5GT0B

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0B00
4UUZA 3AZMD 5B33B 3B0DC 4R8PB 3AN2C 4NE3A 3X1VB 1TZYA 5DNND 5B0YB 4HGAC 4ZBJC 5F99D 5JRGB 1S32C 1F66D 3AZGD 3R45B 3REHA 3AZEC 2NQBB 3WKJA 1P3BD 4YS3C 3MGRC 5AV8B 2IO5B 3LELC 1P3GA 3UTBD 3AV2D 4KUDB 3KUYA 4DRAA 5BO0B 3LZ1B 4J8VA 1KX4B 1P3IA 3LJAB 1M19B 1KX3A 3KSYA 5B40B 1B67A 5AVBD 3KWQC 3AV1B 5CP6C 1H3OA 1R4VA 5B0ZA 4H9OB 3W98D 4JJND 5CPKA 5AV9D 5FUGB 3UTAB 1P34D 5CPIB 3RELB 3WA9A 5B2IA 1BFMA 3AZFB 2F8NK 3MGQD 1P3FC 4AWLB 5DNNA 1P3OC 3WAAB 3C1CC 5B2JD 3TU4D 5B33C 4EO5B 4R8PC 5B1LB 3X1VC 5B31D 5B0YC 5JRGC 1ID3D 5B1MA 2CWEA 1ZLAB 3REID 1Q9CA 4G92B 5AVCA 4H9NA 5GT3B 2NQBC 1P3PC 2IO5C 2F8NG 1HQ3B 3VH5T 4X23D 3LZ1C 1KX4C 3REJB 2BYMB 5GXQB 3AZEA 1M1AA 5B40C 4UUZB 3AV1C 3MGSD 5AV9A 1TZYB 3UTAC 5CPIC 5AY8A 5B2JA 3RELC 2HIOA 3TU4A 3REHB 5CPJD 3WKJB 3AZFC 1P3GB 3B0BA 1ID3A 4E45A 4H9PA 3KUYB 4EO5C 3A6ND 3REIA 4J8VB 5B1LC 4Z2MG 1P3IB 1KX3B 4ZUXD 3AZKB 4H9RA 3W97A 1U35A 2CV5A 1ZLAC 4X23A 4Z66D 5AV6D 1H3OB 5GT3C 5B0ZB 3MNND 3C1CA 3MVDC 5BNXA 1HQ3C 1P3MD 5GT0A 5CPKB 3AZIA 4XZQD 4M6BA 1P3KD 3REJC 3WA9B 5B2IB 5GXQC 3AZHD 1F1EA 3VH5W 5CPJA 3REKD 1AOID 1TZYC 5B24D 5B1MB 4XUJD 4QLCD 3REHC 5AVCB 4H9NB 4DRBA 3AFAA 1EQZD 2PYOD 3WKJC 3AZJC 2FJ7A 1P3GC 1KU5A 4Z2MH 1P3AD 3KUYC 3X1TD 3C1BD 3WTPE 4HGAB 4ZBJB 1P3LD 4LD9A 1KX3C 1WWIA 3AZEB 5JA4A 1M1AB 5DNMD 4J8UD 1M18A 1KX5D 3LELB 2NZDA 5B0ZC 3MGPD 3WTPA 3X1UA 2F8ND 4J8WD 4J8XD 5CPKC 3X1SD 5AY8B 2HIOB 5B2IC 2L5AA 5AV5D 5DNNC 3O62A 4H9PB 2LY8A 3AZNA 2PYOA 4H9RB 3W97B 5B1MC 1U35B 3NQUA 2RVQC 2CV5B 3AZLD 5AVCC 1P3LA 3C1CB 5BNXB 3UT9A 5GT0B 3AZIB 3B6FA 3W96A 1M1AC 2F8NA 3AZJA 5AV9C 1P3PB 3AYWA 