2NQBC

Drosophila nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbC00
3REIC 3KUYB 5B0YA 4X23D 4Z66B 3KUYC 3MNNB 1P3AB 4WU9A 3KWQD 3X1TC 3AZEB 2PYOB 1P3PC 2BYMA 2IO5B 5B32C 1P3AC 3WA9A 2NZDB 4G91C 3AZEC 2PYOC 5JRGA 5B1LA 4WU8A 5GT0A 4J8WC 3WTPE 1S32A 2NZDC 4H9OB 4H9SC 5AVCB 3W96A 3TU4A 3X1VD 5AV6D 3KUYA 4CAYB 4NE3A 4J8XB 3AZGD 4Z66A 5B0ZB 3W97B 3MNNA 4E44A 1P3AA 4J8XC 3AZEA 2PYOA 1JFIB 5B0ZC 3W97C 3LJAD 1P3FD 2NZDA 3VH6A 3REKC 3REHD 5FUGB 3W98D 4H9OA 1TZYD 2CWEA 1M1AD 3X1SB 2YFWB 5AVCA 3NQJA 2F8NK 5CPIA 3X1SC 4CAYA 3MVDB 5B0YD 4EO5C 4J8XA 1KX3B 5AY8B 5CP6B 5B1MD 5B0ZA 3W97A 3AZFC 3REJB 1KX3C 5BT1D 5CP6C 5B40D 1JFIA 3UTAC 1P3LB 3AFAD 4J8VD 3VH5T 4E45A 3WA9D 1M18B 1EQZD 5JRGD 4G92C 5FUGA 5DNNB 5B31B 5AV9B 1M18C 3X1SA 2YFWA 5B33B 1KX5D 4R8PB 1WWIA 1R4VA 3UT9B 5AV9C 4YS3B 4J8UC 5CPJB 5B33C 1M19C 3LELB 3MVDA 5DNMB 4R8PC 4YS3C 5AY8A 5CP6A 3UT9C 5CPKC 4Z66D 1KX3A 5DNMC 3MNND 3LELC 4Z2MG 3REJA 5B2IC 1ID3B 3KXBB 4WNNB 3AZLC 1P3LA 3W99C 4NE5A 1ID3C 1ULYA 1M18A 4QLCB 1F66B 4NFTA 1F66C 5DNNA 4QLCC 5B31A 5AV9A 5B33A 3AZMB 4R8PA 3UT9A 5CPID 1P34B 5KDMB 5CPJA 2NQBB 3AZNB 1P3BB 1P34C 3AZIB 2NQBC 1P3GB 3MGSB 3AZNC 1ID3A 4XZQD 3KXBA 3LZ0B 5C3IB 1P3GC 5JA4B 5GSUB 1F66A 4QLCA 3MGPC 3C1BB 3AZMA 3C1BC 5E5AB 3AV2D 4X23C 1P34A 5KDMA 2NQBA 3MVDD 1WWSA 3AZNA 1P3BA 2HIOB 3KWQC 3AZIA 1P3GA 5B2JB 3MGSA 3REJD 2HIOC 3LZ0A 3AYWD 1P3LD 5F99A 5JA4A 5GSUA 5AV5B 3MGRB 3AZHD 1P3KB 2FJ7B 4KUDD 2F8NB 1KX4D 1P3IB 3V9RB 3MGRC 1P3KC 5DNND 1P3IC 5E5AA 5CPJD 1U35B 4XUJB 4KGCD 5AV8D 3LJAC 5B2JA 5AVBB 4H9RB 4ZBJB 4XUJC 3REIB 1ZLAC 3WKJD 3KXBD 3REHC 5AV5A 4ZBJC 3MGRA 1P3KA 1M1AC 2FJ7A 2F8NA 1P3IA 3V9RA 3X1TB 1P3PB 5B32B 3AZMD 3B6GB 3AN2A 3C1CD 3B0CT 4G91B 4YM6B 4J8WB 3B6GC 3AV1A 3AZJB 3WTPB 1U35A 4XUJA 5BS7C 5BT1C 4YM6C 3AZID 3AZKD 5B31G 3WTPC 3AFAC 4J8VC 5AVBA 4H9RA 3REIA 3AZJC 3LZ0D 1EQZC 2YFVB 5F99D 3KSYA 3R45B 4CSRB 1P3MB 3X1UB 3X1TA 1P3PA 5B32A 1P3MC 3X1UC 4YM6A 3REKB 4J8WA 4WZSB 3AZJA 3WTPA 4H9SA 5B2JD 5GXQD 4EO5B 2YFVA 5B24D 3UTBD 5AV5D 3AZFB 3R45A 4CSRA 1P3MA 3B0CW 3X1UA 3UTAB 1F1EA 5B24A 3AN2D 4WU9D 3REKA 4G92B 3AV1D 5BNVB 4XZQC 1Q9CA 5B1LD 5GT0D 1H3OB 4WU8D 1S32D 1M19B 2AROC 5AVBD 2LY8A 4J8UB 3TU4D 3W96D 3RELB 5CPKB 3KUYD 2HUEC 3AZFA 4LD9B 5B2IB 3RELC 3X1TD 3AZLB 1HQ3B 3UTAA 1P3PD 3WAAB 4AWLB 1P3AD 4LD9C 3W99B 3AZED 2PYOD 1HQ3C 3WAAC 4AWLC 2NZDD 1AOIB 2F8NG 5BNVA 1H3OA 1M19A 1AOIC 3AZHC 4J8UA 4JJNB 5AVCD 3MGQB 3RELA 4YS3A 1TAFB 5CPKA 4JJNC 5DNMA 4WV4B 3LELA 4LD9A 1P3OB 3O62B 5B2IA 3MGQC 2JSSA 4Z5TB 4J8XD 3AZLA 1HQ3A 5B0ZD 3W97D 3VH5W 5GT3C 1P3OC 3O62C 3B6FB 3W99A 4Z5TC 4WNNA 3LZ1C 3REKD 4ZUXC 3MGPB 3B6FC 3A6NB 2CV5C 1AOIA 3WKJC 5BO0B 1B6WA 5B32G 3VH6T 3A6NC 4X23B 3X1SD 4JJNA 1BFMA 4KHAB 3KWQB 1TAFA 4H9PB 1P3OA 3O62A 1KX3D 4Z5TA 5AY8D 5CP6D 5G49B 3MGPA 3AZKC 3A6NA 3X1VB 5AV6B 1M18D 5BO0A 3C1BA 3X1VC 4Z2MH 5AV6C 4X23A 5B31D 5AV9D 3AZGB 1M19D 5B33D 4KHAA 4R8PD 4YS3D 3KWQA 4UUZB 3UT9D 3AZGC 3NQUB 5DNMD 3LELD 3LJAB 1N1JB 1P3FB 1ZLAB 4H9NB 2HIOA 5B2ID 3REHB 1P3FC 3W98B 1ID3D 1BH8B 1M1AB 5G49A 3VH6W 3W98C 1TZYC 5AV6A 1F66D 4QLCD 1B67A 2RVQD 5B24C 3UTBC 5B1MB 3AZGA 5B0YC 4DRBA 4UUZA 5B1MC 3VH5A 1P34D 5B40B 2NQBD 3NQUA 3AFAB 3LJAA 1N1JA 4J8VB 1P3FA 3AZND 4H9NA 1P3BD 1ZLAA 3WA9B 5B40C 1EQZB 5JRGB 3REHA 3MGSD 1P3GD 3W98A 3WA9C 1BH8A 1M1AA 1KX5B 2L5AA 5JRGC 5B1LC 5GT0C 5GSUD 1KX5C 3TU4C 3W96C 3C1BD 5B1MA 3B6GA 5E5AD 5BS7A 4Z66C 5B40A 3MNNC 3AFAA 4J8VA 2HIOD 1A7WA 1EQZA 2IO5C 1KX5A 3NQJB 3MGRD 1P3KD 5CPIB 2FJ7D 2F8ND 1P3ID 5AVCC 3B0DB 5CPIC 5BNXB 3B0DC 4XZQB 2BYKB 1U35D 2AROB 4XUJD 1ZLAD 3REID 2HUEB 3AV2B 1HTAA 4HGAB 3AV2C 5B32D 3B6GD 5BNXA 3MVDC 4HGAC 4XZQA 2BYKA 5AY8C 4YM6D 4J8WD 3B0BA 3AYWB 3AZJD 3WTPD 2AROA 3REJC 4M6BA 3AZHB 4KUDB 3AYWC 1KX4B 1P3LC 4KUDC 1KX4C 4NE6A 3AV2A 5DNNC 5GT3B 5B31C 1P3MD 3X1UD 4KGCB 3LZ1B 5AV8B 3WAAA 4ZUXB 5CPJC 2CV5B 3WKJB 4KGCC 5AV8C 3AYWA 3AZHA 3KXBC 4KUDA 1KX4A 3MGQA 3C1CB 4DRAA 2RVQC 3AZFD 5GT3A 3AZMC 3C1CC 4KGCA 3LZ1A 5AV8A 5CHLB 3UTAD 4ZUXA 3AZKB 3B6FA 2CV5A 3WKJA 1P3BC 3AZIC 3MGSC 5F99B 2AROD 3LZ0C 5C3IC 5GSUC 5F99C 4J8UD 3RELD 3C1CA 4H9PA 5CPKD 2F8NH 4LD9D 3AZLD 5E5AC 1HQ3D 1KU5A 3WAAD 3AZKA 3W99D 1TZYB 4H9QB 5GXQB 3X1VA 1BH9B 5B2JC 5B24B 3UTBB 1AOID 5B0YB 5GXQC 5AV5C 4JJND 2FJ7C 3AN2B 3MGQD 4WU9B 2BYMB 5GT3D 1P3OD 3O62D 3AN2C 3AV1B 4WU9C 4Z5TD 3LZ1D 5B1LB 4WU8B 5GT0B 4ZUXD 1S32B 3AV1C 3B6FD 2CV5D 1TZYA 4H9QA 1U35C 5GXQA 3TU4B 4WU8C 3W96B 3MGPD 1S32C 3A6ND 1BH9A 3UTBA 5AVBC
