2HIO C;  3AZL A;  1T3U A;  3REL D;  4WU9 D;  4J8U B;  3UTA A;  3AZL B;  3UT9 D;  1KX4 A;  3VH6 A;  4DRA A;  5BS7 A;  3UTA B;  2JE5 A;  1KX4 B;  2VQR A;  1P34 A;  2F8N H;  4WU9 A;  5CPJ D;  4ZUX D;  3W99 C;  5B0Z D;  4WU9 B;  5B33 D;  3MGS A;  4NFT A;  3EPL A;  4DRB A;  4H9Q A;  2HIO D;  3MGS B;  3AZI A;  1M18 A;  4H9Q B;  3X1V C;  2NQB A;  3AZI B;  1M18 B;  5CPJ A;  4ZUX A;  3AZE C;  5B0Z A;  3WA9 C;  4J8V C;  1JFI A;  2HUE B;  2NQB B;  4KHA A;  5B33 A;  3X1U D;  4NE6 A;  1KU5 A;  5CPJ B;  4ZUX B;  3NQJ A;  5B0Z B;  3W97 C;  1ULY A;  1JFI B;  5AV6 A;  5B33 B;  2J8P A;  3NQJ B;  4Z5T C;  5AY8 C;  2HIO B;  5AV6 B;  3AV2 A;  3LZ1 A;  4YS3 C;  3X1U A;  3LZ1 B;  3MGQ C;  3X1V D;  3X1U B;  3B6F D;  4Z2M G;  5BT1 D;  3W98 A;  3AZE D;  5B1M D;  3WA9 D;  4J8V D;  1KX5 D;  3W98 B;  5E5A C;  3W97 D;  4XUJ D;  2ARO C;  3X1V A;  4Z5T D;  5AY8 D;  5CP6 C;  3B6F A;  3AZE A;  5B1M A;  3X1V B;  2PYO A;  4J8V A;  5FUG A;  3A6N C;  1KX5 A;  3B6F B;  2ZY5 A;  3AZE B;  5B1M B;  4J8V B;  5FUG B;  3MGQ D;  4Z66 C;  1KX5 B;  4XUJ A;  2FFF B;  3W97 B;  3B0D C;  4Z5T A;  5DNN C;  4XUJ B;  5AVC D;  2Y2L A;  5B2J C;  4Z5T B;  5JA4 A;  5E5A D;  3REH C;  2Y2P A;  5JA4 B;  4XZQ C;  2ARO D;  5CP6 D;  1W2E A;  3W96 D;  3MGQ B;  3C1C A;  5C3I B;  5AVC A;  4J8W C;  1M1A A;  3KUY C;  1HQ3 C;  3C1C B;  5E5A A;  5AVC B;  4Z66 D;  2JCH A;  5E5A B;  3AFA A;  3AYW C;  2CV5 C;  1P3O C;  3W96 A;  2ARO B;  5B24 C;  3W96 B;  3LJA D;  3REH D;  1TZY D;  4XZQ D;  4Z66 A;  3VH5 A;  2XD1 A;  4H9R A;  5F99 C;  3REJ D;  4Z66 B;  3AZM C;  4J8W D;  1U35 C;  1P3I C;  4H9R B;  3B0D B;  3KUY D;  1HQ3 D;  4J8U C;  3LJA A;  3AZL C;  1TZY A;  4WNN B;  2F8N K;  2IO5 C;  3AYW D;  3LJA B;  3REH B;  1TZY B;  4XZQ B;  3REJ A;  5AVB D;  1WWS A;  3B0C W;  4J8W A;  5B24 D;  3A1I A;  3REJ B;  1HQ3 A;  1N1J A;  5BNX A;  4J8W B;  4WU8 C;  1P34 C;  1EQZ A;  3KUY B;  1HQ3 B;  5F99 D;  5BNX B;  3AYW A;  2XD5 A;  5GT3 A;  3AZM D;  5BNV A;  5AV8 C;  3O62 C;  1U35 D;  3MGS C;  1P3I D;  1EQZ B;  5AVB A;  3AYW B;  4X23 C;  3C1B D;  5GT3 B;  1BFM A;  5BNV B;  4LD9 C;  3AZI C;  1M18 C;  2FJ7 A;  5AVB B;  4EO5 