2NQBC

Drosophila nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbC00
4YS3C 5B40B 3REJB 1AOIC 5B24D 3AFAA 3R45B 3AYWA 2BYMA 3LJAB 1EQZC 5KDMB 2NZDB 4H9QA 3WA9B 1N1JB 5JA4A 3B6GB 5E5AA 3REIC 5AV8C 3LZ0C 1B6WA 1P3FD 1KX5B 3MGQD 3MGRA 5GSUC 4J8VA 1ID3C 3AV1A 1TAFB 3WTPB 4XUJA 5JRGD 1ZLAB 3C1BD 3AFAC 3UTAA 1P3GB 4J8WB 1P3AA 3TU4D 1KX3A 1P3PB 1F66A 5E5AC 4UUZB 3AV2D 1TZYB 4XZQD 3X1VD 3MGRC 4J8VC 4XUJC 3MVDB 3AZKB 4ZBJB 5B2JC 3AZIB 1M1AD 3UTAC 3LELB 5FUGB 1P3AC 3RELD 5BO0A 1KX3C 1H3OA 5B24A 1HQ3C 4CSRB 5B31A 4J8XA 3NQUB 3AZEC 3WKJD 3KUYB 3V9RA 5BNVA 5DNNA 5B40D 3REJD 3UTBB 4NE6A 1P3FA 3MGQA 2NZDD 5GXQD 5CPJD 5BNXB 2YFWA 4JJND 3AZMB 2IO5C 3B6GD 4R8PA 5JRGA 4WNNB 5B24C 4DRAA 5B31C 4J8XC 1BFMA 2BYKB 3C1CA 5GT3B 1KX5D 1P3ID 2FJ7B 3TU4A 2RVQD 2PYOB 2HUEB 5DNNC 3W96B 3WTPD 5CP6B 3W99B 1ZLAD 1A7WA 4Z5TB 3AV2A 1P3GD 5GT0B 1P3FC 3MGQC 4J8WD 4H9PB 5BT1D 1P3PD 4R8PC 5JRGC 4G92B 3A6ND 3MGPA 5B0YB 1M1AA 1TZYD 3C1CC 1P3LB 4WU8A 3W97D 4E44A 3RELA 1BH8B 3TU4C 3MVDD 3AZKD 3AZID 4H9SA 3LELD 3AV2C 3B6FA 3WKJA 5B33B 3KXBB 1P3BA 1ULYA 3MGPC 1M1AC 4KHAB 5AVBB 4WU8C 5B32B 3RELC 4ZUXB 5KDMA 3KUYD 4H9RA 3AZFA 5GXQA 5CPJA 1N1JA 4YM6B 1P34A 2NZDA 4JJNA 4H9SC 3UTBD 3B6FC 1P3MD 1P3OA 5B1LA 3MNND 3WKJC 3VH5A 1P3BC 1P3IA 3KWQB 1U35B 3AZMD 3X1UB 5CPIB 5DNMB 5G49B 3AZGB 1S32B 1ZLAA 2L5AA 5AVCB 5GT3D 5B0ZA 4J8WA 3AZFC 5GXQC 5CPJC 1P34C 2FJ7D 2NZDC 4JJNC 2CV5A 2PYOD 3W96D 1P3PA 5CP6D 4H9NB 3W99D 3A6NA 5B1LC 1P3OC 4Z5TD 1KX4B 5B31G 4CAYB 1KX5C 3W97A 3AN2B 4HGAB 1P3IC 2RVQC 5B2IA 3AZIA 1ZLAC 5B0YD 5B1MA 4Z66A 1P3LD 5B0ZC 5FUGA 4J8WC 3AZJB 2CV5C 5B2JA 5BT1C 3AZNB 1P3PC 3A6NC 2AROD 3O62A 4LD9D 4EO5B 3REKA 3W97C 4G91C 3NQUA 5B33D 5B2IC 4YS3B 4H9OB 3KXBD 3X1TB 3KUYA 5AV6A 3NQJA 3AZIC 4X23D 5B1MC 1HQ3A 3AZEA 3AZLB 4Z66C 5AVBD 1P3MA 5B32D 3MNNA 4QLCB 4ZUXD 1M18A 3W98A 4J8UB 5AV8B 5BNXA 4YM6D 3LZ0B 3AZMA 3O62C 4KGCB 3REKC 5GSUB 4WNNA 3VH6W 1JFIA 4KUDA 2NQBB 3KUYC 5AV6C 5F99D 3KWQD 1U35D 2PYOA 3X1UD 3W96A 5DNMD 3AFAB 3AZGD 2BYMB 3AYWB 3X1SB 5CPID 1P3MC 1S32D 4WZSB 2F8NG 3MNNC 5AVCD 1WWSA 5JA4B 1M18C 3W98C 4H9PA 3AZMC 3MGRB 4J8VB 3LJAD 2LY8A 5B0YA 1KX4D 3WA9D 4KUDC 3AV1B 3AN2D 2FJ7C 1BH8A 1BH9A 5AV9B 2PYOC 1P3KB 3W96C 3UTAB 3VH5W 3C1BA 1P3AB 2AROA 3VH6T 4LD9A 3AZJD 1F66B 2F8NK 5B33A 1M19B 3AZND 4XZQA 3X1VA 5B0YC 4X23A 5AV5B 5AVBA 5B32A 1F1EA 4YS3D 1WWIA 4ZUXA 3X1TD 3C1BC 3AZHB 2AROC 5BO0B 3UT9B 3AZLD 4LD9C 4QLCD 2IO5B 5B33C 1H3OB 5F99A 3VH6A 5AV8D 3VH5T 3LZ0D 3KWQA 4J8XB 4J8UD 4XZQC 5CHLB 5B31B 5G49A 5DNMA 3X1VC 4X23C 3AZGA 5AVBC 3LZ1B 4KGCD 5GSUD 5B32C 5BNVB 5AVCA 5DNNB 4ZUXC 3B0DB 2NQBD 4Z2MH 5B40A 3REJA 3AFAD 3AYWD 3X1SD 4H9NA 3R45A 3MGQB 2HIOB 3LJAA 1KX4A 2YFVB 3WA9A 4CAYA 3WAAB 4NE5A 5JRGB 4R8PB 5F99C 3KWQC 3B0CW 3B6GA 4WU9B 5DNMC 3AZGC 3C1CB 1Q9CA 4J8VD 1KX5A 4AWLC 5AVCC 5C3IC 3AV1D 5B40C 1TAFA 5AV9D 3WTPA 3WTPE 3REJC 1P3KD 3UTAD 1HTAA 1P3AD 1P3GA 3LJAC 3REHB 1KX4C 3WA9C 1F66D 1R4VA 3B6GC 3MGPB 1M19D 1M1AB 3X1TA 4WU8B 4UUZA 1TZYA 3RELB 5CPKB 5GT0D 5AV5D 3AZLA 4QLCA 3MVDA 3WTPC 3AZKA 3B0CT 3B6FB 4J8UA 4E45A 2F8NB 3AZHD 3LELA 1P3GC 3UT9D 1P3BB 5AY8B 4KGCA 3MGSB 2NQBA 3X1TC 1TZYC 4J8XD 5B31D 3X1SA 4CSRA 3AZLC 3LZ1D 3AZFB 4H9RB 1P34B 5GXQB 5CPJB 4QLCC 1AOIB 4JJNB 5DNND 3MVDC 3AZKC 4ZBJC 4J8UC 1P3OB 5B1LB 3LELC 3UTBA 1EQZB 4KGCC 1P3IB 2HIOD 5B32G 3REIB 2NQBC 3WAAD 4R8PD 5AV9A 1P3KA 4WU9D 3AYWC 3C1CD 4M6BA 3X1SC 1ID3B 5B0ZB 2BYKA 5GT3A 2CV5B 2FJ7A 3A6NB 3UTBC 5CP6A 1M19A 3W99A 4H9QB 4Z5TA 3W97B 4G91B 3REHD 5GT0A 2JSSA 5B2IB 5AV5A 5E5AB 3AV1C 5AV9C 3MGPD 1P3KC 4NE3A 5B1MB 2F8NH 4Z66B 4WU8D 3AZHA 5CPKD 1P3LA 5GT3C 4XUJB 3UT9A 5B2JB 2HUEC 1F66C 5CP6C 3O62B 1M19C 3W99C 3B6FD 4Z5TC 2F8ND 1KX3B 3REKB 3KSYA 5GT0C 5AV5C 3LZ1A 5AV6B 3NQJB 5AY8D 4DRBA 1P3BD 3KXBA 3MGSD 4G92C 1HQ3B 3AZEB 1P3MB 3AZHC 4NFTA 3MNNB 4KHAA 1P3LC 3UT9C 3AZFD 1P34D 1M18B 3W98B 2CWEA 2HIOA 1AOID 2YFVA 4YM6A 1KU5A 3WAAA 1P3OD 5B1LD 1EQZD 1JFIB 4WU9A 4KUDB 3LZ1C 3KXBC 3REID 1U35A 3B0DC 5B24B 3X1UA 5CPIA 3B0BA 1S32A 3V9RB 1ID3D 5B0ZD 2HIOC 1B67A 3REHA 2CV5D 4YM6C 3WAAC 1P3FB 4WU9C 2YFWB 5CPKA 1BH9B 5B2ID 3AN2A 5E5AD 1U35C 3C1BB 3X1UC 5CPIC 4KUDD 4WV4B 2AROB 4Z2MG 5B1MD 3MGRD 1S32C 4Z66D 3TU4B 2F8NA 4LD9B 3REHC 4XUJD 3AZJA 5B2JD 5AY8A 3AV2B 3MGSA 4XZQB 3AZNA 4X23B 3X1VB 3O62D 1KX3D 3REKD 5CPKC 5BS7A 3AN2C 4HGAC 5AV6D 4YS3A 4H9OA 1AOIA 1HQ3D 3AZED 1EQZA 3AZJC 1M18D 5AY8C 3W98D 5F99B 3MGSC 3AZNC 3REIA 5AV8A 3LZ0A 3WKJB 4AWLB 4EO5C 5BS7C 5GSUA 5C3IB 1ID3A