3X1SA 5E5AD 5CPJB 4Z5TD 3B6GD 5GSUD 5B2JC 2AROD 5AY8C 3TU4C 2HIOC 5B32A 3AFAB 3W99A 2FJ7B 4WU9D 4YM6A 2HUEB 1ID3C 4WU8D 1A7WA 3REIC 3AZMA 4LD9B 5JA4B 3W97C 1U35C 2CV5C 4X23C 1M18B 2NZDB 4H9SC 4H9QA 5F99A 1F66A 3WTPB 3AZGA 4KGCD 2JSSA 3X1UB 5GT0C 1P3BA 3AZIC 1N1JA 3AN2D 3KXBD 3UTBA 4KHAA 3AV2A 3O62B 1S32D 3B6GA 5GSUA 3MVDB 3AZNB 5CPJC 5AVBA 4YS3D 3MGRD 5C3IB 4WU8A 3LZ0D 3W98A 3AFAC 1P3LB 4JJNA 1P34A 2FJ7C 1JFIA 2HUEC 3UT9B 3KWQD 3B6FB 5CP6D 3MGQA 4WNNA 4LD9C 3VH6T 3W96B 2F8NB 3AZJB 1M18C 5B31A 3AYWB 2NZDC 3VH5A 3KXBA 3WTPC 3X1UC 1P3FD 1P3OD 5B33D 5BS7A 4R8PD 5B32B 3X1VD 3W99B 1BH8A 5B0YD 5JRGD 4YM6B 4H9SA 3O62C 1HTAA 3AZNC 2NQBD 3VH6A 3AZMB 2PYOC 3MGSA 5AV8D 5C3IC 2YFVA 4KUDD 3LZ1D 1KX4D 5DNNB 1P3LC 5F99B 4H9QB 1M19D 3LJAD 1F66B 3AZGB 3UT9C 5B40D 3AV1D 1P3BB 3B6FC 5BT1C 1N1JB 3UTBB 4KHAB 3AV2B 3W96C 3A6NA 4CSRA 3UTAD 3B6GB 3AYWC 3X1SC 5CPID 4ZUXA 3RELD 1P3OB 3B0CT 5AVBB 3AZFD 4Z66A 5AV6A 3WAAD 3MNNA 3VH6W 3W98B 5B32C 1P3MA 5B1LD 4JJNB 3W99C 5AV9B 4XZQA 1P34B 1P3KA 5AV8A 4YM6C 1JFIB 1ZLAD 4KUDA 2BYKA 3AZHA 3MGQB 4WNNB 5GT3D 3AZMC 5B2JB 3TU4B 3LJAA 1M19A 1HQ3D 1TAFA 3REKA 5B31B 5KDMA 5B24A 3REJD 1AOIA 1ID3B 5F99C 5G49A 1F66C 5GXQD 3AZGC 4XUJA 4QLCA 3REIB 1P3BC 1EQZA 5FUGA 3UTBC 3AV2C 1P3AA 4X23B 3X1TA 1BH8B 3C1BA 1TZYD 3WAAA 3B6GC 5GSUC 3REHD 3WKJD 5AVBC 5DNMA 3MGSB 4J8UA 1KX5A 1P3GD 3MGPA 4WU8C 3KUYD 3W98C 4J8VD 4J8WA 4J8XA 4JJNC 1P34C 1P3ID 1KX3D 1ULYA 3AZKD 3B0CW 4WZSB 5AV5A 3MGQC 5B0ZD 3A6NB 2YFWA 5CPKD 5B31C 4ZUXB 3WA9D 3KXBC 5B2ID 5BNVA 3AZLA 4Z66B 5AV6B 3MNNB 5BS7C 1P3MB 4CAYA 1P3KB 4XZQB 5CHLB 5B1MD 3NQJA 2RVQD 3LZ0C 2BYKB 3AZHB 5AVCD 3MGSC 3AZKA 1TAFB 5E5AA 3REKB 4Z5TA 