chains in the Genus database with same CATH superfamily
3REIC 3KUYB 5B0YA 4X23D 4Z66B 3KUYC 3MNNB 1P3AB 2ZY2A 3KWQD 3X1TC 4WU9A 3AZEB 2PYOB 1P3PC 2BYMA 2IO5B 5B32C 1P3AC 3WA9A 2NZDB 4G91C 3AZEC 2PYOC 2Y2NA 5B1LA 4WU8A 5GT0A 5JRGA 3WTPE 4J8WC 1S32A 2NZDC 4H9OB 4H9SC 5AVCB 3W96A 3TU4A 3X1VD 5AV6D 3KUYA 4CAYB 4NE3A 4J8XB 3KFUG 3AZGD 4Z66A 5B0ZB 3EPKA 3MNNA 4E44A 1P3AA 3W97B 4J8XC 3AZEA 2PYOA 1JFIB 5B0ZC 3W97C 3LJAD 1P3FD 2NZDA 3VH6A 3REKC 3REHD 5FUGB 3W98D 4H9OA 1TZYD 2CWEA 1M1AD 3X1SB 2YFWB 5AVCA 3NQJA 2F8NK 2G5IC 5CPIA 3F6TA 3X1SC 4CAYA 3MVDB 5B0YD 4EO5C 4J8XA 1KX3B 5AY8B 5CP6B 5B1MD 5B0ZA 3W97A 3AZFC 2DF4C 3REJB 3A1KA 1KX3C 5BT1D 5CP6C 3A1IA 5B40D 1JFIA 3UTAC 1P3LB 3AFAD 4J8VD 3VH5T 4E45A 3WA9D 1M18B 1EQZD 5JRGD 4G92C 5FUGA 5DNNB 2ZY5A 5B31B 5AV9B 3X1SA 2YFWA 5B33B 1KX5D 1M18C 4R8PB 1WWIA 1R4VA 3UT9B 5AV9C 4YS3B 4J8UC 5CPJB 5B33C 1M19C 3LELB 2XD5A 3MVDA 5DNMB 4R8PC 4YS3C 5AY8A 5CP6A 3UT9C 5CPKC 4Z66D 1KX3A 5DNMC 3MNND 3LELC 4Z2MG 3REJA 5B2IC 1ID3B 3KXBB 4WNNB 3AZLC 2Y2OA 1P3LA 3W99C 4NE5A 1ID3C 1ULYA 1M18A 4QLCB 1F66B 4NFTA 1F66C 5DNNA 4QLCC 5B31A 5AV9A 5B33A 3AZMB 4R8PA 3UT9A 5CPID 1P34B 5KDMB 5CPJA 2NQBB 2Y2HA 3EG5B 3AZNB 1P3BB 1P34C 3AZIB 2NQBC 1P3GB 3MGSB 3AZNC 1ID3A 4XZQD 3KXBA 3LZ0B 5C3IB 1P3GC 5JA4B 5GSUB 1F66A 4QLCA 3MGPC 3C1BB 3AZMA 3C1BC 5E5AB 3AV2D 4X23C 1P34A 5KDMA 2NQBA 3EPLA 3MVDD 1WWSA 3AZNA 1P3BA 2HIOB 3KWQC 3AZIA 1P3GA 5B2JB 3MGSA 3REJD 2HIOC 3LZ0A 3AYWD 1P3LD 5F99A 5JA4A 5GSUA 5AV5B 3MGRB 3AZHD 1P3KB 2FJ7B 4KUDD 2F8NB 1KX4D 1P3IB 3V9RB 3MGRC 1P3KC 5DNND 1P3IC 5E5AA 2XD1A 5CPJD 1U35B 4XUJB 4KGCD 5AV8D 2Y2PA 3LJAC 5B2JA 5AVBB 4H9RB 4ZBJB 4XUJC 3REIB 1ZLAC 3WKJD 3KXBD 3REHC 5AV5A 4ZBJC 3MGRA 1P3KA 1M1AC 2FJ7A 2F8NA 1P3IA 3V9RA 3X1TB 1P3PB 5B32B 3AZMD 3B6GB 3AN2A 3C1CD 3B0CT 4G91B 4YM6B 3FDDA 4J8WB 3B6GC 3AV1A 2Y2MA 3AZJB 3WTPB 1U35A 4XUJA 5BS7C 5BT1C 4YM6C 3AZID 3AZKD 5B31G 3WTPC 3AFAC 4J8VC 5AVBA 4H9RA 3REIA 3AZJC 3LZ0D 1EQZC 2YFVB 5F99D 3KSYA 3R45B 4CSRB 1P3MB 3X1UB 3X1TA 1P3PA 5B32A 1P3MC 3X1UC 4YM6A 3REKB 4J8WA 4WZSB 3AZJA 3WTPA 4H9SA 5B2JD 5GXQD 4EO5B 2YFVA 5B24D 3UTBD 5AV5D 3AZFB 3R45A 4CSRA 3EPHA 1P3MA 3B0CW 3X1UA 3UTAB 1F1EA 5B24A 3AN2D 4WU9D 3REKA 4G92B 3AV1D 5BNVB 1T3UA 4XZQC 1Q9CA 5B1LD 5GT0D 1H3OB 4WU8D 1S32D 1M19B 2AROC 2W8SA 2LY8A 5AVBD 3P5JB 4J8UB 3TU4D 3W96D 3RELB 5CPKB 3KUYD 2HUEC 3AZFA 2J8PA 4LD9B 5B2IB 3RELC 2G5HC 2ZY4A 3X1TD 3AZLB 1HQ3B 3UTAA 1P3PD 3WAAB 4AWLB 1P3AD 4LD9C 3W99B 3AZED 2PYOD 1HQ3C 3WAAC 4AWLC 2RIQA 2NZDD 1AOIB 2F8NG 5BNVA 1H3OA 3H0RC 1M19A 1AOIC 3AZHC 4J8UA 4JJNB 5AVCD 3MGQB 3RELA 4YS3A 1TAFB 5CPKA 4JJNC 5DNMA 4WV4B 3LELA 4LD9A 1P3OB 3O62B 5B2IA 3MGQC 2JSSA 4Z5TB 4J8XD 2FFFB 3AZLA 1HQ3A 5B0ZD 2ZM5A 3VH5W 3W97D 5GT3C 1P3OC 2JCHA 3O62C 3B6FB 3W99A 4Z5TC 4WNNA 3LZ1C 3REKD 4ZUXC 3MGPB 3B6FC 3A6NB 1W2EA 2CV5C 1AOIA 3WKJC 5BO0B 1B6WA 5B32G 3VH6T 3A6NC 4X23B 3X1SD 4JJNA 1BFMA 4KHAB 2DQNC 1TAFA 3KWQB 4H9PB 1P3OA 3O62A 1KX3D 4Z5TA 5AY8D 5CP6D 2BG1A 5G49B 3MGPA 3AZKC 3A6NA 3X1VB 5AV6B 1M18D 5BO0A 3C1BA 3EPJA 3X1VC 4Z2MH 5AV6C 4X23A 5B31D 5AV9D 3AZGB 1M19D 5B33D 4KHAA 4R8PD 4YS3D 3KWQA 4UUZB 3UT9D 3AZGC 4UPKA 3NQUB 5DNMD 3LELD 3LJAB 1N1JB 2VQRA 1P3FB 1ZLAB 4H9NB 2HIOA 5B2ID 3REHB 1P3FC 3W98B 1ID3D 1BH8B 1M1AB 5G49A 4DQYB 3VH6W 3W98C 1TZYC 5AV6A 1F66D 4QLCD 1B67A 2RVQD 5B24C 3UTBC 5B1MB 3AZGA 5B0YC 4WJ3C 4DRBA 4UUZA 5B1MC 3VH5A 1P34D 5B40B 2NQBD 3NQUA 2Y2JA 3AFAB 1N1JA 3H0LC 3LJAA 4J8VB 3AZND 4H9NA 1P3BD 1P3FA 1ZLAA 3WA9B 5B40C 1EQZB 5JRGB 3REHA 3MGSD 1P3GD 3W98A 3WA9C 1BH8A 1M1AA 1KX5B 2L5AA 5JRGC 5B1LC 5GT0C 5GSUD 1Z2CB 1KX5C 3TU4C 3W96C 3C1BD 5B1MA 3B6GA 5E5AD 5BS7A 4Z66C 5B40A 3MNNC 3AFAA 4J8VA 2HIOD 1A7WA 1EQZA 2IO5C 1KX5A 3NQJB 3MGRD 1P3KD 5CPIB 2FJ7D 2F8ND 1P3ID 5AVCC 3B0DB 5CPIC 3IP4C 5BNXB 3B0DC 4XZQB 2BYKB 1U35D 2AROB 4XUJD 1ZLAD 3REID 2HUEB 3AV2B 1HTAA 4HGAB 3AV2C 5B32D 3B6GD 5BNXA 3MVDC 4HGAC 4XZQA 2BYKA 2Y2QA 2ZY3A 5AY8C 3B0BA 4YM6D 4J8WD 3AYWB 3AZJD 3WTPD 2AROA 3REJC 4M6BA 3AZHB 4KUDB 3AYWC 1KX4B 1P3LC 4KUDC 2JE5A 2Y2IA 1KX4C 4NE6A 3AV2A 5DNNC 5GT3B 5B31C 1P3MD 3X1UD 4KGCB 3LZ1B 5AV8B 3WAAA 4ZUXB 5CPJC 2Y2KA 2CV5B 3WKJB 4KGCC 5AV8C 3AYWA 3AZHA 3KXBC 4KUDA 1KX4A 3MGQA 3C1CB 4DRAA 2RVQC 3AZFD 5GT3A 3AZMC 2Y2LA 3C1CC 4KGCA 3LZ1A 5AV8A 5CHLB 3UTAD 4ZUXA 3AZKB 3B6FA 2CV5A 3WKJA 2Y2GA 1P3BC 3AZIC 3MGSC 5F99B 2AROD 2F2AC 3LZ0C 3AL0C 5C3IC 5GSUC 5F99C 4J8UD 3RELD 3C1CA 4H9PA 5CPKD 2F8NH 4LD9D 3AZLD 5E5AC 1HQ3D 1KU5A 3WAAD 3AZKA 3W99D 1TZYB 4H9QB 1PZRA 5GXQB 3X1VA 1BH9B 5B2JC 5B24B 3UTBB 1AOID 5B0YB 5GXQC 5AV5C 4JJND 2FJ7C 3AN2B 3MGQD 4WU9B 3H0MC 2BYMB 5GT3D 1P3OD 3O62D 3AN2C 3AV1B 4WU9C 4Z5TD 3LZ1D 5B1LB 4WU8B 5GT0B 4ZUXD 1S32B 3AV1C 3B6FD 2CV5D 1TZYA 4H9QA 1U35C 5GXQA 3TU4B 4WU8C 2UWXA 3MGPD 1S32C 3W96B 3A6ND 1BH9A 3UTBA 5AVBC