chains in the Genus database with same CATH superfamily
2Y2QA 4YS3C 5B40B 3REJB 1AOIC 5B24D 3AFAA 3R45B 3AYWA 2BYMA 3LJAB 1EQZC 5KDMB 2NZDB 4H9QA 3WA9B 1N1JB 5JA4A 3B6GB 5E5AA 3REIC 5AV8C 3LZ0C 1B6WA 1P3FD 1KX5B 3MGQD 3MGRA 5GSUC 4J8VA 1ID3C 3AV1A 1TAFB 3WTPB 4XUJA 5JRGD 1ZLAB 3C1BD 3AFAC 3UTAA 1P3GB 3IP4C 4J8WB 3A1IA 1P3AA 3TU4D 1KX3A 1P3PB 1F66A 5E5AC 4UUZB 3AV2D 1TZYB 4XZQD 3X1VD 3MGRC 4J8VC 4XUJC 3MVDB 3AZKB 4ZBJB 5B2JC 3AZIB 1M1AD 3UTAC 3LELB 3F6TA 5FUGB 1P3AC 3RELD 2JCHA 5BO0A 1KX3C 1H3OA 3H0RC 2BG1A 5B24A 1HQ3C 4CSRB 5B31A 4J8XA 3NQUB 3AZEC 3WKJD 3KUYB 3V9RA 2ZY4A 5BNVA 5DNNA 5B40D 3REJD 3UTBB 4NE6A 1P3FA 2ZY3A 3MGQA 2NZDD 5GXQD 5CPJD 5BNXB 2YFWA 2ZM5A 4JJND 3AZMB 2IO5C 2Y2GA 3B6GD 4R8PA 5JRGA 4WNNB 5B24C 4DRAA 5B31C 4J8XC 1BFMA 2BYKB 3C1CA 5GT3B 1KX5D 1P3ID 2FJ7B 3TU4A 2RVQD 2PYOB 2HUEB 5DNNC 3W96B 4WJ3C 3WTPD 5CP6B 3W99B 1ZLAD 1A7WA 4Z5TB 3AV2A 1P3GD 5GT0B 1P3FC 3MGQC 4J8WD 4H9PB 2W8SA 5BT1D 4R8PC 5JRGC 1P3PD 4G92B 3A6ND 3MGPA 5B0YB 1M1AA 1TZYD 3C1CC 1P3LB 4WU8A 3W97D 4UPKA 2DQNC 4E44A 3RELA 1BH8B 3TU4C 3MVDD 3AZKD 3AZID 4H9SA 3KFUG 3H0LC 3LELD 3AV2C 3B6FA 2RIQA 3WKJA 2VQRA 5B33B 3KXBB 1P3BA 1ULYA 3MGPC 1M1AC 4KHAB 5AVBB 4WU8C 5B32B 3RELC 4ZUXB 5KDMA 3KUYD 4H9RA 3AZFA 5GXQA 5CPJA 1N1JA 4YM6B 1P34A 2NZDA 4JJNA 4H9SC 2Y2KA 3UTBD 3B6FC 1P3MD 1P3OA 5B1LA 3MNND 3WKJC 3VH5A 1P3BC 1P3IA 3KWQB 1U35B 3AZMD 3X1UB 5CPIB 5DNMB 5G49B 3AZGB 1S32B 1ZLAA 2L5AA 5AVCB 5GT3D 5B0ZA 4J8WA 3AZFC 5GXQC 5CPJC 1P34C 2FJ7D 2NZDC 4JJNC 2CV5A 2PYOD 3W96D 1P3PA 5CP6D 4H9NB 3W99D 3A6NA 5B1LC 1P3OC 4Z5TD 1KX4B 5B31G 4CAYB 1KX5C 3W97A 3AN2B 4HGAB 1P3IC 2RVQC 5B2IA 3AZIA 1ZLAC 5B0YD 5B1MA 4Z66A 1P3LD 5B0ZC 5FUGA 4J8WC 3AZJB 2CV5C 5B2JA 5BT1C 3AZNB 1P3PC 3A6NC 2Y2OA 2AROD 3O62A 1Z2CB 4LD9D 4EO5B 3REKA 3W97C 4G91C 3NQUA 5B33D 5B2IC 4YS3B 4H9OB 3KXBD 2Y2LA 3X1TB 3KUYA 5AV6A 3NQJA 3EPKA 3AZIC 4X23D 5B1MC 1HQ3A 3AZEA 3AZLB 4Z66C 5AVBD 1P3MA 1W2EA 5B32D 3MNNA 4QLCB 4ZUXD 1M18A 3W98A 4J8UB 5AV8B 5BNXA 4YM6D 3LZ0B 3AZMA 3O62C 4KGCB 3REKC 5GSUB 4WNNA 3VH6W 1JFIA 4KUDA 2NQBB 3KUYC 5AV6C 5F99D 3KWQD 1U35D 2PYOA 3X1UD 3W96A 5DNMD 3AFAB 3EG5B 2BYMB 3AZGD 3X1SB 3AYWB 5CPID 1P3MC 1S32D 4WZSB 2F8NG 3MNNC 5AVCD 1WWSA 5JA4B 1M18C 3W98C 4H9PA 3AZMC 3MGRB 4J8VB 3LJAD 2LY8A 5B0YA 1KX4D 3WA9D 4KUDC 3AV1B 2UWXA 3AN2D 2FJ7C 1BH8A 1BH9A 5AV9B 2PYOC 1P3KB 3W96C 3UTAB 3VH5W 3C1BA 1P3AB 2AROA 3VH6T 4LD9A 3AZJD 1F66B 2F8NK 5B33A 1M19B 3AZND 4XZQA 3X1VA 5B0YC 4X23A 5AV5B 5AVBA 5B32A 1F1EA 4YS3D 1WWIA 4ZUXA 3X1TD 3C1BC 2Y2IA 3AZHB 2AROC 5BO0B 3FDDA 3UT9B 3AZLD 4LD9C 4QLCD 2IO5B 5B33C 1H3OB 5F99A 3VH6A 5AV8D 3VH5T 3LZ0D 3KWQA 4J8XB 4J8UD 2JE5A 5CHLB 4XZQC 5G49A 5B31B 5DNMA 3X1VC 4X23C 3AZGA 5AVBC 3LZ1B 4KGCD 5GSUD 5B32C 5BNVB 5AVCA 5DNNB 4ZUXC 3B0DB 2NQBD 4Z2MH 5B40A 3REJA 3AFAD 3AYWD 3X1SD 4H9NA 3R45A 3MGQB 2HIOB 3LJAA 1KX4A 2YFVB 3WA9A 4CAYA 3WAAB 4NE5A 5JRGB 4R8PB 5F99C 3KWQC 3B0CW 3B6GA 4WU9B 5DNMC 3AZGC 3C1CB 1Q9CA 4J8VD 1KX5A 4AWLC 5AVCC 5C3IC 3AV1D 5B40C 1TAFA 5AV9D 3WTPA 3WTPE 3REJC 1P3KD 3UTAD 1HTAA 1P3AD 1P3GA 3LJAC 3REHB 1KX4C 3WA9C 2Y2HA 1F66D 1R4VA 3B6GC 3MGPB 1M19D 1M1AB 3X1TA 4WU8B 4UUZA 1TZYA 3RELB 5CPKB 5GT0D 5AV5D 3AZLA 4QLCA 3MVDA 3WTPC 3AZKA 3B0CT 3B6FB 4J8UA 3H0MC 4E45A 3AZHD 3LELA 1P3GC 2F8NB 3UT9D 1P3BB 5AY8B 4KGCA 3MGSB 2NQBA 3X1TC 2Y2JA 1TZYC 4J8XD 5B31D 3X1SA 4CSRA 3AZLC 3LZ1D 3AZFB 4H9RB 1P34B 5GXQB 5CPJB 4QLCC 1AOIB 4JJNB 5DNND 3MVDC 3AZKC 4ZBJC 4J8UC 1P3OB 5B1LB 3LELC 3UTBA 2J8PA 1EQZB 4KGCC 2DF4C 1P3IB 2HIOD 2G5HC 5B32G 3REIB 2NQBC 3WAAD 4R8PD 5AV9A 1P3KA 4WU9D 3AYWC 3C1CD 4M6BA 3X1SC 1ID3B 5B0ZB 2BYKA 5GT3A 2CV5B 2FJ7A 3A6NB 3UTBC 5CP6A 2ZY5A 1M19A 3W99A 4H9QB 4Z5TA 3W97B 4G91B 3REHD 5GT0A 2JSSA 5B2IB 5AV5A 5E5AB 3AV1C 5AV9C 3MGPD 1P3KC 4NE3A 5B1MB 2F8NH 4Z66B 4WU8D 3AZHA 5CPKD 1P3LA 2FFFB 5GT3C 4XUJB 3UT9A 5B2JB 2HUEC 1F66C 5CP6C 3O62B 1M19C 3W99C 3B6FD 4Z5TC 2F8ND 1KX3B 3REKB 3KSYA 2XD1A 5GT0C 5AV5C 3LZ1A 5AV6B 3NQJB 5AY8D 4DRBA 1P3BD 3KXBA 3MGSD 4G92C 1HQ3B 2XD5A 3AZEB 1P3MB 3AZHC 4NFTA 3MNNB 4KHAA 3EPJA 1P3LC 3UT9C 3AZFD 1P34D 1M18B 3W98B 2CWEA 2HIOA 1AOID 2YFVA 4DQYB 4YM6A 1KU5A 3WAAA 1P3OD 5B1LD 1EQZD 2G5IC 1JFIB 4WU9A 4KUDB 3LZ1C 3KXBC 2F2AC 3REID 1U35A 3B0DC 5B24B 3X1UA 5CPIA 3B0BA 1S32A 3V9RB 1ID3D 5B0ZD 2HIOC 1B67A 3REHA 2CV5D 4YM6C 3WAAC 2Y2MA 3EPHA 1P3FB 4WU9C 2YFWB 5CPKA 1BH9B 5B2ID 3AN2A 5E5AD 1U35C 3C1BB 3X1UC 5CPIC 4KUDD 4WV4B 2AROB 4Z2MG 5B1MD 3MGRD 1S32C 4Z66D 3TU4B 2F8NA 4LD9B 3A1KA 3REHC 4XUJD 3AZJA 5B2JD 5AY8A 3AV2B 3MGSA 4XZQB 3AZNA 4X23B 3X1VB 3O62D 1KX3D 2Y2PA 3REKD 5CPKC 2Y2NA 5BS7A 3AN2C 4HGAC 5AV6D 4YS3A 4H9OA 1AOIA 3EPLA 1HQ3D 3AZED 1PZRA 1EQZA 3AZJC 3P5JB 1M18D 5AY8C 3W98D 5F99B 3MGSC 1T3UA 3AZNC 3REIA 5AV8A 3LZ0A 3AL0C 3WKJB 2ZY2A 4AWLB 4EO5C 5BS7C 5GSUA 5C3IB 1ID3A