5KDMB 5B24B 1AOIB 5G49B 2AROA 4XUJB 4QLCB 3AZED 1M1AD 2PYOB 1EQZB 3LELD 4WU9A 3NQUB 1P3AB 3X1TB 3A6NC 3C1BB 1B6WA 5AY8D 4ZUXC 2HIOD 5DNMB 4J8UB 1KX5B 4Z66C 5AV6C 3MNNC 3MGPB 4KGCA 4J8WB 1P3MC 4J8XB 1P3KC 4XZQC 3X1SB 5AV8C 3V9RA 3AN2A 3W97D 1U35D 2CV5D 4E44A 4KUDC 3AZHC 5AV5B 4WV4B 3C1CD 1S32A 1M19C 3LJAC 2YFWB 1BH9A 5GT0D 3REKC 1WWSA 3AZID 3MGRA 4YS3A 1AOIC 5B24C 5B32G 3LELA 5BNVB 4QLCC 4XUJC 3LZ0A 3AZLB 1EQZC 1P3PD 1P3AC 3KWQA 4CAYB 3X1TC 3C1BC 5CP6A 4AWLC 3WAAC 3NQJB 3AFAD 4G91B 5DNMC 2FJ7D 4J8UC 1KX5C 5E5AB 3MGPC 2F8NH 4Z5TB 4J8WC 4G92C 1P3FA 1P3OA 4J8XC 4LD9D 5GSUB 5B33A 2AROB 4NE6A 4R8PA 3X1VA 1M18D 5AV5C 4WU9B 2NZDD 5B0YA 5JRGA 4WU8B 3WTPD 3R45A 3X1UD 2NQBA 1P3PA 3AZLC 5BO0A 3LZ1A 1KX4A 3O62D 3MVDD 4KGCB 3AZND 5B40A 3AV1A 3B0DB 3V9RB 3AN2B 3KXBB 4H9OA 5B31G 4J8VC 4G91C 1S32B 3UTAA 1P3IC 4NFTA 5CPIA 3RELA 3AZKC 1BH9B 5E5AC 3UT9D 3B6FD 5BT1D 3MGRB 4Z5TC 3AZFA 4YS3B 2AROC 3W96D 3LZ0B 4NE5A 5B1LA 3AZJD 3AYWD 4WU9C 2YFVB 3WA9C 1ZLAA 3KWQB 5CP6B 5GT3A 3MVDA 1HQ3A 5B32D 3W99D 4YM6D 2BYMA 3REJA 5GXQA 4KGCC 1P3FB 4CSRB
chains in the Genus database with same CATH superfamily
4UUZA 3AZMD 5B33B 3B0DC 4R8PB 3AN2C 4NE3A 3X1VB 1TZYA 5DNND 5B0YB 4HGAC 4ZBJC 5F99D 5JRGB 1S32C 1F66D 3AZGD 1PZRA 3R45B 2FFFB 3REHA 3AZEC 2NQBB 3WKJA 1P3BD 4YS3C 3MGRC 5AV8B 2IO5B 3LELC 4DQYB 1P3GA 3UTBD 3AV2D 4KUDB 3KUYA 4DRAA 5BO0B 3LZ1B 4J8VA 1KX4B 1P3IA 3LJAB 1M19B 1KX3A 3KSYA 5B40B 1B67A 5AVBD 3KWQC 3AV1B 5CP6C 1H3OA 1R4VA 5B0ZA 4H9OB 3W98D 4JJND 5CPKA 5AV9D 5FUGB 3UTAB 1P34D 5CPIB 3RELB 3WA9A 5B2IA 2VQRA 1BFMA 3AZFB 2F8NK 3MGQD 1P3FC 4AWLB 5DNNA 1P3OC 3WAAB 3EPKA 3C1CC 5B2JD 3TU4D 5B33C 4EO5B 4R8PC 