chains in the Genus database with same CATH topology
3REIC 3KUYB 5B0YA 4X23D 4Z66B 3KUYC 3MNNB 1P3AB 2ZY2A 3KWQD 3X1TC 4WU9A 3AZEB 2PYOB 1P3PC 2BYMA 2IO5B 5B32C 1P3AC 3WA9A 2NZDB 4G91C 3AZEC 2PYOC 2Y2NA 5B1LA 4WU8A 5GT0A 5JRGA 3WTPE 4J8WC 1S32A 2NZDC 4H9OB 4H9SC 5AVCB 3W96A 3TU4A 3X1VD 5AV6D 3KUYA 4CAYB 4NE3A 4J8XB 3KFUG 3AZGD 4Z66A 5B0ZB 3EPKA 3MNNA 4E44A 1P3AA 3W97B 4J8XC 3AZEA 2PYOA 1JFIB 5B0ZC 3W97C 3LJAD 1P3FD 2NZDA 3VH6A 3REKC 3REHD 5FUGB 3W98D 4H9OA 1TZYD 2CWEA 1M1AD 3X1SB 2YFWB 5AVCA 3NQJA 2F8NK 2G5IC 5CPIA 3F6TA 3X1SC 4CAYA 3MVDB 5B0YD 4EO5C 4J8XA 1KX3B 5AY8B 5CP6B 5B1MD 5B0ZA 3W97A 3AZFC 2DF4C 3REJB 3A1KA 1KX3C 5BT1D 5CP6C 3A1IA 5B40D 1JFIA 3UTAC 1P3LB 3AFAD 4J8VD 3VH5T 4E45A 3WA9D 1M18B 1EQZD 5JRGD 4G92C 5FUGA 5DNNB 2ZY5A 5B31B 5AV9B 3X1SA 2YFWA 5B33B 1KX5D 1M18C 4R8PB 1WWIA 1R4VA 3UT9B 5AV9C 4YS3B 4J8UC 5CPJB 5B33C 1M19C 3LELB 2XD5A 3MVDA 5DNMB 4R8PC 4YS3C 5AY8A 5CP6A 3UT9C 5CPKC 4Z66D 1KX3A 5DNMC 3MNND 3LELC 4Z2MG 3REJA 5B2IC 1ID3B 3KXBB 4WNNB 3AZLC 2Y2OA 1P3LA 3W99C 4NE5A 1ID3C 1ULYA 1M18A 4QLCB 1F66B 4NFTA 1F66C 5DNNA 4QLCC 5B31A 5AV9A 5B33A 3AZMB 4R8PA 3UT9A 5CPID 1P34B 5KDMB 5CPJA 2NQBB 2Y2HA 3EG5B 3AZNB 1P3BB 1P34C 3AZIB 2NQBC 1P3GB 3MGSB 3AZNC 1ID3A 4XZQD 3KXBA 3LZ0B 5C3IB 1P3GC 5JA4B 5GSUB 1F66A 4QLCA 3MGPC 3C1BB 3AZMA 3C1BC 5E5AB 3AV2D 4X23C 1P34A 5KDMA 2NQBA 3EPLA 3MVDD 1WWSA 3AZNA 1P3BA 2HIOB 3KWQC 3AZIA 1P3GA 5B2JB 3MGSA 3REJD 2HIOC 3LZ0A 3AYWD 1P3LD 5F99A 5JA4A 5GSUA 5AV5B 3MGRB 3AZHD 1P3KB 2FJ7B 4KUDD 2F8NB 1KX4D 1P3IB 3V9RB 3MGRC 1P3KC 5DNND 1P3IC 5E5AA 2XD1A 5CPJD 1U35B 4XUJB 4KGCD 5AV8D 2Y2PA 3LJAC 5B2JA 5AVBB 4H9RB 4ZBJB 4XUJC 3REIB 1ZLAC 3WKJD 3KXBD 3REHC 5AV5A 4ZBJC 3MGRA 1P3KA 1M1AC 2FJ7A 2F8NA 1P3IA 3V9RA 3X1TB 1P3PB 5B32B 3AZMD 3B6GB 3AN2A 3C1CD 3B0CT 4G91B 4YM6B 3FDDA 4J8WB 3B6GC 3AV1A 2Y2MA 3AZJB 3WTPB 1U35A 4XUJA 5BS7C 5BT1C 4YM6C 3AZID 3AZKD 5B31G 3WTPC 3AFAC 4J8VC 5AVBA 4H9RA 3REIA 3AZJC 3LZ0D 1EQZC 2YFVB 5F99D 3KSYA 3R45B 4CSRB 1P3MB 3X1UB 3X1TA 1P3PA 5B32A 1P3MC 3X1UC 4YM6A 3REKB 4J8WA 4WZSB 3AZJA 3WTPA 4H9SA 5B2JD 5GXQD 4EO5B 2YFVA 5B24D 3UTBD 5AV5D 3AZFB 3R45A 4CSRA 3EPHA 1P3MA 3B0CW 3X1UA 3UTAB 1F1EA 5B24A 3AN2D 4WU9D 3REKA 4G92B 3AV1D 5BNVB 1T3UA 4XZQC 1Q9CA 5B1LD 5GT0D 1H3OB 4WU8D 1S32D 1M19B 2AROC 2W8SA 2LY8A 5AVBD 3P5JB 4J8UB 3TU4D 3W96D 3RELB 5CPKB 3KUYD 2HUEC 3AZFA 2J8PA 4LD9B 5B2IB 3RELC 2G5HC 2ZY4A 3X1TD 3AZLB 1HQ3B 3UTAA 1P3PD 3WAAB 4AWLB 1P3AD 4LD9C 3W99B 3AZED 2PYOD 1HQ3C 3WAAC 4AWLC 2RIQA 2NZDD 1AOIB 2F8NG 5BNVA 1H3OA 3H0RC 1M19A 1AOIC 3AZHC 4J8UA 4JJNB 5AVCD 3MGQB 3RELA 4YS3A 1TAFB 5CPKA 4JJNC 5DNMA 4WV4B 3LELA 4LD9A 1P3OB 3O62B 5B2IA 3MGQC 2JSSA 4Z5TB 4J8XD 2FFFB 3AZLA 1HQ3A 5B0ZD 2ZM5A 3VH5W 3W97D 5GT3C 1P3OC 2JCHA 3O62C 3B6FB 3W99A 4Z5TC 4WNNA 3LZ1C 3REKD 4ZUXC 3MGPB 3B6FC 3A6NB 1W2EA 2CV5C 1AOIA 3WKJC 5BO0B 1B6WA 5B32G 3VH6T 3A6NC 4X23B 3X1SD 4JJNA 1BFMA 4KHAB 2DQNC 1TAFA 3KWQB 4H9PB 1P3OA 3O62A 1KX3D 4Z5TA 5AY8D 5CP6D 2BG1A 5G49B 3MGPA 3AZKC 3A6NA 3X1VB 5AV6B 1M18D 5BO0A 3C1BA 3EPJA 3X1VC 4Z2MH 5AV6C 4X23A 5B31D 5AV9D 3AZGB 1M19D 5B33D 4KHAA 4R8PD 4YS3D 3KWQA 4UUZB 3UT9D 3AZGC 4UPKA 3NQUB 5DNMD 3LELD 3LJAB 1N1JB 2VQRA 1P3FB 1ZLAB 4H9NB 2HIOA 5B2ID 3REHB 1P3FC 3W98B 1ID3D 1BH8B 1M1AB 5G49A 4DQYB 3VH6W 3W98C 1TZYC 5AV6A 1F66D 4QLCD 1B67A 2RVQD 5B24C 3UTBC 5B1MB 3AZGA 5B0YC 4WJ3C 4DRBA 4UUZA 5B1MC 3VH5A 1P34D 5B40B 2NQBD 3NQUA 2Y2JA 3AFAB 1N1JA 3H0LC 3LJAA 4J8VB 3AZND 4H9NA 1P3BD 1P3FA 1ZLAA 3WA9B 5B40C 1EQZB 5JRGB 3REHA 3MGSD 1P3GD 3W98A 3WA9C 1BH8A 1M1AA 1KX5B 2L5AA 5JRGC 5B1LC 5GT0C 5GSUD 1Z2CB 1KX5C 3TU4C 3W96C 3C1BD 5B1MA 3B6GA 5E5AD 5BS7A 4Z66C 5B40A 3MNNC 3AFAA 4J8VA 2HIOD 1A7WA 1EQZA 2IO5C 1KX5A 3NQJB 3MGRD 1P3KD 5CPIB 2FJ7D 2F8ND 1P3ID 5AVCC 3B0DB 5CPIC 3IP4C 5BNXB 3B0DC 4XZQB 2BYKB 1U35D 2AROB 4XUJD 1ZLAD 3REID 2HUEB 3AV2B 1HTAA 4HGAB 3AV2C 5B32D 3B6GD 