B;  2NQB C;  2HUE C;  2FJ7 B;  5CPJ C;  1P3B A;  4KGC C;  5F99 A;  5B31 A;  1F1E A;  3F6T A;  3AZM A;  1AOI D;  1U35 A;  1P3I A;  3REI A;  5F99 B;  3C1B A;  2Y2J A;  5DNM A;  3AZM B;  2Y2H A;  4WU8 D;  5AV6 C;  1U35 B;  1P34 D;  1P3I B;  2F8N D;  3C1B B;  5DNM B;  4UUZ A;  5AV8 D;  3O62 D;  3AV2 C;  2NZD A;  3MGS D;  2IO5 B;  4X23 D;  3LZ1 C;  2ZM5 A;  4UUZ B;  1AOI A;  3EG5 B;  3X1U C;  4LD9 D;  5B0Y A;  2NZD B;  3AZI D;  1M18 D;  1Z2C B;  2F8N G;  1AOI B;  4WU8 A;  2F8N A;  2NQB D;  5B0Y B;  3NQU A;  4KGC D;  3W98 C;  4WU8 B;  3EPJ A;  1P34 B;  2F8N B;  5AV8 A;  3NQU B;  3O62 A;  3KWQ D;  4X23 A;  3X1T C;  5AV8 B;  3O62 B;  5AV6 D;  4LD9 A;  4X23 B;  4H9P A;  3B6F C;  4LD9 B;  5BT1 C;  4H9N A;  4KGC A;  3AV2 D;  5B1M C;  2PYO C;  4H9P B;  3LZ1 D;  1KX5 C;  4KUD A;  3KWQ A;  4H9N B;  4KGC B;  5B32 D;  2RVQ C;  3LEL C;  3KXB C;  4XUJ C;  4KHA B;  3KWQ B;  2LY8 A;  1P3M A;  3W98 D;  1PZR A;  1F66 A;  5B32 G;  3X1T D;  2DQN C;  3AV2 B;  5B32 A;  1F66 B;  3WKJ C;  5C3I C;  5GT0 A;  5B32 B;  3EPK A;  3C1C C;  4WZS B;  5AVC C;  2PYO D;  5GT0 B;  4YM6 A;  1M1A C;  2RVQ D;  3LEL D;  2Y2O A;  3KXB D;  1P3K C;  3X1T A;  5B2I C;  1KX3 A;  2L5A A;  3B0C T;  3AFA C;  3X1T B;  3W96 C;  1KX3 B;  4E44 A;  4CAY A;  3UTB A;  3LEL A;  4J8X C;  3KXB A;  2PYO B;  3WKJ D;  2Y2M A;  4CAY B;  3LEL B;  2YFW A;  3KXB B;  1P3A D;  3C1C D;  1P3F A;  2YFW B;  1R4V A;  1M1A D;  1Q9C A;  1P3K D;  4H9S A;  5B2I D;  1TZY C; 
#chains in the Genus database with same CATH homology
 4G91 B;  3WKJ A;  3AN2 C;  3AFA D;  3WTP E;  1ZLA A;  1P3A A;  2G5H C;  3REJ C;  3WKJ B;  3AL0 C;  1BH8 A;  3MGP D;  1M19 D;  1P3A B;  1ZLA B;  4J8X D;  1P3K A;  4DQY B;  2Y2G A;  5B2I A;  5CHL B;  1EQZ C;  1M1A B;  4WV4 B;  1P3K B;  5B2I B;  5GT3 C;  5AVB C;  4EO5 C;  3AFA B;  3MGP A;  1M19 A;  2FJ7 C;  1TAF A;  4J8X A;  3MGP B;  3AN2 D;  1M19 B;  1TAF B;  4J8X B;  1P3B C;  5B31 C;  3MNN D;  3REI C;  3C1B C;  5DNM C;  5CPK C;  3MGR D;  1EQZ D;  2F2A C;  3AN2 A;  5GT3 D;  2NZD C;  5GXQ A;  3AZG A;  3MNN A;  3AN2 B;  1AOI C;  3IP4 C;  5B0Y C;  2FJ7 D;  3MNN B;  4CSR A;  2ZY3 A;  3R45 A;  3VH6 