5B1LB 3X1VC 5B31D 5B0YC 5JRGC 1ID3D 2DQNC 5B1MA 2CWEA 1ZLAB 3REID 1Q9CA 4G92B 5AVCA 4H9NA 5GT3B 2NQBC 1P3PC 2IO5C 2F8NG 1HQ3B 3VH5T 4X23D 3LZ1C 1KX4C 3REJB 2BYMB 3AL0C 2ZY3A 5GXQB 3AZEA 1M1AA 5B40C 4UUZB 3AV1C 3MGSD 5AV9A 1TZYB 3UTAC 5CPIC 5AY8A 5B2JA 3RELC 2HIOA 3TU4A 3REHB 5CPJD 3WKJB 3AZFC 1P3GB 3B0BA 1ID3A 4E45A 4H9PA 3KUYB 2F2AC 4EO5C 3A6ND 3REIA 4J8VB 5B1LC 4Z2MG 1P3IB 1KX3B 4ZUXD 3AZKB 3F6TA 4H9RA 3W97A 1U35A 2CV5A 1ZLAC 4X23A 4Z66D 5AV6D 1H3OB 5GT3C 5B0ZB 3MNND 3C1CA 2G5IC 3MVDC 5BNXA 1HQ3C 1P3MD 5GT0A 5CPKB 3AZIA 4XZQD 4M6BA 1P3KD 3REJC 3WA9B 5B2IB 5GXQC 3AZHD 1F1EA 3VH5W 5CPJA 3REKD 3EPJA 1AOID 1TZYC 2Y2KA 5B24D 5B1MB 4XUJD 4QLCD 3REHC 5AVCB 4H9NB 4DRBA 3AFAA 1EQZD 2PYOD 3WKJC 3AZJC 2FJ7A 1P3GC 1KU5A 4Z2MH 1P3AD 3KUYC 3X1TD 2ZY2A 3WTPE 3C1BD 4HGAB 4ZBJB 1P3LD 4LD9A 2ZY5A 1WWIA 3EPLA 1KX3C 3AZEB 5JA4A 1T3UA 1M1AB 5DNMD 4J8UD 1M18A 1KX5D 3LELB 2NZDA 5B0ZC 3MGPD 4UPKA 3WTPA 3X1UA 2F8ND 4J8WD 4J8XD 5CPKC 3X1SD 5AY8B 2HIOB 5B2IC 2L5AA 5AV5D 5DNNC 3O62A 4H9PB 2LY8A 3IP4C 3AZNA 2PYOA 4H9RB 3W97B 5B1MC 1U35B 3NQUA 2RVQC 2CV5B 2RIQA 3AZLD 5AVCC 1P3LA 3C1CB 2Y2JA 1Z2CB 5BNXB 3UT9A 5GT0B 3AZIB 3B6FA 3W96A 1M1AC 2F8NA 2XD1A 3AZJA 5AV9C 1P3PB 3AYWA 3X1SA 5E5AD 5CPJB 4Z5TD 3B6GD 5GSUD 5B2JC 2AROD 5AY8C 3TU4C 2HIOC 5B32A 3AFAB 3W99A 2FJ7B 4WU9D 4YM6A 2HUEB 1ID3C 4WU8D 1A7WA 3REIC 3AZMA 4LD9B 5JA4B 3W97C 1U35C 2CV5C 4X23C 1M18B 2NZDB 4H9SC 4H9QA 5F99A 1F66A 3WTPB 3AZGA 4KGCD 2JSSA 3X1UB 5GT0C 1P3BA 3AZIC 1N1JA 3AN2D 3KXBD 3UTBA 4KHAA 3AV2A 2W8SA 3O62B 3H0MC 1S32D 3B6GA 5GSUA 3MVDB 3AZNB 5CPJC 5AVBA 2Y2IA 4YS3D 3MGRD 5C3IB 4WU8A 2Y2QA 3LZ0D 3W98A 3AFAC 1P3LB 4JJNA 1P34A 2FJ7C 1JFIA 