5BNXA 3MVDC 4HGAC 4XZQA 2BYKA 2Y2QA 2ZY3A 5AY8C 3B0BA 4YM6D 4J8WD 3AYWB 3AZJD 3WTPD 2AROA 3REJC 4M6BA 3AZHB 4KUDB 3AYWC 1KX4B 1P3LC 4KUDC 2JE5A 2Y2IA 1KX4C 4NE6A 3AV2A 5DNNC 5GT3B 5B31C 1P3MD 3X1UD 4KGCB 3LZ1B 5AV8B 3WAAA 4ZUXB 5CPJC 2Y2KA 2CV5B 3WKJB 4KGCC 5AV8C 3AYWA 3AZHA 3KXBC 4KUDA 1KX4A 3MGQA 3C1CB 4DRAA 2RVQC 3AZFD 5GT3A 3AZMC 2Y2LA 3C1CC 4KGCA 3LZ1A 5AV8A 5CHLB 3UTAD 4ZUXA 3AZKB 3B6FA 2CV5A 3WKJA 2Y2GA 1P3BC 3AZIC 3MGSC 5F99B 2AROD 2F2AC 3LZ0C 3AL0C 5C3IC 5GSUC 5F99C 4J8UD 3RELD 3C1CA 4H9PA 5CPKD 2F8NH 4LD9D 3AZLD 5E5AC 1HQ3D 1KU5A 3WAAD 3AZKA 3W99D 1TZYB 4H9QB 1PZRA 5GXQB 3X1VA 1BH9B 5B2JC 5B24B 3UTBB 1AOID 5B0YB 5GXQC 5AV5C 4JJND 2FJ7C 3AN2B 3MGQD 4WU9B 3H0MC 2BYMB 5GT3D 1P3OD 3O62D 3AN2C 3AV1B 4WU9C 4Z5TD 3LZ1D 5B1LB 4WU8B 5GT0B 4ZUXD 1S32B 3AV1C 3B6FD 2CV5D 1TZYA 4H9QA 1U35C 5GXQA 3TU4B 4WU8C 2UWXA 3MGPD 1S32C 3W96B 3A6ND 1BH9A 3UTBA 5AVBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI C;  3KUY B;  5B0Y A;  4X23 D;  4Z66 B;  3KUY C;  3MNN B;  1P3A B;  4WU9 A;  3KWQ D;  3X1T C;  3AZE B;  2PYO B;  1P3P C;  2BYM A;  2IO5 B;  5B32 C;  1P3A C;  3WA9 A;  2NZD B;  4G91 C;  3AZE C;  2PYO C;  5JRG A;  5B1L A;  4WU8 A;  5GT0 A;  4J8W C;  3WTP E;  1S32 A;  2NZD C;  4H9O B;  4H9S C;  5AVC B;  3W96 A;  3TU4 A;  3X1V D;  5AV6 D;  3KUY A;  4CAY B;  4NE3 A;  4J8X B;  3AZG D;  4Z66 A;  5B0Z B;  3W97 B;  3MNN A;  4E44 A;  1P3A A;  4J8X C;  3AZE A;  2PYO A;  1JFI B;  5B0Z C;  3W97 C;  3LJA D;  1P3F D;  2NZD A;  3VH6 A;  3REK C;  3REH D;  5FUG B;  3W98 D;  4H9O A;  1TZY D;  2CWE A;  1M1A D;  3X1S B;  2YFW B;  5AVC A;  3NQJ A;  2F8N K;  5CPI A;  3X1S C;  4CAY A;  3MVD B;  5B0Y D;  4EO5 C;  4J8X A;  1KX3 B;  5AY8 B;  5CP6 B;  5B1M D;  5B0Z A;  3W97 A;  3AZF C;  3REJ B;  1KX3 C;  5BT1 D;  5CP6 C;  5B40 D;  1JFI A;  3UTA C;  1P3L B;  3AFA D;  4J8V D;  3VH5 T;  4E45 A;  3WA9 D;  1M18 B;  1EQZ D;  5JRG D;  4G92 C;  5FUG A;  5DNN B;  5B31 B;  5AV9 B;  1M18 C;  3X1S A;  2YFW A;  5B33 B;  1KX5 D;  4R8P B;  1WWI A;  1R4V A;  3UT9 B;  5AV9 C;  4YS3 B;  4J8U C;  5CPJ B;  5B33 C;  1M19 C;  3LEL B;  3MVD A;  5DNM B;  4R8P C;  4YS3 C;  5AY8 A;  5CP6 A;  3UT9 C;  5CPK C;  4Z66 D;  1KX3 A;  5DNM C;  3MNN D;  3LEL C;  4Z2M G;  3REJ A;  5B2I C;  1ID3 B;  3KXB B;  4WNN B;  3AZL C;  1P3L A;  3W99 C;  4NE5 A;  1ID3 C;  1ULY A;  1M18 A;  4QLC B;  1F66 B;  4NFT A;  1F66 C;  5DNN A;  4QLC C;  5B31 A;  5AV9 A;  5B33 A;  3AZM B;  4R8P A;  3UT9 A;  5CPI D;  1P34 B;  5KDM B;  5CPJ A;  2NQB B;  3AZN B;  1P3B B;  1P34 C;  3AZI B;  2NQB C;  1P3G B;  3MGS B;  3AZN C;  1ID3 A;  4XZQ D;  3KXB A;  3LZ0 B;  5C3I B;  1P3G C;  5JA4 B;  5GSU B;  1F66 A;  4QLC A;  3MGP C;  3C1B B;  3AZM A;  3C1B C;  5E5A B;  3AV2 D;  4X23 C;  1P34 A;  5KDM A;  2NQB A;  3MVD D;  1WWS A;  3AZN A;  1P3B A;  2HIO B;  3KWQ C;  3AZI A;  1P3G A;  5B2J B;  3MGS A;  3REJ D;  2HIO C;  3LZ0 A;  3AYW D;  1P3L D;  5F99 A;  5JA4 A;  5GSU A;  5AV5 B;  3MGR B;  3AZH D;  1P3K B;  2FJ7 B;  4KUD D;  2F8N B;  1KX4 D;  1P3I B;  3V9R B;  3MGR C;  1P3K C;  5DNN D;  1P3I C;  5E5A A;  5CPJ D;  1U35 B;  4XUJ B;  4KGC D;  5AV8 D;  3LJA C;  5B2J A;  5AVB B;  4H9R B;  4ZBJ B;  4XUJ C;  3REI B;  1ZLA C;  3WKJ D;  3KXB D;  3REH C;  5AV5 A;  4ZBJ C;  3MGR A;  1P3K A;  1M1A C;  2FJ7 A;  2F8N A;  1P3I A;  3V9R A;  3X1T B;  1P3P B;  5B32 B;  3AZM D;  3B6G B;  3AN2 A;  3C1C D;  3B0C T;  4G91 B;  4YM6 B;  4J8W B;  3B6G C;  3AV1 A;  3AZJ B;  3WTP B;  1U35 A;  4XUJ A;  5BS7 C;  5BT1 C;  4YM6 C;  3AZI D;  3AZK D;  5B31 G;  3WTP C;  3AFA C;  4J8V C;  5AVB A;  4H9R A;  3REI A;  3AZJ C;  3LZ0 D;  1EQZ C;  2YFV B;  5F99 D;  3KSY A;  3R45 B;  4CSR B;  1P3M B;  3X1U B;  3X1T A;  1P3P A;  5B32 A;  1P3M C;  3X1U C;  4YM6 A;  3REK B;  4J8W A;  4WZS B;  3AZJ A;  3WTP A;  4H9S A;  5B2J D;  5GXQ D;  4EO5 B;  2YFV A;  5B24 D;  3UTB D;  5AV5 D;  3AZF B;  3R45 A;  4CSR A;  1P3M A;  3B0C W;  3X1U A;  3UTA B;  1F1E A;  5B24 A;  3AN2 D;  4WU9 D;  3REK A;  4G92 B;  3AV1 D;  5BNV B;  4XZQ C;  1Q9C A;  5B1L D;  5GT0 D;  1H3O B;  4WU8 D;  1S32 D;  1M19 B;  2ARO C;  5AVB D;  2LY8 A;  4J8U B;  3TU4 D;  3W96 D;  3REL B;  5CPK B;  3KUY D;  2HUE C;  3AZF A;  4LD9 B;  5B2I B;  3REL C;  3X1T D;  3AZL B;  1HQ3 B;  3UTA A;  1P3P D;  3WAA B;  4AWL B;  1P3A D;  4LD9 C;  3W99 B;  3AZE D;  2PYO D;  1HQ3 C;  3WAA C;  4AWL