W;  3MGR A;  5AV5 A;  1P3B D;  1N1J B;  4NE3 A;  5B31 D;  3R45 B;  3MGR B;  5B1L C;  3REI D;  5CPK D;  3B0B A;  5DNM D;  2BYM A;  3B6G C;  3KFU G;  3V9R A;  2BYM B;  5B31 G;  4H9O A;  2NZD D;  3WTP C;  3AZH C;  3V9R B;  1P3L A;  4KUD C;  4H9O B;  3EPH A;  3KWQ C;  1P3B B;  5B31 B;  5B0Y D;  5CPK A;  3X1S C;  1P3L B;  3REI B;  5CPK B;  1P3M C;  5B1L D;  5BO0 A;  5B40 A;  3LZ0 A;  1F66 C;  3AZF C;  4R8P A;  5KDM A;  5BO0 B;  5B32 C;  3B6G D;  5GT0 C;  3VH5 T;  2CWE A;  4HGA C;  3WTP D;  3AZH D;  2JSS A;  2Y2N A;  5GSU A;  4KUD D;  4YM6 C;  5B1L A;  2G5I C;  4AWL B;  3AV1 D;  5GSU B;  3X1S D;  5B1L B;  2UWX A;  5AV9 D;  3B6G A;  1KX3 C;  2Y2I A;  1P3M D;  1P3G C;  3B6G B;  3WTP A;  3AZH A;  1F66 D;  3AZF D;  3WTP B;  3AZH B;  3UTB C;  3A1K A;  3AV1 A;  3X1S A;  4KUD B;  1B67 A;  5GT0 D;  5AV9 A;  3AV1 B;  5G49 A;  3X1S B;  3TU4 D;  3REL A;  3REK C;  5AV9 B;  1P3F C;  4YM6 D;  3WAA D;  5G49 B;  3AZK C;  4G91 C;  3REL B;  3AZF A;  3UT9 A;  1P3M B;  4H9S C;  2BG1 A;  1B6W A;  3AZF B;  3UT9 B;  1KX3 D;  2YFV A;  1P3G D;  1ZLA C;  1P3A C;  3TU4 A;  2YFV B;  3WAA A;  4HGA B;  3TU4 B;  3UTB D;  2Y2Q A;  4YM6 B;  3WAA B;  2HIO A;  1P3G A;  3REK D;  1P3F D;  3W99 D;  3AZK D;  3VH6 T;  1P3G B;  3MGP C;  1M19 C;  2ZY2 A;  5JRG C;  3UTB B;  1ZLA D;  5CPI C;  3REK A;  3H0R C;  3VH5 W;  1ID3 C;  3W99 A;  4Z2M H;  3AZK A;  3REK B;  1P3F B;  3W99 B;  3AZK B;  3MVD C;  3AZN C;  5GXQ C;  3AZG C;  3MNN C;  4ZBJ C;  3WA9 A;  4YS3 D;  3MGR C;  1BH8 B;  4QLC C;  3W97 A;  4NE5 A;  5AV5 C;  3WA9 B;  5JRG D;  4G92 C;  1HTA A;  5CPI D;  4M6B A;  5AY8 A;  1ID3 D;  1P3P C;  5AY8 B;  3AZJ C;  4E45 A;  4YS3 A;  2DF4 C;  5JRG A;  3MGQ A;  3MVD D;  3AZN D;  5GXQ D;  3AZG D;  4YS3 B;  3KSY A;  1P3L C;  5CPI A;  5JRG B;  1ID3 A;  2Y2K A;  3A6N D;  5CPI B;  4QLC D;  1ID3 B;  5AV5 D;  1WWI A;  2ARO A;  3MVD A;  3AZN A;  3FDD A;  5CP6 A;  3LZ0 C;  5B40 C;  5DNN D;  1P3P D;  4R8P C;  2BYK A;  4UPK A;  5B2J D;  3MVD B;  3AZN B;  5GXQ B;  5CP6 B;  3AZG B;  3AZJ D;  3A6N A;  4ZBJ B;  2BYK B;  4QLC A;  1A7W A;  3H0L C;  1S32 C;  4CSR B;  3A6N B;  4AWL C;  4JJN C;  4QLC B;  