2HUEC 3UT9B 3KWQD 3B6FB 5CP6D 3MGQA 4WNNA 4LD9C 3VH6T 3W96B 3EPHA 2F8NB 3AZJB 1M18C 5B31A 3AYWB 2NZDC 3VH5A 3KXBA 3WTPC 3X1UC 1P3FD 1P3OD 5B33D 5BS7A 4R8PD 5B32B 3X1VD 3W99B 1BH8A 5B0YD 5JRGD 4YM6B 4H9SA 3O62C 1HTAA 3AZNC 2NQBD 3VH6A 3AZMB 2PYOC 3MGSA 5AV8D 5C3IC 2YFVA 4KUDD 2Y2MA 3LZ1D 1KX4D 5DNNB 1P3LC 5F99B 4H9QB 1M19D 3LJAD 1F66B 3AZGB 3H0RC 3UT9C 5B40D 3AV1D 1P3BB 3B6FC 5BT1C 1N1JB 3UTBB 4KHAB 3AV2B 3W96C 3A6NA 4CSRA 3UTAD 3B6GB 3AYWC 3X1SC 5CPID 4ZUXA 3RELD 3FDDA 1P3OB 1W2EA 3B0CT 5AVBB 3AZFD 4Z66A 5AV6A 3WAAD 3MNNA 3VH6W 3W98B 2G5HC 5B32C 1P3MA 5B1LD 4JJNB 3W99C 5AV9B 4XZQA 2ZM5A 1P34B 1P3KA 3H0LC 5AV8A 4YM6C 1JFIB 1ZLAD 4KUDA 2BYKA 3AZHA 3MGQB 4WNNB 5GT3D 3AZMC 5B2JB 3TU4B 3LJAA 1M19A 1HQ3D 1TAFA 3REKA 5B31B 5KDMA 5B24A 3REJD 1AOIA 1ID3B 5F99C 5G49A 1F66C 5GXQD 3AZGC 4XUJA 4QLCA 3REIB 1P3BC 1EQZA 5FUGA 3A1KA 2Y2LA 3UTBC 3AV2C 1P3AA 4X23B 3X1TA 1BH8B 3C1BA 1TZYD 2ZY4A 3WAAA 3B6GC 5GSUC 3KFUG 3REHD 3WKJD 5AVBC 5DNMA 3MGSB 4J8UA 1KX5A 1P3GD 3MGPA 4WU8C 3KUYD 3W98C 4J8VD 4J8WA 4J8XA 4JJNC 1P34C 1P3ID 1KX3D 1ULYA 2JE5A 3AZKD 3B0CW 4WZSB 5AV5A 3MGQC 5B0ZD 3A6NB 2YFWA 5CPKD 5B31C 4ZUXB 3WA9D 3KXBC 5B2ID 5BNVA 3AZLA 4Z66B 5AV6B 2UWXA 3MNNB 5BS7C 2XD5A 1P3MB 4CAYA 1P3KB 3A1IA 4XZQB 5CHLB 5B1MD 3NQJA 2RVQD 3LZ0C 2BYKB 3AZHB 5AVCD 3MGSC 3AZKA 1TAFB 5E5AA 3REKB 4Z5TA 5KDMB 5B24B 1AOIB 5G49B 2AROA 4XUJB 4QLCB 3AZED 1M1AD 2PYOB 1EQZB 3LELD 4WU9A 3NQUB 1P3AB 4WJ3C 3X1TB 3A6NC 3C1BB 1B6WA 2Y2OA 5AY8D 4ZUXC 2HIOD 5DNMB 4J8UB 1KX5B 4Z66C 5AV6C 2Y2NA 3MNNC 3MGPB 4KGCA 4J8WB 2J8PA 1P3MC 4J8XB 1P3KC 4XZQC 3X1SB 5AV8C 3V9RA 3AN2A 3W97D 1U35D 2CV5D 4E44A 4KUDC 3AZHC 5AV5B 4WV4B 3C1CD 