C;  2NZD D;  1AOI B;  2F8N G;  5BNV A;  1H3O A;  1M19 A;  1AOI C;  3AZH C;  4J8U A;  4JJN B;  5AVC D;  3MGQ B;  3REL A;  4YS3 A;  1TAF B;  5CPK A;  4JJN C;  5DNM A;  4WV4 B;  3LEL A;  4LD9 A;  1P3O B;  3O62 B;  5B2I A;  3MGQ C;  2JSS A;  4Z5T B;  4J8X D;  3AZL A;  1HQ3 A;  5B0Z D;  3W97 D;  3VH5 W;  5GT3 C;  1P3O C;  3O62 C;  3B6F B;  3W99 A;  4Z5T C;  4WNN A;  3LZ1 C;  3REK D;  4ZUX C;  3MGP B;  3B6F C;  3A6N B;  2CV5 C;  1AOI A;  3WKJ C;  5BO0 B;  1B6W A;  5B32 G;  3VH6 T;  3A6N C;  4X23 B;  3X1S D;  4JJN A;  1BFM A;  4KHA B;  3KWQ B;  1TAF A;  4H9P B;  1P3O A;  3O62 A;  1KX3 D;  4Z5T A;  5AY8 D;  5CP6 D;  5G49 B;  3MGP A;  3AZK C;  3A6N A;  3X1V B;  5AV6 B;  1M18 D;  5BO0 A;  3C1B A;  3X1V C;  4Z2M H;  5AV6 C;  4X23 A;  5B31 D;  5AV9 D;  3AZG B;  1M19 D;  5B33 D;  4KHA A;  4R8P D;  4YS3 D;  3KWQ A;  4UUZ B;  3UT9 D;  3AZG C;  3NQU B;  5DNM D;  3LEL D;  3LJA B;  1N1J B;  1P3F B;  1ZLA B;  4H9N B;  2HIO A;  5B2I D;  3REH B;  1P3F C;  3W98 B;  1ID3 D;  1BH8 B;  1M1A B;  5G49 A;  3VH6 W;  3W98 C;  1TZY C;  5AV6 A;  1F66 D;  4QLC D;  1B67 A;  2RVQ D;  5B24 C;  3UTB C;  5B1M B;  3AZG A;  5B0Y C;  4DRB A;  4UUZ A;  5B1M C;  3VH5 A;  1P34 D;  5B40 B;  2NQB D;  3NQU A;  3AFA B;  3LJA A;  1N1J A;  4J8V B;  1P3F A;  3AZN D;  4H9N A;  1P3B D;  1ZLA A;  3WA9 B;  5B40 C;  1EQZ B;  5JRG B;  3REH A;  3MGS D;  1P3G D;  3W98 A;  3WA9 C;  1BH8 A;  1M1A A;  1KX5 B;  2L5A A;  5JRG C;  5B1L C;  5GT0 C;  5GSU D;  1KX5 C;  3TU4 C;  3W96 C;  3C1B D;  5B1M A;  3B6G A;  5E5A D;  5BS7 A;  4Z66 C;  5B40 A;  3MNN C;  3AFA A;  4J8V A;  2HIO D;  1A7W A;  1EQZ A;  2IO5 C;  1KX5 A;  3NQJ B;  3MGR D;  1P3K D;  5CPI B;  2FJ7 D;  2F8N D;  1P3I D;  5AVC C;  3B0D B;  5CPI C;  5BNX B;  3B0D C;  4XZQ B;  2BYK B;  1U35 D;  2ARO B;  4XUJ D;  1ZLA D;  3REI D;  2HUE B;  3AV2 B;  1HTA A;  4HGA B;  3AV2 C;  5B32 D;  3B6G D;  5BNX A;  3MVD C;  4HGA C;  4XZQ A;  2BYK A;  5AY8 C;  4YM6 D;  4J8W D;  3B0B A;  3AYW B;  3AZJ D;  3WTP D;  2ARO A;  3REJ C;  4M6B A;  3AZH B;  4KUD B;  3AYW C;  1KX4 B;  1P3L C;  4KUD C;  1KX4 C;  4NE6 A;  3AV2 A;  5DNN C;  5GT3 B;  5B31 C;  1P3M D;  3X1U D;  4KGC B;  3LZ1 B;  5AV8 B;  3WAA A;  4ZUX B;  5CPJ C;  2CV5 B;  3WKJ B;  4KGC C;  5AV8 C;  3AYW A;  3AZH A;  3KXB C;  4KUD A;  1KX4 A;  3MGQ A;  3C1C B;  4DRA A;  2RVQ C;  3AZF D;  5GT3 A;  3AZM C;  3C1C C;  4KGC A;  3LZ1 A;  5AV8 A;  5CHL B;  3UTA D;  4ZUX A;  3AZK B;  3B6F A;  2CV5 A;  3WKJ A;  1P3B C;  3AZI C;  3MGS C;  5F99 B;  2ARO D;  3LZ0 C;  5C3I C;  5GSU C;  5F99 C;  4J8U D;  3REL D;  3C1C A;  4H9P A;  5CPK D;  2F8N H;  4LD9 D;  3AZL D;  5E5A C;  1HQ3 D;  1KU5 A;  3WAA D;  3AZK A;  3W99 D;  1TZY B;  4H9Q B;  5GXQ B;  3X1V A;  1BH9 B;  5B2J C;  5B24 B;  3UTB B;  1AOI D;  5B0Y B;  5GXQ C;  5AV5 C;  4JJN D;  2FJ7 C;  3AN2 B;  3MGQ D;  4WU9 B;  2BYM B;  5GT3 D;  1P3O D;  3O62 D;  3AN2 C;  3AV1 B;  4WU9 C;  4Z5T D;  3LZ1 D;  5B1L B;  4WU8 B;  5GT0 B;  4ZUX D;  1S32 B;  3AV1 C;  3B6F D;  2CV5 D;  1TZY A;  4H9Q A;  1U35 C;  5GXQ A;  3TU4 B;  4WU8 C;  3W96 B;  3MGP D;  1S32 C;  3A6N D;  1BH9 A;  3UTB A;  5AVB C; 
#chains in the Genus database with same CATH topology
 3REI C;  3KUY B;  5B0Y A;  4X23 D;  4Z66 B;  3KUY C;  3MNN B;  1P3A B;  2ZY2 A;  3KWQ D;  3X1T C;  4WU9 A;  3AZE B;  2PYO B;  1P3P C;  2BYM A;  2IO5 B;  5B32 C;  1P3A C;  3WA9 A;  2NZD B;  4G91 C;  3AZE C;  2PYO C;  2Y2N A;  5B1L A;  4WU8 A;  5GT0 A;  5JRG A;  3WTP E;  4J8W C;  1S32 A;  2NZD C;  4H9O B;  4H9S C;  5AVC B;  3W96 A;  3TU4 A;  3X1V D;  5AV6 D;  3KUY A;  4CAY B;  4NE3 A;  4J8X B;  3KFU G;  3AZG D;  4Z66 A;  5B0Z B;  3EPK A;  3MNN A;  4E44 A;  1P3A A;  3W97 B;  4J8X C;  3AZE A;  2PYO A;  1JFI B;  5B0Z C;  3W97 C;  3LJA D;  1P3F D;  2NZD A;  3VH6 A;  3REK C;  3REH D;  5FUG B;  3W98 D;  4H9O A;  1TZY D;  2CWE A;  1M1A D;  3X1S B;  2YFW B;  5AVC A;  3NQJ A;  2F8N K;  2G5I C;  5CPI A;  3F6T A;  3X1S C;  4CAY A;  3MVD B;  5B0Y D;  4EO5 C;  4J8X A;  1KX3 B;  5AY8 B;  5CP6 B;  5B1M D;  5B0Z A;  3W97 A;  3AZF C;  2DF4 C;  3REJ B;  3A1K A;  1KX3 C;  5BT1 D;  5CP6 C;  3A1I A;  5B40 D;  1JFI A;  3UTA C;  1P3L B;  3AFA D;  4J8V D;  3VH5 T;  4E45 A;  3WA9 D;  1M18 B;  1EQZ D;  5JRG D;  4G92 C;  5FUG A;  5DNN B;  2ZY5 A;  5B31 B;  5AV9 B;  3X1S A;  2YFW A;  5B33 B;  1KX5 D;  1M18 C;  4R8P B;  1WWI