chains in the Genus database with same CATH topology
2Y2QA 4YS3C 5B40B 3REJB 1AOIC 5B24D 3AFAA 3R45B 3AYWA 2BYMA 3LJAB 1EQZC 5KDMB 2NZDB 4H9QA 3WA9B 1N1JB 5JA4A 3B6GB 5E5AA 3REIC 5AV8C 3LZ0C 1B6WA 1P3FD 1KX5B 3MGQD 3MGRA 5GSUC 4J8VA 1ID3C 3AV1A 1TAFB 3WTPB 4XUJA 5JRGD 1ZLAB 3C1BD 3AFAC 3UTAA 1P3GB 3IP4C 4J8WB 3A1IA 1P3AA 3TU4D 1KX3A 1P3PB 1F66A 5E5AC 4UUZB 3AV2D 1TZYB 4XZQD 3X1VD 3MGRC 4J8VC 4XUJC 3MVDB 3AZKB 4ZBJB 5B2JC 3AZIB 1M1AD 3UTAC 3LELB 3F6TA 5FUGB 1P3AC 3RELD 2JCHA 5BO0A 1KX3C 1H3OA 3H0RC 2BG1A 5B24A 1HQ3C 4CSRB 5B31A 4J8XA 3NQUB 3AZEC 3WKJD 3KUYB 3V9RA 2ZY4A 5BNVA 5DNNA 5B40D 3REJD 3UTBB 4NE6A 1P3FA 2ZY3A 3MGQA 2NZDD 5GXQD 5CPJD 5BNXB 2YFWA 2ZM5A 4JJND 3AZMB 2IO5C 2Y2GA 3B6GD 4R8PA 5JRGA 4WNNB 5B24C 4DRAA 5B31C 4J8XC 1BFMA 2BYKB 3C1CA 5GT3B 1KX5D 1P3ID 2FJ7B 3TU4A 2RVQD 2PYOB 2HUEB 5DNNC 3W96B 4WJ3C 3WTPD 5CP6B 3W99B 1ZLAD 1A7WA 4Z5TB 3AV2A 1P3GD 5GT0B 1P3FC 3MGQC 4J8WD 4H9PB 2W8SA 5BT1D 4R8PC 5JRGC 1P3PD 4G92B 3A6ND 3MGPA 5B0YB 1M1AA 1TZYD 3C1CC 1P3LB 4WU8A 3W97D 4UPKA 2DQNC 4E44A 3RELA 1BH8B 3TU4C 3MVDD 3AZKD 3AZID 4H9SA 3KFUG 3H0LC 3LELD 3AV2C 3B6FA 2RIQA 3WKJA 2VQRA 5B33B 3KXBB 1P3BA 1ULYA 3MGPC 1M1AC 4KHAB 5AVBB 4WU8C 5B32B 3RELC 4ZUXB 5KDMA 3KUYD 4H9RA 3AZFA 5GXQA 5CPJA 1N1JA 4YM6B 1P34A 2NZDA 4JJNA 4H9SC 2Y2KA 3UTBD 3B6FC 1P3MD 1P3OA 5B1LA 3MNND 3WKJC 3VH5A 1P3BC 1P3IA 3KWQB 1U35B 3AZMD 3X1UB 5CPIB 5DNMB 5G49B 3AZGB 1S32B 1ZLAA 2L5AA 5AVCB 5GT3D 5B0ZA 4J8WA 3AZFC 5GXQC 5CPJC 1P34C 2FJ7D 2NZDC 4JJNC 2CV5A 2PYOD 3W96D 1P3PA 5CP6D 4H9NB 3W99D 3A6NA 5B1LC 1P3OC 4Z5TD 1KX4B 5B31G 4CAYB 1KX5C 3W97A 3AN2B 4HGAB 1P3IC 2RVQC 5B2IA 3AZIA 1ZLAC 5B0YD 5B1MA 4Z66A 1P3LD 5B0ZC 5FUGA 4J8WC 3AZJB 2CV5C 5B2JA 5BT1C 3AZNB 1P3PC 3A6NC 2Y2OA 2AROD 3O62A 1Z2CB 4LD9D 4EO5B 3REKA 3W97C 4G91C 3NQUA 5B33D 5B2IC 4YS3B 4H9OB 3KXBD 2Y2LA 3X1TB 3KUYA 5AV6A 3NQJA 3EPKA 3AZIC 4X23D 5B1MC 1HQ3A 3AZEA 3AZLB 4Z66C 5AVBD 1P3MA 1W2EA 5B32D 3MNNA 4QLCB 4ZUXD 1M18A 3W98A 4J8UB 5AV8B 5BNXA 4YM6D 3LZ0B 3AZMA 3O62C 4KGCB 3REKC 5GSUB 4WNNA 3VH6W 1JFIA 4KUDA 2NQBB 3KUYC 5AV6C 5F99D 3KWQD 1U35D 2PYOA 3X1UD 3W96A 5DNMD 3AFAB 3EG5B 2BYMB 3AZGD 3X1SB 3AYWB 5CPID 1P3MC 1S32D 4WZSB 2F8NG 3MNNC 5AVCD 1WWSA 5JA4B 1M18C 3W98C 4H9PA 3AZMC 3MGRB 4J8VB 3LJAD 2LY8A 5B0YA 1KX4D 3WA9D 4KUDC 3AV1B 2UWXA 3AN2D 2FJ7C 1BH8A 1BH9A 5AV9B 2PYOC 1P3KB 3W96C 3UTAB 3VH5W 3C1BA 1P3AB 2AROA 3VH6T 4LD9A 3AZJD 1F66B 2F8NK 5B33A 1M19B 3AZND 4XZQA 3X1VA 5B0YC 4X23A 5AV5B 5AVBA 5B32A 1F1EA 4YS3D 1WWIA 4ZUXA 3X1TD 3C1BC 2Y2IA 3AZHB 2AROC 5BO0B 3FDDA 3UT9B 3AZLD 4LD9C 4QLCD 2IO5B 5B33C 1H3OB 5F99A 3VH6A 5AV8D 3VH5T 3LZ0D 3KWQA 4J8XB 4J8UD 2JE5A 5CHLB 4XZQC 5G49A 5B31B 5DNMA 3X1VC 4X23C 3AZGA 5AVBC 3LZ1B 4KGCD 5GSUD 5B32C 5BNVB 5AVCA 5DNNB 4ZUXC 3B0DB 2NQBD 4Z2MH 5B40A 3REJA 3AFAD 3AYWD 3X1SD 4H9NA 3R45A 3MGQB 2HIOB 3LJAA 1KX4A 2YFVB 3WA9A 4CAYA 3WAAB 4NE5A 5JRGB 4R8PB 5F99C 3KWQC 3B0CW 3B6GA 4WU9B 5DNMC 3AZGC 3C1CB 1Q9CA 4J8VD 1KX5A 4AWLC 5AVCC 5C3IC 3AV1D 5B40C 1TAFA 5AV9D 3WTPA 3WTPE 3REJC 1P3KD 3UTAD 1HTAA 1P3AD 1P3GA 3LJAC 3REHB 1KX4C 3WA9C 2Y2HA 1F66D 1R4VA 3B6GC 3MGPB 1M19D 1M1AB 3X1TA 4WU8B 4UUZA 1TZYA 3RELB 5CPKB 5GT0D 5AV5D 3AZLA 4QLCA 3MVDA 3WTPC 3AZKA 3B0CT 3B6FB 4J8UA 3H0MC 4E45A 3AZHD 3LELA 1P3GC 2F8NB 3UT9D 1P3BB 5AY8B 4KGCA 3MGSB 2NQBA 3X1TC 2Y2JA 1TZYC 4J8XD 5B31D 3X1SA 4CSRA 3AZLC 3LZ1D 3AZFB 4H9RB 1P34B 5GXQB 5CPJB 4QLCC 1AOIB 4JJNB 5DNND 3MVDC 3AZKC 4ZBJC 4J8UC 1P3OB 5B1LB 3LELC 3UTBA 2J8PA 1EQZB 4KGCC 2DF4C 1P3IB 2HIOD 2G5HC 5B32G 3REIB 2NQBC 3WAAD 4R8PD 5AV9A 1P3KA 4WU9D 3AYWC 3C1CD 4M6BA 3X1SC 1ID3B 5B0ZB 2BYKA 5GT3A 2CV5B 2FJ7A 3A6NB 3UTBC 5CP6A 2ZY5A 1M19A 3W99A 4H9QB 4Z5TA 3W97B 4G91B 3REHD 5GT0A 2JSSA 5B2IB 5AV5A 5E5AB 3AV1C 5AV9C 3MGPD 1P3KC 4NE3A 5B1MB 2F8NH 4Z66B 4WU8D 3AZHA 5CPKD 1P3LA 2FFFB 5GT3C 4XUJB 3UT9A 5B2JB 2HUEC 1F66C 5CP6C 3O62B 1M19C 3W99C 