5GSU C;  1P3L D;  5AV5 B;  4G92 B;  5DNN A;  1P3P A;  1BH9 A;  5B2J A;  4WNN A;  3AZJ A;  5DNN B;  1P3P B;  1BH9 B;  3REH A;  5B2J B;  3P5J B;  2RIQ A;  4XZQ A;  3AZJ B;  5B40 D;  3LZ0 D;  3UTA C;  2CV5 D;  1P3O D;  4R8P D;  2W8S A;  3LJA C;  1KX4 C;  4WJ3 C;  3AV1 C;  5BS7 C;  3KUY A;  5AV9 C;  1S32 D;  1H3O A;  3REL C;  4JJN D;  4WU9 C;  5GSU D;  2CV5 A;  1H3O B;  1P3O A;  3UT9 C;  5B40 B;  3LZ0 B;  5B24 A;  4J8U D;  2CV5 B;  4R8P B;  5KDM B;  1P3O B;  3AZL D;  1S32 A;  5B24 B;  3TU4 C;  4JJN A;  3UTA D;  2ZY4 A;  1S32 B;  4ZUX C;  3WAA C;  5B0Z C;  1KX4 D;  4JJN B;  5B33 C;  3H0M C;  4J8U A;  2HIO C;  3AZL A;  1T3U A;  3REL D;  4WU9 D;  4J8U B;  3UTA A;  3AZL B;  3UT9 D;  1KX4 A;  3VH6 A;  4DRA A;  5BS7 A;  3UTA B;  2JE5 A;  1KX4 B;  2VQR A;  1P34 A;  2F8N H;  4WU9 A;  5CPJ D;  4ZUX D;  3W99 C;  5B0Z D;  4WU9 B;  5B33 D;  3MGS A;  4NFT A;  3EPL A;  4DRB A;  4H9Q A;  2HIO D;  3MGS B;  3AZI A;  1M18 A;  4H9Q B;  3X1V C;  2NQB A;  3AZI B;  1M18 B;  5CPJ A;  4ZUX A;  3AZE C;  5B0Z A;  3WA9 C;  4J8V C;  1JFI A;  2HUE B;  2NQB B;  4KHA A;  5B33 A;  3X1U D;  4NE6 A;  1KU5 A;  5CPJ B;  4ZUX B;  3NQJ A;  5B0Z B;  3W97 C;  1ULY A;  1JFI B;  5AV6 A;  5B33 B;  2J8P A;  3NQJ B;  4Z5T C;  5AY8 C;  2HIO B;  5AV6 B;  3AV2 A;  3LZ1 A;  4YS3 C;  3X1U A;  3LZ1 B;  3MGQ C;  3X1V D;  3X1U B;  3B6F D;  4Z2M G;  5BT1 D;  3W98 A;  3AZE D;  5B1M D;  3WA9 D;  4J8V D;  1KX5 D;  3W98 B;  5E5A C;  3W97 D;  4XUJ D;  2ARO C;  3X1V A;  4Z5T D;  5AY8 D;  5CP6 C;  3B6F A;  3AZE A;  5B1M A;  3X1V B;  2PYO A;  4J8V A;  5FUG A;  3A6N C;  1KX5 A;  3B6F B;  2ZY5 A;  3AZE B;  5B1M B;  4J8V B;  5FUG B;  3MGQ D;  4Z66 C;  1KX5 B;  4XUJ A;  2FFF B;  3W97 B;  3B0D C;  4Z5T A;  5DNN C;  4XUJ B;  5AVC D;  2Y2L A;  5B2J C;  4Z5T B;  5JA4 A;  5E5A D;  3REH C;  2Y2P A;  5JA4 B;  4XZQ C;  2ARO D;  5CP6 D;  1W2E A;  3W96 D;  3MGQ B;  3C1C A;  5C3I B;  5AVC A;  4J8W C;  1M1A A;  3KUY C;  1HQ3 C;  3C1C B;  5E5A A;  5AVC B;  4Z66 D;  2JCH A;  5E5A B;  3AFA A;  3AYW C;  2CV5 C;  1P3O C;  3W96 A;  2ARO B;  5B24 C;  3W96 B;  3LJA D;  3REH D;  1TZY D;  4XZQ D;  4Z66 A;  3VH5 A;  2XD1 A;  