A;  1R4V A;  3UT9 B;  5AV9 C;  4YS3 B;  4J8U C;  5CPJ B;  5B33 C;  1M19 C;  3LEL B;  2XD5 A;  3MVD A;  5DNM B;  4R8P C;  4YS3 C;  5AY8 A;  5CP6 A;  3UT9 C;  5CPK C;  4Z66 D;  1KX3 A;  5DNM C;  3MNN D;  3LEL C;  4Z2M G;  3REJ A;  5B2I C;  1ID3 B;  3KXB B;  4WNN B;  3AZL C;  2Y2O A;  1P3L A;  3W99 C;  4NE5 A;  1ID3 C;  1ULY A;  1M18 A;  4QLC B;  1F66 B;  4NFT A;  1F66 C;  5DNN A;  4QLC C;  5B31 A;  5AV9 A;  5B33 A;  3AZM B;  4R8P A;  3UT9 A;  5CPI D;  1P34 B;  5KDM B;  5CPJ A;  2NQB B;  2Y2H A;  3EG5 B;  3AZN B;  1P3B B;  1P34 C;  3AZI B;  2NQB C;  1P3G B;  3MGS B;  3AZN C;  1ID3 A;  4XZQ D;  3KXB A;  3LZ0 B;  5C3I B;  1P3G C;  5JA4 B;  5GSU B;  1F66 A;  4QLC A;  3MGP C;  3C1B B;  3AZM A;  3C1B C;  5E5A B;  3AV2 D;  4X23 C;  1P34 A;  5KDM A;  2NQB A;  3EPL A;  3MVD D;  1WWS A;  3AZN A;  1P3B A;  2HIO B;  3KWQ C;  3AZI A;  1P3G A;  5B2J B;  3MGS A;  3REJ D;  2HIO C;  3LZ0 A;  3AYW D;  1P3L D;  5F99 A;  5JA4 A;  5GSU A;  5AV5 B;  3MGR B;  3AZH D;  1P3K B;  2FJ7 B;  4KUD D;  2F8N B;  1KX4 D;  1P3I B;  3V9R B;  3MGR C;  1P3K C;  5DNN D;  1P3I C;  5E5A A;  2XD1 A;  5CPJ D;  1U35 B;  4XUJ B;  4KGC D;  5AV8 D;  2Y2P A;  3LJA C;  5B2J A;  5AVB B;  4H9R B;  4ZBJ B;  4XUJ C;  3REI B;  1ZLA C;  3WKJ D;  3KXB D;  3REH C;  5AV5 A;  4ZBJ C;  3MGR A;  1P3K A;  1M1A C;  2FJ7 A;  2F8N A;  1P3I A;  3V9R A;  3X1T B;  1P3P B;  5B32 B;  3AZM D;  3B6G B;  3AN2 A;  3C1C D;  3B0C T;  4G91 B;  4YM6 B;  3FDD A;  4J8W B;  3B6G C;  3AV1 A;  2Y2M A;  3AZJ B;  3WTP B;  1U35 A;  4XUJ A;  5BS7 C;  5BT1 C;  4YM6 C;  3AZI D;  3AZK D;  5B31 G;  3WTP C;  3AFA C;  4J8V C;  5AVB A;  4H9R A;  3REI A;  3AZJ C;  3LZ0 D;  1EQZ C;  2YFV B;  5F99 D;  3KSY A;  3R45 B;  4CSR B;  1P3M B;  3X1U B;  3X1T A;  1P3P A;  5B32 A;  1P3M C;  3X1U C;  4YM6 A;  3REK B;  4J8W A;  4WZS B;  3AZJ A;  3WTP A;  4H9S A;  5B2J D;  5GXQ D;  4EO5 B;  2YFV A;  5B24 D;  3UTB D;  5AV5 D;  3AZF B;  3R45 A;  4CSR A;  3EPH A;  1P3M A;  3B0C W;  3X1U A;  3UTA B;  1F1E A;  5B24 A;  3AN2 D;  4WU9 D;  3REK A;  4G92 B;  3AV1 D;  5BNV B;  1T3U A;  4XZQ C;  1Q9C A;  5B1L D;  5GT0 D;  1H3O B;  4WU8 D;  1S32 D;  1M19 B;  2ARO C;  2W8S A;  2LY8 A;  5AVB D;  3P5J B;  4J8U B;  3TU4 D;  3W96 D;  3REL B;  5CPK B;  3KUY D;  2HUE C;  3AZF A;  2J8P A;  4LD9 B;  5B2I B;  3REL C;  2G5H C;  2ZY4 A;  3X1T D;  3AZL B;  1HQ3 B;  3UTA A;  1P3P D;  3WAA B;  4AWL B;  1P3A D;  4LD9 C;  3W99 B;  3AZE D;  2PYO D;  1HQ3 C;  3WAA C;  4AWL C;  2RIQ A;  2NZD D;  1AOI B;  2F8N G;  5BNV A;  1H3O A;  3H0R C;  1M19 A;  1AOI C;  3AZH C;  4J8U A;  4JJN B;  5AVC D;  3MGQ B;  3REL A;  4YS3 A;  1TAF B;  5CPK A;  4JJN C;  5DNM A;  4WV4 B;  3LEL A;  4LD9 A;  1P3O B;  3O62 B;  5B2I A;  3MGQ C;  2JSS A;  4Z5T B;  4J8X D;  2FFF B;  3AZL A;  1HQ3 A;  5B0Z D;  2ZM5 A;  3VH5 W;  3W97 D;  5GT3 C;  1P3O C;  2JCH A;  3O62 C;  3B6F B;  3W99 A;  4Z5T C;  4WNN A;  3LZ1 C;  3REK D;  4ZUX C;  3MGP B;  3B6F C;  3A6N B;  1W2E A;  2CV5 C;  1AOI A;  3WKJ C;  5BO0 B;  1B6W A;  5B32 G;  3VH6 T;  3A6N C;  4X23 B;  3X1S D;  4JJN A;  1BFM A;  4KHA B;  2DQN C;  1TAF A;  3KWQ B;  4H9P B;  1P3O A;  3O62 A;  1KX3 D;  4Z5T A;  5AY8 D;  5CP6 D;  2BG1 A;  5G49 B;  3MGP A;  3AZK C;  3A6N A;  3X1V B;  5AV6 B;  1M18 D;  5BO0 A;  3C1B A;  3EPJ A;  3X1V C;  4Z2M H;  5AV6 C;  4X23 A;  5B31 D;  5AV9 D;  3AZG B;  1M19 D;  5B33 D;  4KHA A;  4R8P D;  4YS3 D;  3KWQ A;  4UUZ B;  3UT9 D;  3AZG C;  4UPK A;  3NQU B;  5DNM D;  3LEL D;  3LJA B;  1N1J B;  2VQR A;  1P3F B;  1ZLA B;  4H9N B;  2HIO A;  5B2I D;  3REH B;  1P3F C;  3W98 B;  1ID3 D;  1BH8 B;  1M1A B;  5G49 A;  4DQY B;  3VH6 W;  3W98 C;  1TZY C;  5AV6 A;  1F66 D;  4QLC D;  1B67 A;  2RVQ D;  5B24 C;  3UTB C;  5B1M B;  3AZG A;  5B0Y C;  4WJ3 C;  4DRB A;  4UUZ A;  5B1M C;  3VH5 A;  1P34 D;  5B40 B;  2NQB D;  3NQU A;  2Y2J A;  3AFA B;  1N1J A;  3H0L C;  3LJA A;  4J8V B;  3AZN D;  4H9N A;  1P3B D;  1P3F A;  1ZLA A;  3WA9 B;  5B40 C;  1EQZ B;  5JRG B;  3REH A;  3MGS D;  1P3G D;  3W98 A;  3WA9 C;  1BH8 A;  1M1A A;  1KX5 B;  2L5A A;  5JRG C;  5B1L C;  5GT0 C;  5GSU D;  1Z2C B;  1KX5 C;  3TU4 C;  3W96 C;  3C1B D;  5B1M A;  3B6G A;  5E5A D;  5BS7 A;  4Z66 C;  5B40 A;  3MNN C;  3AFA A;  4J8V A;  2HIO D;  1A7W A;  1EQZ A;  2IO5 C;  1KX5 A;  3NQJ B;  3MGR D;  1P3K D;  5CPI B;  2FJ7 D;  2F8N D;  1P3I D;  