3B6FD 4Z5TC 2F8ND 1KX3B 3REKB 3KSYA 2XD1A 5GT0C 5AV5C 3LZ1A 5AV6B 3NQJB 5AY8D 4DRBA 1P3BD 3KXBA 3MGSD 4G92C 1HQ3B 2XD5A 3AZEB 1P3MB 3AZHC 4NFTA 3MNNB 4KHAA 3EPJA 1P3LC 3UT9C 3AZFD 1P34D 1M18B 3W98B 2CWEA 2HIOA 1AOID 2YFVA 4DQYB 4YM6A 1KU5A 3WAAA 1P3OD 5B1LD 1EQZD 2G5IC 1JFIB 4WU9A 4KUDB 3LZ1C 3KXBC 2F2AC 3REID 1U35A 3B0DC 5B24B 3X1UA 5CPIA 3B0BA 1S32A 3V9RB 1ID3D 5B0ZD 2HIOC 1B67A 3REHA 2CV5D 4YM6C 3WAAC 2Y2MA 3EPHA 1P3FB 4WU9C 2YFWB 5CPKA 1BH9B 5B2ID 3AN2A 5E5AD 1U35C 3C1BB 3X1UC 5CPIC 4KUDD 4WV4B 2AROB 4Z2MG 5B1MD 3MGRD 1S32C 4Z66D 3TU4B 2F8NA 4LD9B 3A1KA 3REHC 4XUJD 3AZJA 5B2JD 5AY8A 3AV2B 3MGSA 4XZQB 3AZNA 4X23B 3X1VB 3O62D 1KX3D 2Y2PA 3REKD 5CPKC 2Y2NA 5BS7A 3AN2C 4HGAC 5AV6D 4YS3A 4H9OA 1AOIA 3EPLA 1HQ3D 3AZED 1PZRA 1EQZA 3AZJC 3P5JB 1M18D 5AY8C 3W98D 5F99B 3MGSC 1T3UA 3AZNC 3REIA 5AV8A 3LZ0A 3AL0C 3WKJB 2ZY2A 4AWLB 4EO5C 5BS7C 5GSUA 5C3IB 1ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS3 C;  5B40 B;  3REJ B;  1AOI C;  5B24 D;  3AFA A;  3R45 B;  3AYW A;  2BYM A;  3LJA B;  1EQZ C;  5KDM B;  2NZD B;  4H9Q A;  3WA9 B;  1N1J B;  5JA4 A;  3B6G B;  5E5A A;  3REI C;  5AV8 C;  3LZ0 C;  1B6W A;  1P3F D;  1KX5 B;  3MGQ D;  3MGR A;  5GSU C;  4J8V A;  1ID3 C;  3AV1 A;  1TAF B;  3WTP B;  4XUJ A;  5JRG D;  1ZLA B;  3C1B D;  3AFA C;  3UTA A;  1P3G B;  4J8W B;  1P3A A;  3TU4 D;  1KX3 A;  1P3P B;  1F66 A;  5E5A C;  4UUZ B;  3AV2 D;  1TZY B;  4XZQ D;  3X1V D;  3MGR C;  4J8V C;  4XUJ C;  3MVD B;  3AZK B;  4ZBJ B;  5B2J C;  3AZI B;  1M1A D;  3UTA C;  3LEL B;  5FUG B;  1P3A C;  3REL D;  5BO0 A;  1KX3 C;  1H3O A;  5B24 A;  1HQ3 C;  4CSR B;  5B31 A;  4J8X A;  3NQU B;  3AZE C;  3WKJ D;  3KUY B;  3V9R A;  5BNV A;  5DNN A;  5B40 D;  3REJ D;  3UTB B;  4NE6 A;  1P3F A;  3MGQ A;  2NZD D;  5GXQ D;  5CPJ D;  5BNX B;  2YFW A;  4JJN D;  3AZM B;  2IO5 C;  3B6G D;  4R8P A;  5JRG A;  4WNN B;  5B24 C;  4DRA A;  5B31 C;  4J8X C;  1BFM A;  2BYK B;  3C1C A;  5GT3 B;  1KX5 D;  1P3I D;  2FJ7 B;  3TU4 A;  2RVQ D;  2PYO B;  2HUE B;  5DNN C;  3W96 B;  3WTP D;  5CP6 B;  3W99 B;  1ZLA D;  1A7W A;  4Z5T B;  3AV2 A;  1P3G D;  5GT0 B;  1P3F C;  3MGQ C;  4J8W D;  4H9P B;  5BT1 D;  1P3P D;  4R8P C;  5JRG C;  4G92 B;  3A6N D;  3MGP A;  5B0Y B;  1M1A A;  1TZY D;  3C1C C;  1P3L B;  4WU8 A;  3W97 D;  4E44 A;  3REL A;  1BH8 B;  3TU4 C;  3MVD D;  3AZK D;  3AZI D;  4H9S A;  3LEL D;  3AV2 C;  3B6F A;  3WKJ A;  5B33 B;  3KXB B;  1P3B A;  1ULY A;  3MGP C;  1M1A C;  4KHA B;  5AVB B;  4WU8 C;  5B32 B;  3REL C;  4ZUX B;  5KDM A;  3KUY D;  4H9R A;  3AZF A;  5GXQ A;  5CPJ A;  1N1J A;  4YM6 B;  1P34 A;  2NZD A;  4JJN A;  4H9S C;  3UTB D;  3B6F C;  1P3M D;  1P3O A;  5B1L A;  3MNN D;  3WKJ C;  3VH5 A;  1P3B C;  1P3I A;  3KWQ B;  1U35 B;  3AZM D;  3X1U B;  5CPI B;  5DNM B;  5G49 B;  3AZG B;  1S32 B;  1ZLA A;  2L5A A;  5AVC B;  5GT3 D;  5B0Z A;  4J8W A;  3AZF C;  5GXQ C;  5CPJ C;  1P34 C;  2FJ7 D;  2NZD C;  4JJN C;  2CV5 A;  2PYO D;  3W96 D;  1P3P A;  5CP6 D;  4H9N B;  3W99 D;  3A6N A;  5B1L C;  1P3O C;  4Z5T D;  1KX4 B;  5B31 G;  4CAY B;  1KX5 C;  3W97 A;  3AN2 B;  4HGA B;  1P3I C;  2RVQ C;  5B2I A;  3AZI A;  1ZLA C;  5B0Y D;  5B1M A;  4Z66 A;  1P3L D;  5B0Z C;  5FUG A;  4J8W C;  3AZJ B;  2CV5 C;  5B2J A;  5BT1 C;  3AZN B;  1P3P C;  3A6N C;  2ARO D;  3O62 A;  4LD9 D;  4EO5 B;  3REK A;  3W97 C;  4G91 C;  3NQU A;  5B33 D;  5B2I C;  4YS3 B;  4H9O B;  3KXB D;  3X1T B;  3KUY A;  5AV6 A;  3NQJ A;  3AZI C;  4X23 D;  5B1M C;  1HQ3 A;  3AZE A;  3AZL B;  4Z66 C;  5AVB D;  1P3M A;  5B32 D;  3MNN A;  4QLC B;  4ZUX D;  1M18 A;  3W98 A;  4J8U B;  5AV8 B;  5BNX A;  4YM6 D;  3LZ0 B;  3AZM A;  3O62 C;  4KGC B;  3REK C;  5GSU B;  4WNN A;  3VH6 W;  1JFI A;  4KUD A;  2NQB B;  3KUY C;  5AV6 C;  5F99 D;  3KWQ D;  1U35 D;  2PYO A;  3X1U D;  3W96 A;  5DNM D;  3AFA B;  3AZG D;  2BYM B;  3AYW B;  3X1S B;  5CPI D;  1P3M C;  1S32 D;  4WZS B;  2F8N G;  3MNN C;  5AVC D;  1WWS A;  5JA4 B;  1M18 C;  3W98 C;  4H9P A;  3AZM C;  3MGR B;  4J8V B;  3LJA D;  2LY8 A;  5B0Y A;  1KX4 D;  3WA9 D;  4KUD C;  3AV1 B;  3AN2 D;  2FJ7 C;  1BH8 A;  1BH9 A;  5AV9 B;  2PYO C;  1P3K B;  3W96 C;  3UTA B;  3VH5 W;  3C1B A;  1P3A B;  2ARO A;  3VH6 T;  4LD9 A;  3AZJ D;  1F66 B;  2F8N K;  5B33 A;  1M19 B;  3AZN D;  4XZQ A;  3X1V A;  5B0Y C;  4X23 A;  5AV5 B;  5AVB A;  5B32 A;  1F1E A;  4YS3 D;  1WWI