4H9R A;  5F99 C;  3REJ D;  4Z66 B;  3AZM C;  4J8W D;  1U35 C;  1P3I C;  4H9R B;  3B0D B;  3KUY D;  1HQ3 D;  4J8U C;  3LJA A;  3AZL C;  1TZY A;  4WNN B;  2F8N K;  2IO5 C;  3AYW D;  3LJA B;  3REH B;  1TZY B;  4XZQ B;  3REJ A;  5AVB D;  1WWS A;  3B0C W;  4J8W A;  5B24 D;  3A1I A;  3REJ B;  1HQ3 A;  1N1J A;  5BNX A;  4J8W B;  4WU8 C;  1P34 C;  1EQZ A;  3KUY B;  1HQ3 B;  5F99 D;  5BNX B;  3AYW A;  2XD5 A;  5GT3 A;  3AZM D;  5BNV A;  5AV8 C;  3O62 C;  1U35 D;  3MGS C;  1P3I D;  1EQZ B;  5AVB A;  3AYW B;  4X23 C;  3C1B D;  5GT3 B;  1BFM A;  5BNV B;  4LD9 C;  3AZI C;  1M18 C;  2FJ7 A;  5AVB B;  4EO5 B;  2NQB C;  2HUE C;  2FJ7 B;  5CPJ C;  1P3B A;  4KGC C;  5F99 A;  5B31 A;  1F1E A;  3F6T A;  3AZM A;  1AOI D;  1U35 A;  1P3I A;  3REI A;  5F99 B;  3C1B A;  2Y2J A;  5DNM A;  3AZM B;  2Y2H A;  4WU8 D;  5AV6 C;  1U35 B;  1P34 D;  1P3I B;  2F8N D;  3C1B B;  5DNM B;  4UUZ A;  5AV8 D;  3O62 D;  3AV2 C;  2NZD A;  3MGS D;  2IO5 B;  4X23 D;  3LZ1 C;  2ZM5 A;  4UUZ B;  1AOI A;  3EG5 B;  3X1U C;  4LD9 D;  5B0Y A;  2NZD B;  3AZI D;  1M18 D;  1Z2C B;  2F8N G;  1AOI B;  4WU8 A;  2F8N A;  2NQB D;  5B0Y B;  3NQU A;  4KGC D;  3W98 C;  4WU8 B;  3EPJ A;  1P34 B;  2F8N B;  5AV8 A;  3NQU B;  3O62 A;  3KWQ D;  4X23 A;  3X1T C;  5AV8 B;  3O62 B;  5AV6 D;  4LD9 A;  4X23 B;  4H9P A;  3B6F C;  4LD9 B;  5BT1 C;  4H9N A;  4KGC A;  3AV2 D;  5B1M C;  2PYO C;  4H9P B;  3LZ1 D;  1KX5 C;  4KUD A;  3KWQ A;  4H9N B;  4KGC B;  5B32 D;  2RVQ C;  3LEL C;  3KXB C;  4XUJ C;  4KHA B;  3KWQ B;  2LY8 A;  1P3M A;  3W98 D;  1PZR A;  1F66 A;  5B32 G;  3X1T D;  2DQN C;  3AV2 B;  5B32 A;  1F66 B;  3WKJ C;  5C3I C;  5GT0 A;  5B32 B;  3EPK A;  3C1C C;  4WZS B;  5AVC C;  2PYO D;  5GT0 B;  4YM6 A;  1M1A C;  2RVQ D;  3LEL D;  2Y2O A;  3KXB D;  1P3K C;  3X1T A;  5B2I C;  1KX3 A;  2L5A A;  3B0C T;  3AFA C;  3X1T B;  3W96 C;  1KX3 B;  4E44 A;  4CAY A;  3UTB A;  3LEL A;  4J8X C;  3KXB A;  2PYO B;  3WKJ D;  2Y2M A;  4CAY B;  3LEL B;  2YFW A;  3KXB B;  1P3A D;  3C1C D;  1P3F A;  2YFW B;  1R4V A;  1M1A D;  1Q9C A;  1P3K D;  4H9S A;  5B2I D;  1TZY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...