5AVC C;  3B0D B;  5CPI C;  3IP4 C;  5BNX B;  3B0D C;  4XZQ B;  2BYK B;  1U35 D;  2ARO B;  4XUJ D;  1ZLA D;  3REI D;  2HUE B;  3AV2 B;  1HTA A;  4HGA B;  3AV2 C;  5B32 D;  3B6G D;  5BNX A;  3MVD C;  4HGA C;  4XZQ A;  2BYK A;  2Y2Q A;  2ZY3 A;  5AY8 C;  3B0B A;  4YM6 D;  4J8W D;  3AYW B;  3AZJ D;  3WTP D;  2ARO A;  3REJ C;  4M6B A;  3AZH B;  4KUD B;  3AYW C;  1KX4 B;  1P3L C;  4KUD C;  2JE5 A;  2Y2I A;  1KX4 C;  4NE6 A;  3AV2 A;  5DNN C;  5GT3 B;  5B31 C;  1P3M D;  3X1U D;  4KGC B;  3LZ1 B;  5AV8 B;  3WAA A;  4ZUX B;  5CPJ C;  2Y2K A;  2CV5 B;  3WKJ B;  4KGC C;  5AV8 C;  3AYW A;  3AZH A;  3KXB C;  4KUD A;  1KX4 A;  3MGQ A;  3C1C B;  4DRA A;  2RVQ C;  3AZF D;  5GT3 A;  3AZM C;  2Y2L A;  3C1C C;  4KGC A;  3LZ1 A;  5AV8 A;  5CHL B;  3UTA D;  4ZUX A;  3AZK B;  3B6F A;  2CV5 A;  3WKJ A;  2Y2G A;  1P3B C;  3AZI C;  3MGS C;  5F99 B;  2ARO D;  2F2A C;  3LZ0 C;  3AL0 C;  5C3I C;  5GSU C;  5F99 C;  4J8U D;  3REL D;  3C1C A;  4H9P A;  5CPK D;  2F8N H;  4LD9 D;  3AZL D;  5E5A C;  1HQ3 D;  1KU5 A;  3WAA D;  3AZK A;  3W99 D;  1TZY B;  4H9Q B;  1PZR A;  5GXQ B;  3X1V A;  1BH9 B;  5B2J C;  5B24 B;  3UTB B;  1AOI D;  5B0Y B;  5GXQ C;  5AV5 C;  4JJN D;  2FJ7 C;  3AN2 B;  3MGQ D;  4WU9 B;  3H0M C;  2BYM B;  5GT3 D;  1P3O D;  3O62 D;  3AN2 C;  3AV1 B;  4WU9 C;  4Z5T D;  3LZ1 D;  5B1L B;  4WU8 B;  5GT0 B;  4ZUX D;  1S32 B;  3AV1 C;  3B6F D;  2CV5 D;  1TZY A;  4H9Q A;  1U35 C;  5GXQ A;  3TU4 B;  4WU8 C;  2UWX A;  3MGP D;  1S32 C;  3W96 B;  3A6N D;  1BH9 A;  3UTB A;  5AVB C; 
#chains in the Genus database with same CATH homology
 3REI C;  3KUY B;  5B0Y A;  4X23 D;  4Z66 B;  3KUY C;  3MNN B;  1P3A B;  2ZY2 A;  3KWQ D;  3X1T C;  4WU9 A;  3AZE B;  2PYO B;  1P3P C;  2BYM A;  2IO5 B;  5B32 C;  1P3A C;  3WA9 A;  2NZD B;  4G91 C;  3AZE C;  2PYO C;  2Y2N A;  5B1L A;  4WU8 A;  5GT0 A;  5JRG A;  3WTP E;  4J8W C;  1S32 A;  2NZD C;  4H9O B;  4H9S C;  5AVC B;  3W96 A;  3TU4 A;  3X1V D;  5AV6 D;  3KUY A;  4CAY B;  4NE3 A;  4J8X B;  3KFU G;  3AZG D;  4Z66 A;  5B0Z B;  3EPK A;  3MNN A;  4E44 A;  1P3A A;  3W97 B;  4J8X C;  3AZE A;  2PYO A;  1JFI B;  5B0Z C;  3W97 C;  3LJA D;  1P3F D;  2NZD A;  3VH6 A;  3REK C;  3REH D;  5FUG B;  3W98 D;  4H9O A;  1TZY D;  2CWE A;  1M1A D;  3X1S B;  2YFW B;  5AVC A;  3NQJ A;  2F8N K;  2G5I C;  5CPI A;  3F6T A;  3X1S C;  4CAY A;  3MVD B;  5B0Y D;  4EO5 C;  4J8X A;  1KX3 B;  5AY8 B;  5CP6 B;  5B1M D;  5B0Z A;  3W97 A;  3AZF C;  2DF4 C;  3REJ B;  3A1K A;  1KX3 C;  5BT1 D;  5CP6 C;  3A1I A;  5B40 D;  1JFI A;  3UTA C;  1P3L B;  3AFA D;  4J8V D;  3VH5 T;  4E45 A;  3WA9 D;  1M18 B;  1EQZ D;  5JRG D;  4G92 C;  5FUG A;  5DNN B;  2ZY5 A;  5B31 B;  5AV9 B;  3X1S A;  2YFW A;  5B33 B;  1KX5 D;  1M18 C;  4R8P B;  1WWI A;  1R4V A;  3UT9 B;  5AV9 C;  4YS3 B;  4J8U C;  5CPJ B;  5B33 C;  1M19 C;  3LEL B;  2XD5 A;  3MVD A;  5DNM B;  4R8P C;  4YS3 C;  5AY8 A;  5CP6 A;  3UT9 C;  5CPK C;  4Z66 D;  1KX3 A;  5DNM C;  3MNN D;  3LEL C;  4Z2M G;  3REJ A;  5B2I C;  1ID3 B;  3KXB B;  4WNN B;  3AZL C;  2Y2O A;  1P3L A;  3W99 C;  4NE5 A;  1ID3 C;  1ULY A;  1M18 A;  4QLC B;  1F66 B;  4NFT A;  1F66 C;  5DNN A;  4QLC C;  5B31 A;  5AV9 A;  5B33 A;  3AZM B;  4R8P A;  3UT9 A;  5CPI D;  1P34 B;  5KDM B;  5CPJ A;  2NQB B;  2Y2H A;  3EG5 B;  3AZN B;  1P3B B;  1P34 C;  3AZI B;  2NQB C;  1P3G B;  3MGS B;  3AZN C;  1ID3 A;  4XZQ D;  3KXB A;  3LZ0 B;  5C3I B;  1P3G C;  5JA4 B;  5GSU B;  1F66 A;  4QLC A;  3MGP C;  3C1B B;  3AZM A;  3C1B C;  5E5A B;  3AV2 D;  4X23 C;  1P34 A;  5KDM A;  2NQB A;  3EPL A;  3MVD D;  1WWS A;  3AZN A;  1P3B A;  2HIO B;  3KWQ C;  3AZI A;  1P3G A;  5B2J B;  3MGS A;  3REJ D;  2HIO C;  3LZ0 A;  3AYW D;  1P3L D;  5F99 A;  5JA4 A;  5GSU A;  5AV5 B;  3MGR B;  3AZH D;  1P3K B;  2FJ7 B;  4KUD D;  2F8N B;  1KX4 D;  1P3I B;  3V9R B;  3MGR C;  1P3K C;  5DNN D;  1P3I C;  5E5A A;  2XD1 A;  5CPJ D;  1U35 B;  4XUJ B;  4KGC D;  5AV8 D;  2Y2P A;  3LJA C;  5B2J A;  5AVB B;  4H9R B;  4ZBJ B;  4XUJ C;  3REI B;  1ZLA C;  3WKJ D;  3KXB D;  3REH C;  5AV5 A;  4ZBJ C;  3MGR A;  1P3K A;  1M1A C;  2FJ7 A;  2F8N A;  1P3I A;  3V9R A;  3X1T B;  1P3P B;  5B32 B;  3AZM D;  3B6G B;  3AN2 A;  3C1C D;  3B0C T;  4G91 B;  4YM6 B;  3FDD A;  4J8W B;  3B6G C;  3AV1 A;  2Y2M A;  3AZJ B;  3WTP B;  1U35 A;  4XUJ A;  5BS7 C;  5BT1 C;  4YM6 C;  3AZI D;  3AZK D;  