A;  4ZUX A;  3X1T D;  3C1B C;  3AZH B;  2ARO C;  5BO0 B;  3UT9 B;  3AZL D;  4LD9 C;  4QLC D;  2IO5 B;  5B33 C;  1H3O B;  5F99 A;  3VH6 A;  5AV8 D;  3VH5 T;  3LZ0 D;  3KWQ A;  4J8X B;  4J8U D;  4XZQ C;  5CHL B;  5B31 B;  5G49 A;  5DNM A;  3X1V C;  4X23 C;  3AZG A;  5AVB C;  3LZ1 B;  4KGC D;  5GSU D;  5B32 C;  5BNV B;  5AVC A;  5DNN B;  4ZUX C;  3B0D B;  2NQB D;  4Z2M H;  5B40 A;  3REJ A;  3AFA D;  3AYW D;  3X1S D;  4H9N A;  3R45 A;  3MGQ B;  2HIO B;  3LJA A;  1KX4 A;  2YFV B;  3WA9 A;  4CAY A;  3WAA B;  4NE5 A;  5JRG B;  4R8P B;  5F99 C;  3KWQ C;  3B0C W;  3B6G A;  4WU9 B;  5DNM C;  3AZG C;  3C1C B;  1Q9C A;  4J8V D;  1KX5 A;  4AWL C;  5AVC C;  5C3I C;  3AV1 D;  5B40 C;  1TAF A;  5AV9 D;  3WTP A;  3WTP E;  3REJ C;  1P3K D;  3UTA D;  1HTA A;  1P3A D;  1P3G A;  3LJA C;  3REH B;  1KX4 C;  3WA9 C;  1F66 D;  1R4V A;  3B6G C;  3MGP B;  1M19 D;  1M1A B;  3X1T A;  4WU8 B;  4UUZ A;  1TZY A;  3REL B;  5CPK B;  5GT0 D;  5AV5 D;  3AZL A;  4QLC A;  3MVD A;  3WTP C;  3AZK A;  3B0C T;  3B6F B;  4J8U A;  4E45 A;  2F8N B;  3AZH D;  3LEL A;  1P3G C;  3UT9 D;  1P3B B;  5AY8 B;  4KGC A;  3MGS B;  2NQB A;  3X1T C;  1TZY C;  4J8X D;  5B31 D;  3X1S A;  4CSR A;  3AZL C;  3LZ1 D;  3AZF B;  4H9R B;  1P34 B;  5GXQ B;  5CPJ B;  4QLC C;  1AOI B;  4JJN B;  5DNN D;  3MVD C;  3AZK C;  4ZBJ C;  4J8U C;  1P3O B;  5B1L B;  3LEL C;  3UTB A;  1EQZ B;  4KGC C;  1P3I B;  2HIO D;  5B32 G;  3REI B;  2NQB C;  3WAA D;  4R8P D;  5AV9 A;  1P3K A;  4WU9 D;  3AYW C;  3C1C D;  4M6B A;  3X1S C;  1ID3 B;  5B0Z B;  2BYK A;  5GT3 A;  2CV5 B;  2FJ7 A;  3A6N B;  3UTB C;  5CP6 A;  1M19 A;  3W99 A;  4H9Q B;  4Z5T A;  3W97 B;  4G91 B;  3REH D;  5GT0 A;  2JSS A;  5B2I B;  5AV5 A;  5E5A B;  3AV1 C;  5AV9 C;  3MGP D;  1P3K C;  4NE3 A;  5B1M B;  2F8N H;  4Z66 B;  4WU8 D;  3AZH A;  5CPK D;  1P3L A;  5GT3 C;  4XUJ B;  3UT9 A;  5B2J B;  2HUE C;  1F66 C;  5CP6 C;  3O62 B;  1M19 C;  3W99 C;  3B6F D;  4Z5T C;  2F8N D;  1KX3 B;  3REK B;  3KSY A;  5GT0 C;  5AV5 C;  3LZ1 A;  5AV6 B;  3NQJ B;  5AY8 D;  4DRB A;  1P3B D;  3KXB A;  3MGS D;  4G92 C;  1HQ3 B;  3AZE B;  1P3M B;  3AZH C;  4NFT A;  3MNN B;  4KHA A;  1P3L C;  3UT9 C;  3AZF D;  1P34 D;  1M18 B;  3W98 B;  2CWE A;  2HIO A;  1AOI D;  2YFV A;  4YM6 A;  1KU5 A;  3WAA A;  1P3O D;  5B1L D;  1EQZ D;  1JFI B;  4WU9 A;  4KUD B;  3LZ1 C;  3KXB C;  3REI D;  1U35 A;  3B0D C;  5B24 B;  3X1U A;  5CPI A;  3B0B A;  1S32 A;  3V9R B;  1ID3 D;  5B0Z D;  2HIO C;  1B67 A;  3REH A;  2CV5 D;  4YM6 C;  3WAA C;  1P3F B;  4WU9 C;  2YFW B;  5CPK A;  1BH9 B;  5B2I D;  3AN2 A;  5E5A D;  1U35 C;  3C1B B;  3X1U C;  5CPI C;  4KUD D;  4WV4 B;  2ARO B;  4Z2M G;  5B1M D;  3MGR D;  1S32 C;  4Z66 D;  3TU4 B;  2F8N A;  4LD9 B;  3REH C;  4XUJ D;  3AZJ A;  5B2J D;  5AY8 A;  3AV2 B;  3MGS A;  4XZQ B;  3AZN A;  4X23 B;  3X1V B;  3O62 D;  1KX3 D;  3REK D;  5CPK C;  5BS7 A;  3AN2 C;  4HGA C;  5AV6 D;  4YS3 A;  4H9O A;  1AOI A;  1HQ3 D;  3AZE D;  1EQZ A;  3AZJ C;  1M18 D;  5AY8 C;  3W98 D;  5F99 B;  3MGS C;  3AZN C;  3REI A;  5AV8 A;  3LZ0 A;  3WKJ B;  4AWL B;  4EO5 C;  5BS7 C;  5GSU A;  5C3I B;  1ID3 A; 
#chains in the Genus database with same CATH topology
 2Y2Q A;  4YS3 C;  5B40 B;  3REJ B;  1AOI C;  5B24 D;  3AFA A;  3R45 B;  3AYW A;  2BYM A;  3LJA B;  1EQZ C;  5KDM B;  2NZD B;  4H9Q A;  3WA9 B;  1N1J B;  5JA4 A;  3B6G B;  5E5A A;  3REI C;  5AV8 C;  3LZ0 C;  1B6W A;  1P3F D;  1KX5 B;  3MGQ D;  3MGR A;  5GSU C;  4J8V A;  1ID3 C;  3AV1 A;  1TAF B;  3WTP B;  4XUJ A;  5JRG D;  1ZLA B;  3C1B D;  3AFA C;  3UTA A;  1P3G B;  3IP4 C;  4J8W B;  3A1I A;  1P3A A;  3TU4 D;  1KX3 A;  1P3P B;  1F66 A;  5E5A C;  4UUZ B;  3AV2 D;  1TZY B;  4XZQ D;  3X1V D;  3MGR C;  4J8V C;  4XUJ C;  3MVD B;  3AZK B;  4ZBJ B;  5B2J C;  3AZI B;  1M1A D;  3UTA C;  3LEL B;  3F6T A;  5FUG B;  1P3A C;  3REL D;  2JCH A;  5BO0 A;  1KX3 C;  1H3O A;  3H0R C;  2BG1 A;  5B24 A;  1HQ3 C;  4CSR B;  5B31 A;  4J8X A;  3NQU B;  3AZE C;  3WKJ D;  3KUY B;  3V9R A;  2ZY4 A;  5BNV A;  5DNN A;  5B40 D;  3REJ D;  3UTB B;  4NE6 A;  1P3F A;  2ZY3 A;  3MGQ A;  2NZD D;  5GXQ D;  5CPJ D;  5BNX B;  2YFW A;  2ZM5 A;  4JJN D;  3AZM B;  2IO5 C;  2Y2G A;  3B6G D;  4R8P A;  5JRG A;  4WNN B;  5B24 C;  4DRA A;  5B31 C;  4J8X C;  1BFM A;  2BYK B;  3C1C A;  5GT3 B;  1KX5 D;  1P3I D;  2FJ7 B;  3TU4 A;  2RVQ D;  2PYO B;  2HUE B;  5DNN C;  3W96 B;  4WJ3 C;  3WTP D;  5CP6 B;  3W99 B;  1ZLA D;  1A7W A;  4Z5T B;  3AV2 A;  1P3G D;  5GT0 B;  1P3F C;  3MGQ C;  4J8W D;  4H9P B;  2W8S A;  5BT1 D;  4R8P C;  5JRG C;  1P3P D;  4G92 B;  3A6N D;  3MGP A;  5B0Y B;  1M1A A;  1TZY D;  3C1C C;  1P3L B;  4WU8 A;  3W97 D;  4UPK A;  2DQN C;  4E44 A;  3REL A;  1BH8 B;  3TU4 C;  3MVD D;  3AZK D;  3AZI D;  4H9S A;  3KFU G;  3H0L C;  3LEL D;  3AV2 C;  3B6F A;  2RIQ A;  3WKJ A;  2VQR A;  5B33 B;  3KXB B;  1P3B A;  1ULY A;  3MGP C;  1M1A C;  4KHA B;  5AVB B;  4WU8 C;  5B32 B;  3REL C;  4ZUX B;  5KDM A;  3KUY D;  4H9R A;  3AZF A;  5GXQ A;  5CPJ A;  1N1J A;  4YM6 B;  1P34 A;  2NZD A;  4JJN A;  4H9S C;  2Y2K A;  3UTB D;  3B6F C;  1P3M D;  1P3O A;  5B1L A;  3MNN D;  3WKJ C;  3VH5 A;  1P3B C;  1P3I A;  3KWQ B;  1U35 B;  3AZM D;  3X1U B;  5CPI B;  5DNM B;  5G49 B;  3AZG B;  1S32 B;  1ZLA A;  2L5A A;  5AVC B;  5GT3 D;  5B0Z A;  4J8W A;  3AZF C;  5GXQ C;  5CPJ C;  1P34 C;  2FJ7 D;  2NZD C;  4JJN C;  2CV5 A;  2PYO D;  3W96 D;  1P3P A;  5CP6 D;  4H9N B;  3W99 D;  3A6N A;  5B1L C;  1P3O C;  4Z5T D;  1KX4 B;  5B31 G;  4CAY B;  1KX5 C;  3W97 A;  3AN2 B;  4HGA B;  1P3I C;  2RVQ C;  5B2I A;  3AZI A;  1ZLA C;  5B0Y D;  5B1M A;  4Z66 A;  1P3L D;  5B0Z C;  5FUG A;  4J8W C;  3AZJ B;  2CV5 C;  5B2J A;  5BT1 C;  3AZN B;  1P3P C;  3A6N C;  2Y2O A;  2ARO D;  3O62 A;  1Z2C B;  4LD9 D;  4EO5 B;  3REK A;  3W97 C;  4G91 C;  3NQU A;  5B33 D;  5B2I C;  4YS3 B;  4H9O B;  3KXB D;  2Y2L A;  3X1T B;  3KUY A;  5AV6 A;  3NQJ A;  3EPK A;  3AZI C;  4X23 D;  5B1M C;  1HQ3 A;  3AZE A;  3AZL B;  4Z66 C;  5AVB D;  1P3M A;  1W2E A;  5B32 D;  3MNN A;  4QLC B;  4ZUX D;  1M18 A;  3W98 A;  4J8U B;  5AV8 B;  5BNX A;  4YM6 D;  3LZ0 B;  3AZM A;  3O62 C;  4KGC B;  3REK C;  5GSU B;  4WNN A;  3VH6 W;  1JFI A;  4KUD A;  2NQB B;  3KUY C;  5AV6 C;  5F99 D;  3KWQ D;  1U35 D;  2PYO A;  3X1U D;  3W96 A;  5DNM D;  3AFA B;  3EG5 B;  2BYM B;  3AZG D;  3X1S B;  3AYW B;  5CPI D;  1P3M C;  1S32 D;  4WZS B;  2F8N G;  3MNN C;  5AVC D;  1WWS A;  5JA4 B;  1M18 C;  3W98 C;  4H9P A;  3AZM C;  3MGR B;  4J8V B;  3LJA D;  2LY8 A;  5B0Y A;  1KX4 D;  3WA9 D;  4KUD C;  3AV1 B;  2UWX A;  3AN2 D;  2FJ7 C;  1BH8 A;  1BH9 A;  5AV9 B;  2PYO C;  1P3K B;  3W96 C;  3UTA B;  3VH5 W;  3C1B A;  1P3A B;  2ARO A;  3VH6 T;  4LD9 A;  3AZJ D;  1F66 B;  2F8N K;  5B33 A;  1M19 B;  3AZN D;  4XZQ A;  3X1V A;  5B0Y C;  4X23 A;  5AV5 B;  5AVB A;  5B32 A;  1F1E A;  4YS3 D;  1WWI A;  4ZUX A;  3X1T D;  3C1B C;  2Y2I A;  3AZH B;  2ARO C;  5BO0 B;  3FDD A;  3UT9 B;  3AZL D;  4LD9 C;  4QLC D;  2IO5 B;  5B33 C;  1H3O B;  5F99 A;  3VH6 A;  5AV8 D;  3VH5 T;  3LZ0 D;  3KWQ A;  4J8X B;  4J8U D;  2JE5 A;  5CHL B;  4XZQ C;  5G49 A;  5B31 B;  5DNM A;  3X1V C;  4X23 C;  3AZG A;  5AVB C;  3LZ1 B;  4KGC D;  5GSU D;  5B32 C;  5BNV B;  5AVC A;  5DNN B;  4ZUX C;  3B0D B;  2NQB D;  4Z2M H;  5B40 A;  3REJ A;  3AFA D;  3AYW D;  3X1S D;  4H9N A;  3R45 A;  3MGQ B;  2HIO B;  3LJA A;  1KX4 A;  2YFV B;  3WA9 A;  4CAY A;  3WAA B;  4NE5 A;  5JRG B;  4R8P B;  5F99 C;  3KWQ C;  3B0C W;  3B6G A;  4WU9 B;  5DNM C;  3AZG C;  3C1C B;  1Q9C A;  4J8V D;  1KX5 A;  4AWL C;  5AVC C;  5C3I C;  3AV1 D;  5B40 C;  1TAF A;  5AV9 D;  3WTP A;  3WTP E;  3REJ C;  1P3K D;  3UTA D;  1HTA A;  1P3A D;  1P3G A;  3LJA C;  3REH B;  1KX4 C;  3WA9 C;  2Y2H A;  1F66 D;  1R4V A;  3B6G C;  3MGP B;  1M19 D;  1M1A B;  3X1T A;  4WU8 B;  4UUZ A;  1TZY A;  3REL B;  5CPK B;  5GT0 D;  5AV5 D;  3AZL A;  4QLC A;  3MVD A;  3WTP C;  3AZK A;  3B0C T;  3B6F B;  4J8U A;  3H0M C;  4E45 A;  3AZH D;  3LEL A;  1P3G C;  2F8N B;  3UT9 D;  1P3B B;  5AY8 B;  4KGC A;  3MGS B;  2NQB A;  3X1T C;  2Y2J A;  1TZY C;  4J8X D;  5B31 D;  3X1S A;  4CSR A;  3AZL C;  3LZ1 D;  3AZF B;  4H9R B;  1P34 B;  5GXQ B;  5CPJ B;  4QLC C;  1AOI B;  4JJN B;  5DNN D;  3MVD C;  3AZK C;  4ZBJ C;  4J8U C;  1P3O B;  5B1L B;  3LEL C;  3UTB A;  2J8P A;  1EQZ B;  4KGC C;  2DF4 C;  1P3I B;  2HIO D;  2G5H C;  5B32 G;  3REI B;  2NQB C;  3WAA D;  4R8P D;  5AV9 A;  1P3K A;  4WU9 D;  3AYW C;  3C1C D;  4M6B A;  3X1S C;  1ID3 B;  5B0Z B;  2BYK A;  5GT3 A;  2CV5 B;  2FJ7 A;  3A6N B;  3UTB C;  5CP6 A;  2ZY5 A;  1M19 A;  3W99 A;  4H9Q B;  4Z5T A;  3W97 B;  4G91 B;  3REH D;  5GT0 A;  2JSS A;  5B2I B;  5AV5 A;  5E5A B;  3AV1 C;  5AV9 C;  3MGP D;  