5B31 G;  3WTP C;  3AFA C;  4J8V C;  5AVB A;  4H9R A;  3REI A;  3AZJ C;  3LZ0 D;  1EQZ C;  2YFV B;  5F99 D;  3KSY A;  3R45 B;  4CSR B;  1P3M B;  3X1U B;  3X1T A;  1P3P A;  5B32 A;  1P3M C;  3X1U C;  4YM6 A;  3REK B;  4J8W A;  4WZS B;  3AZJ A;  3WTP A;  4H9S A;  5B2J D;  5GXQ D;  4EO5 B;  2YFV A;  5B24 D;  3UTB D;  5AV5 D;  3AZF B;  3R45 A;  4CSR A;  3EPH A;  1P3M A;  3B0C W;  3X1U A;  3UTA B;  1F1E A;  5B24 A;  3AN2 D;  4WU9 D;  3REK A;  4G92 B;  3AV1 D;  5BNV B;  1T3U A;  4XZQ C;  1Q9C A;  5B1L D;  5GT0 D;  1H3O B;  4WU8 D;  1S32 D;  1M19 B;  2ARO C;  2W8S A;  2LY8 A;  5AVB D;  3P5J B;  4J8U B;  3TU4 D;  3W96 D;  3REL B;  5CPK B;  3KUY D;  2HUE C;  3AZF A;  2J8P A;  4LD9 B;  5B2I B;  3REL C;  2G5H C;  2ZY4 A;  3X1T D;  3AZL B;  1HQ3 B;  3UTA A;  1P3P D;  3WAA B;  4AWL B;  1P3A D;  4LD9 C;  3W99 B;  3AZE D;  2PYO D;  1HQ3 C;  3WAA C;  4AWL C;  2RIQ A;  2NZD D;  1AOI B;  2F8N G;  5BNV A;  1H3O A;  3H0R C;  1M19 A;  1AOI C;  3AZH C;  4J8U A;  4JJN B;  5AVC D;  3MGQ B;  3REL A;  4YS3 A;  1TAF B;  5CPK A;  4JJN C;  5DNM A;  4WV4 B;  3LEL A;  4LD9 A;  1P3O B;  3O62 B;  5B2I A;  3MGQ C;  2JSS A;  4Z5T B;  4J8X D;  2FFF B;  3AZL A;  1HQ3 A;  5B0Z D;  2ZM5 A;  3VH5 W;  3W97 D;  5GT3 C;  1P3O C;  2JCH A;  3O62 C;  3B6F B;  3W99 A;  4Z5T C;  4WNN A;  3LZ1 C;  3REK D;  4ZUX C;  3MGP B;  3B6F C;  3A6N B;  1W2E A;  2CV5 C;  1AOI A;  3WKJ C;  5BO0 B;  1B6W A;  5B32 G;  3VH6 T;  3A6N C;  4X23 B;  3X1S D;  4JJN A;  1BFM A;  4KHA B;  2DQN C;  1TAF A;  3KWQ B;  4H9P B;  1P3O A;  3O62 A;  1KX3 D;  4Z5T A;  5AY8 D;  5CP6 D;  2BG1 A;  5G49 B;  3MGP A;  3AZK C;  3A6N A;  3X1V B;  5AV6 B;  1M18 D;  5BO0 A;  3C1B A;  3EPJ A;  3X1V C;  4Z2M H;  5AV6 C;  4X23 A;  5B31 D;  5AV9 D;  3AZG B;  1M19 D;  5B33 D;  4KHA A;  4R8P D;  4YS3 D;  3KWQ A;  4UUZ B;  3UT9 D;  3AZG C;  4UPK A;  3NQU B;  5DNM D;  3LEL D;  3LJA B;  1N1J B;  2VQR A;  1P3F B;  1ZLA B;  4H9N B;  2HIO A;  5B2I D;  3REH B;  1P3F C;  3W98 B;  1ID3 D;  1BH8 B;  1M1A B;  5G49 A;  4DQY B;  3VH6 W;  3W98 C;  1TZY C;  5AV6 A;  1F66 D;  4QLC D;  1B67 A;  2RVQ D;  5B24 C;  3UTB C;  5B1M B;  3AZG A;  5B0Y C;  4WJ3 C;  4DRB A;  4UUZ A;  5B1M C;  3VH5 A;  1P34 D;  5B40 B;  2NQB D;  3NQU A;  2Y2J A;  3AFA B;  1N1J A;  3H0L C;  3LJA A;  4J8V B;  3AZN D;  4H9N A;  1P3B D;  1P3F A;  1ZLA A;  3WA9 B;  5B40 C;  1EQZ B;  5JRG B;  3REH A;  3MGS D;  1P3G D;  3W98 A;  3WA9 C;  1BH8 A;  1M1A A;  1KX5 B;  2L5A A;  5JRG C;  5B1L C;  5GT0 C;  5GSU D;  1Z2C B;  1KX5 C;  3TU4 C;  3W96 C;  3C1B D;  5B1M A;  3B6G A;  5E5A D;  5BS7 A;  4Z66 C;  5B40 A;  3MNN C;  3AFA A;  4J8V A;  2HIO D;  1A7W A;  1EQZ A;  2IO5 C;  1KX5 A;  3NQJ B;  3MGR D;  1P3K D;  5CPI B;  2FJ7 D;  2F8N D;  1P3I D;  5AVC C;  3B0D B;  5CPI C;  3IP4 C;  5BNX B;  3B0D C;  4XZQ B;  2BYK B;  1U35 D;  2ARO B;  4XUJ D;  1ZLA D;  3REI D;  2HUE B;  3AV2 B;  1HTA A;  4HGA B;  3AV2 C;  5B32 D;  3B6G D;  5BNX A;  3MVD C;  4HGA C;  4XZQ A;  2BYK A;  2Y2Q A;  2ZY3 A;  5AY8 C;  3B0B A;  4YM6 D;  4J8W D;  3AYW B;  3AZJ D;  3WTP D;  2ARO A;  3REJ C;  4M6B A;  3AZH B;  4KUD B;  3AYW C;  1KX4 B;  1P3L C;  4KUD C;  2JE5 A;  2Y2I A;  1KX4 C;  4NE6 A;  3AV2 A;  5DNN C;  5GT3 B;  5B31 C;  1P3M D;  3X1U D;  4KGC B;  3LZ1 B;  5AV8 B;  3WAA A;  4ZUX B;  5CPJ C;  2Y2K A;  2CV5 B;  3WKJ B;  4KGC C;  5AV8 C;  3AYW A;  3AZH A;  3KXB C;  4KUD A;  1KX4 A;  3MGQ A;  3C1C B;  4DRA A;  2RVQ C;  3AZF D;  5GT3 A;  3AZM C;  2Y2L A;  3C1C C;  4KGC A;  3LZ1 A;  5AV8 A;  5CHL B;  3UTA D;  4ZUX A;  3AZK B;  3B6F A;  2CV5 A;  3WKJ A;  2Y2G A;  1P3B C;  3AZI C;  3MGS C;  5F99 B;  2ARO D;  2F2A C;  3LZ0 C;  3AL0 C;  5C3I C;  5GSU C;  5F99 C;  4J8U D;  3REL D;  3C1C A;  4H9P A;  5CPK D;  2F8N H;  4LD9 D;  3AZL D;  5E5A C;  1HQ3 D;  1KU5 A;  3WAA D;  3AZK A;  3W99 D;  1TZY B;  4H9Q B;  1PZR A;  5GXQ B;  3X1V A;  1BH9 B;  5B2J C;  5B24 B;  3UTB B;  1AOI D;  5B0Y B;  5GXQ C;  5AV5 C;  4JJN D;  2FJ7 C;  3AN2 B;  3MGQ D;  4WU9 B;  3H0M C;  2BYM B;  5GT3 D;  1P3O D;  3O62 D;  3AN2 C;  3AV1 B;  4WU9 C;  4Z5T D;  3LZ1 D;  5B1L B;  4WU8 B;  5GT0 B;  4ZUX D;  1S32 B;  3AV1 C;  3B6F D;  2CV5 D;  1TZY A;  4H9Q A;  1U35 C;  5GXQ A;  3TU4 B;  4WU8 C;  2UWX A;  3MGP D;  1S32 C;  3W96 B;  3A6N D;  1BH9 A;  3UTB A;  5AVB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...