1P3K C;  4NE3 A;  5B1M B;  2F8N H;  4Z66 B;  4WU8 D;  3AZH A;  5CPK D;  1P3L A;  2FFF B;  5GT3 C;  4XUJ B;  3UT9 A;  5B2J B;  2HUE C;  1F66 C;  5CP6 C;  3O62 B;  1M19 C;  3W99 C;  3B6F D;  4Z5T C;  2F8N D;  1KX3 B;  3REK B;  3KSY A;  2XD1 A;  5GT0 C;  5AV5 C;  3LZ1 A;  5AV6 B;  3NQJ B;  5AY8 D;  4DRB A;  1P3B D;  3KXB A;  3MGS D;  4G92 C;  1HQ3 B;  2XD5 A;  3AZE B;  1P3M B;  3AZH C;  4NFT A;  3MNN B;  4KHA A;  3EPJ A;  1P3L C;  3UT9 C;  3AZF D;  1P34 D;  1M18 B;  3W98 B;  2CWE A;  2HIO A;  1AOI D;  2YFV A;  4DQY B;  4YM6 A;  1KU5 A;  3WAA A;  1P3O D;  5B1L D;  1EQZ D;  2G5I C;  1JFI B;  4WU9 A;  4KUD B;  3LZ1 C;  3KXB C;  2F2A C;  3REI D;  1U35 A;  3B0D C;  5B24 B;  3X1U A;  5CPI A;  3B0B A;  1S32 A;  3V9R B;  1ID3 D;  5B0Z D;  2HIO C;  1B67 A;  3REH A;  2CV5 D;  4YM6 C;  3WAA C;  2Y2M A;  3EPH A;  1P3F B;  4WU9 C;  2YFW B;  5CPK A;  1BH9 B;  5B2I D;  3AN2 A;  5E5A D;  1U35 C;  3C1B B;  3X1U C;  5CPI C;  4KUD D;  4WV4 B;  2ARO B;  4Z2M G;  5B1M D;  3MGR D;  1S32 C;  4Z66 D;  3TU4 B;  2F8N A;  4LD9 B;  3A1K A;  3REH C;  4XUJ D;  3AZJ A;  5B2J D;  5AY8 A;  3AV2 B;  3MGS A;  4XZQ B;  3AZN A;  4X23 B;  3X1V B;  3O62 D;  1KX3 D;  2Y2P A;  3REK D;  5CPK C;  2Y2N A;  5BS7 A;  3AN2 C;  4HGA C;  5AV6 D;  4YS3 A;  4H9O A;  1AOI A;  3EPL A;  1HQ3 D;  3AZE D;  1PZR A;  1EQZ A;  3AZJ C;  3P5J B;  1M18 D;  5AY8 C;  3W98 D;  5F99 B;  3MGS C;  1T3U A;  3AZN C;  3REI A;  5AV8 A;  3LZ0 A;  3AL0 C;  3WKJ B;  2ZY2 A;  4AWL B;  4EO5 C;  5BS7 C;  5GSU A;  5C3I B;  1ID3 A; 
#chains in the Genus database with same CATH homology
 2Y2Q A;  4YS3 C;  5B40 B;  3REJ B;  1AOI C;  5B24 D;  3AFA A;  3R45 B;  3AYW A;  2BYM A;  3LJA B;  1EQZ C;  5KDM B;  2NZD B;  4H9Q A;  3WA9 B;  1N1J B;  5JA4 A;  3B6G B;  5E5A A;  3REI C;  5AV8 C;  3LZ0 C;  1B6W A;  1P3F D;  1KX5 B;  3MGQ D;  3MGR A;  5GSU C;  4J8V A;  1ID3 C;  3AV1 A;  1TAF B;  3WTP B;  4XUJ A;  5JRG D;  1ZLA B;  3C1B D;  3AFA C;  3UTA A;  1P3G B;  3IP4 C;  4J8W B;  3A1I A;  1P3A A;  3TU4 D;  1KX3 A;  1P3P B;  1F66 A;  5E5A C;  4UUZ B;  3AV2 D;  1TZY B;  4XZQ D;  3X1V D;  3MGR C;  4J8V C;  4XUJ C;  3MVD B;  3AZK B;  4ZBJ B;  5B2J C;  3AZI B;  1M1A D;  3UTA C;  3LEL B;  3F6T A;  5FUG B;  1P3A C;  3REL D;  2JCH A;  5BO0 A;  1KX3 C;  1H3O A;  3H0R C;  2BG1 A;  5B24 A;  1HQ3 C;  4CSR B;  5B31 A;  4J8X A;  3NQU B;  3AZE C;  3WKJ D;  3KUY B;  3V9R A;  2ZY4 A;  5BNV A;  5DNN A;  5B40 D;  3REJ D;  3UTB B;  4NE6 A;  1P3F A;  2ZY3 A;  3MGQ A;  2NZD D;  5GXQ D;  5CPJ D;  5BNX B;  2YFW A;  2ZM5 A;  4JJN D;  3AZM B;  2IO5 C;  2Y2G A;  3B6G D;  4R8P A;  5JRG A;  4WNN B;  5B24 C;  4DRA A;  5B31 C;  4J8X C;  1BFM A;  2BYK B;  3C1C A;  5GT3 B;  1KX5 D;  1P3I D;  2FJ7 B;  3TU4 A;  2RVQ D;  2PYO B;  2HUE B;  5DNN C;  3W96 B;  4WJ3 C;  3WTP D;  5CP6 B;  3W99 B;  1ZLA D;  1A7W A;  4Z5T B;  3AV2 A;  1P3G D;  5GT0 B;  1P3F C;  3MGQ C;  4J8W D;  4H9P B;  2W8S A;  5BT1 D;  4R8P C;  5JRG C;  1P3P D;  4G92 B;  3A6N D;  3MGP A;  5B0Y B;  1M1A A;  1TZY D;  3C1C C;  1P3L B;  4WU8 A;  3W97 D;  4UPK A;  2DQN C;  4E44 A;  3REL A;  1BH8 B;  3TU4 C;  3MVD D;  3AZK D;  3AZI D;  4H9S A;  3KFU G;  3H0L C;  3LEL D;  3AV2 C;  3B6F A;  2RIQ A;  3WKJ A;  2VQR A;  5B33 B;  3KXB B;  1P3B A;  1ULY A;  3MGP C;  1M1A C;  4KHA B;  5AVB B;  4WU8 C;  5B32 B;  3REL C;  4ZUX B;  5KDM A;  3KUY D;  4H9R A;  3AZF A;  5GXQ A;  5CPJ A;  1N1J A;  4YM6 B;  1P34 A;  2NZD A;  4JJN A;  4H9S C;  2Y2K A;  3UTB D;  3B6F C;  1P3M D;  1P3O A;  5B1L A;  3MNN D;  3WKJ C;  3VH5 A;  1P3B C;  1P3I A;  3KWQ B;  1U35 B;  3AZM D;  3X1U B;  5CPI B;  5DNM B;  5G49 B;  3AZG B;  1S32 B;  1ZLA A;  2L5A A;  5AVC B;  5GT3 D;  5B0Z A;  4J8W A;  3AZF C;  5GXQ C;  5CPJ C;  1P34 C;  2FJ7 D;  2NZD C;  4JJN C;  2CV5 A;  2PYO D;  3W96 D;  1P3P A;  5CP6 D;  4H9N B;  3W99 D;  3A6N A;  5B1L C;  1P3O C;  4Z5T D;  1KX4 B;  5B31 G;  4CAY B;  1KX5 C;  3W97 A;  3AN2 B;  4HGA B;  1P3I C;  2RVQ C;  5B2I A;  3AZI A;  1ZLA C;  5B0Y D;  5B1M A;  4Z66 A;  1P3L D;  5B0Z C;  5FUG A;  4J8W C;  3AZJ B;  2CV5 C;  5B2J A;  5BT1 C;  3AZN B;  1P3P C;  3A6N C;  2Y2O A;  2ARO D;  3O62 A;  1Z2C B;  4LD9 D;  4EO5 B;  3REK A;  3W97 C;  4G91 C;  3NQU A;  5B33 D;  5B2I C;  4YS3 B;  4H9O B;  3KXB D;  2Y2L A;  3X1T B;  3KUY A;  5AV6 A;  3NQJ A;  3EPK A;  3AZI C;  4X23 D;  5B1M C;  1HQ3 A;  3AZE A;  3AZL B;  4Z66 C;  5AVB D;  1P3M A;  1W2E A;  5B32 D;  3MNN A;  4QLC B;  4ZUX D;  1M18 A;  3W98 A;  4J8U B;  5AV8 B;  5BNX A;  4YM6 D;  3LZ0 B;  3AZM A;  3O62 C;  4KGC B;  3REK C;  5GSU B;  4WNN A;  3VH6 W;  1JFI A;  4KUD A;  2NQB B;  3KUY C;  5AV6 C;  5F99 D;  3KWQ D;  1U35 D;  2PYO A;  3X1U D;  3W96 A;  5DNM D;  3AFA B;  3EG5 B;  2BYM B;  3AZG D;  3X1S B;  3AYW B;  5CPI D;  1P3M C;  1S32 D;  4WZS B;  2F8N G;  3MNN C;  5AVC D;  1WWS A;  5JA4 B;  1M18 C;  3W98 C;  4H9P A;  3AZM C;  3MGR B;  4J8V B;  3LJA D;  2LY8 A;  5B0Y A;  1KX4 D;  3WA9 D;  4KUD C;  3AV1 B;  2UWX A;  3AN2 D;  2FJ7 C;  1BH8 A;  1BH9 A;  5AV9 B;  2PYO C;  1P3K B;  3W96 C;  3UTA B;  3VH5 W;  3C1B A;  1P3A B;  2ARO A;  3VH6 T;  4LD9 A;  3AZJ D;  1F66 B;  2F8N K;  5B33 A;  1M19 B;  3AZN D;  4XZQ A;  3X1V A;  5B0Y C;  4X23 A;  5AV5 B;  5AVB A;  5B32 A;  1F1E A;  4YS3 D;  1WWI A;  4ZUX A;  3X1T D;  3C1B C;  2Y2I A;  3AZH B;  2ARO C;  5BO0 B;  3FDD A;  3UT9 B;  3AZL D;  4LD9 C;  4QLC D;  2IO5 B;  5B33 C;  1H3O B;  5F99 A;  3VH6 A;  5AV8 D;  3VH5 T;  3LZ0 D;  3KWQ A;  4J8X B;  4J8U D;  2JE5 A;  5CHL B;  4XZQ C;  5G49 A;  5B31 B;  5DNM A;  3X1V C;  4X23 C;  3AZG A;  5AVB C;  3LZ1 B;  4KGC D;  5GSU D;  5B32 C;  5BNV B;  5AVC A;  5DNN B;  4ZUX C;  3B0D B;  2NQB D;  4Z2M H;  5B40 A;  3REJ A;  3AFA D;  3AYW D;  3X1S D;  4H9N A;  3R45 A;  3MGQ B;  2HIO B;  3LJA A;  1KX4 A;  2YFV B;  3WA9 A;  4CAY A;  3WAA B;  4NE5 A;  5JRG B;  4R8P B;  5F99 C;  3KWQ C;  3B0C W;  3B6G A;  4WU9 B;  5DNM C;  3AZG C;  3C1C B;  1Q9C A;  4J8V D;  1KX5 A;  4AWL C;  5AVC C;  5C3I C;  3AV1 D;  5B40 C;  1TAF A;  5AV9 D;  3WTP A;  3WTP E;  3REJ C;  1P3K D;  3UTA D;  1HTA A;  1P3A D;  1P3G A;  3LJA C;  3REH B;  1KX4 C;  3WA9 C;  2Y2H A;  1F66 D;  1R4V A;  3B6G C;  3MGP B;  1M19 D;  1M1A B;  3X1T A;  4WU8 B;  4UUZ A;  1TZY A;  3REL B;  5CPK B;  5GT0 D;  5AV5 D;  3AZL A;  4QLC A;  3MVD A;  3WTP C;  3AZK A;  3B0C T;  3B6F B;  4J8U A;  3H0M C;  4E45 A;  3AZH D;  3LEL A;  1P3G C;  2F8N B;  3UT9 D;  1P3B B;  5AY8 B;  4KGC A;  3MGS B;  2NQB A;  3X1T C;  2Y2J A;  1TZY C;  4J8X D;  5B31 D;  3X1S A;  4CSR A;  3AZL C;  3LZ1 D;  3AZF B;  4H9R B;  1P34 B;  5GXQ B;  5CPJ B;  4QLC C;  1AOI B;  4JJN B;  5DNN D;  3MVD C;  3AZK C;  4ZBJ C;  4J8U C;  1P3O B;  5B1L B;  3LEL C;  3UTB A;  2J8P A;  1EQZ B;  4KGC C;  2DF4 C;  1P3I B;  2HIO D;  2G5H C;  5B32 G;  3REI B;  2NQB C;  3WAA D;  4R8P D;  5AV9 A;  1P3K A;  4WU9 D;  3AYW C;  3C1C D;  4M6B A;  3X1S C;  1ID3 B;  5B0Z B;  2BYK A;  5GT3 A;  2CV5 B;  2FJ7 A;  3A6N B;  3UTB C;  5CP6 A;  2ZY5 A;  1M19 A;  3W99 A;  4H9Q B;  4Z5T A;  3W97 B;  4G91 B;  3REH D;  5GT0 A;  2JSS A;  5B2I B;  5AV5 A;  5E5A B;  3AV1 C;  5AV9 C;  3MGP D;  1P3K C;  4NE3 A;  5B1M B;  2F8N H;  4Z66 B;  4WU8 D;  3AZH A;  5CPK D;  1P3L A;  2FFF B;  5GT3 C;  4XUJ B;  3UT9 A;  5B2J B;  2HUE C;  1F66 C;  5CP6 C;  3O62 B;  1M19 C;  3W99 C;  3B6F D;  4Z5T C;  2F8N D;  1KX3 B;  3REK B;  3KSY A;  2XD1 A;  5GT0 C;  5AV5 C;  3LZ1 A;  5AV6 B;  3NQJ B;  5AY8 D;  4DRB A;  1P3B D;  3KXB A;  3MGS D;  4G92 C;  1HQ3 B;  2XD5 A;  3AZE B;  1P3M B;  3AZH C;  4NFT A;  3MNN B;  4KHA A;  3EPJ A;  1P3L C;  3UT9 C;  3AZF D;  1P34 D;  1M18 B;  3W98 B;  2CWE A;  2HIO A;  1AOI D;  2YFV A;  4DQY B;  4YM6 A;  1KU5 A;  3WAA A;  1P3O D;  5B1L D;  1EQZ D;  2G5I C;  1JFI B;  4WU9 A;  4KUD B;  3LZ1 C;  3KXB C;  2F2A C;  3REI D;  1U35 A;  3B0D C;  5B24 B;  3X1U A;  5CPI A;  3B0B A;  1S32 A;  3V9R B;  1ID3 D;  5B0Z D;  2HIO C;  1B67 A;  3REH A;  2CV5 D;  4YM6 C;  3WAA C;  2Y2M A;  3EPH A;  1P3F B;  4WU9 C;  2YFW B;  5CPK A;  1BH9 B;  5B2I D;  3AN2 A;  5E5A D;  1U35 C;  3C1B B;  3X1U C;  5CPI C;  4KUD D;  4WV4 B;  2ARO B;  4Z2M G;  5B1M D;  3MGR D;  1S32 C;  4Z66 D;  3TU4 B;  2F8N A;  4LD9 B;  3A1K A;  3REH C;  4XUJ D;  3AZJ A;  5B2J D;  5AY8 A;  3AV2 B;  3MGS A;  4XZQ B;  3AZN A;  4X23 B;  3X1V B;  3O62 D;  1KX3 D;  2Y2P A;  3REK D;  5CPK C;  2Y2N A;  5BS7 A;  3AN2 C;  4HGA C;  5AV6 D;  4YS3 A;  4H9O A;  1AOI A;  3EPL A;  1HQ3 D;  3AZE D;  1PZR A;  1EQZ A;  3AZJ C;  3P5J B;  1M18 D;  5AY8 C;  3W98 D;  5F99 B;  3MGS C;  1T3U A;  3AZN C;  3REI A;  5AV8 A;  3LZ0 A;  3AL0 C;  3WKJ B;  2ZY2 A;  4AWL B;  4EO5 C;  5BS7 C;  5GSU A;  5C3I B;  1ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...