1S32A 1M19C 3LJAC 1BH9A 2YFWB 5GT0D 3REKC 1WWSA 3AZID 3MGRA 4YS3A 1AOIC 5B24C 5B32G 3LELA 5BNVB 4QLCC 4XUJC 3LZ0A 3AZLB 1EQZC 1P3PD 1P3AC 3KWQA 4CAYB 3X1TC 3C1BC 5CP6A 4AWLC 3WAAC 3NQJB 3AFAD 4G91B 5DNMC 2FJ7D 4J8UC 1KX5C 5E5AB 3MGPC 2F8NH 4Z5TB 4J8WC 4G92C 1P3FA 1P3OA 4J8XC 4LD9D 5GSUB 5B33A 2AROB 4NE6A 4R8PA 3X1VA 1M18D 5AV5C 4WU9B 2NZDD 5B0YA 5JRGA 2Y2PA 4WU8B 3WTPD 2DF4C 3R45A 3X1UD 2NQBA 2BG1A 1P3PA 3EG5B 3AZLC 5BO0A 3LZ1A 1KX4A 3O62D 3MVDD 4KGCB 3AZND 5B40A 3AV1A 3B0DB 3V9RB 3AN2B 3KXBB 4H9OA 5B31G 4J8VC 4G91C 1S32B 3UTAA 1P3IC 4NFTA 5CPIA 2Y2GA 3RELA 3AZKC 1BH9B 5E5AC 3UT9D 3B6FD 5BT1D 3MGRB 4Z5TC 3AZFA 4YS3B 3P5JB 2AROC 3W96D 3LZ0B 4NE5A 5B1LA 3AZJD 3AYWD 4WU9C 2YFVB 3WA9C 1ZLAA 2Y2HA 3KWQB 5CP6B 5GT3A 3MVDA 1HQ3A 5B32D 3W99D 4YM6D 2BYMA 3REJA 5GXQA 4KGCC 2JCHA 1P3FB 4CSRB
chains in the Genus database with same CATH topology
4UUZA 3AZMD 5B33B 3B0DC 4R8PB 3AN2C 4NE3A 3X1VB 1TZYA 5DNND 5B0YB 4HGAC 4ZBJC 5F99D 5JRGB 1S32C 1F66D 3AZGD 1PZRA 3R45B 2FFFB 3REHA 3AZEC 2NQBB 3WKJA 1P3BD 4YS3C 3MGRC 5AV8B 2IO5B 3LELC 4DQYB 1P3GA 3UTBD 3AV2D 4KUDB 3KUYA 4DRAA 5BO0B 3LZ1B 4J8VA 1KX4B 1P3IA 3LJAB 1M19B 1KX3A 3KSYA 5B40B 1B67A 5AVBD 3KWQC 3AV1B 5CP6C 1H3OA 1R4VA 5B0ZA 4H9OB 3W98D 4JJND 5CPKA 5AV9D 5FUGB 3UTAB 1P34D 5CPIB 3RELB 3WA9A 5B2IA 2VQRA 1BFMA 3AZFB 2F8NK 3MGQD 1P3FC 4AWLB 5DNNA 1P3OC 3WAAB 3EPKA 3C1CC 5B2JD 3TU4D 5B33C 4EO5B 4R8PC 5B1LB 3X1VC 5B31D 5B0YC 5JRGC 1ID3D 2DQNC 5B1MA 2CWEA 1ZLAB 3REID 1Q9CA 4G92B 5AVCA 4H9NA 5GT3B 2NQBC 1P3PC 2IO5C 2F8NG 1HQ3B 3VH5T 4X23D 3LZ1C 1KX4C 3REJB 2BYMB 3AL0C 2ZY3A 5GXQB 3AZEA 1M1AA 5B40C 4UUZB 3AV1C 3MGSD 5AV9A 1TZYB 3UTAC 5CPIC 5AY8A 5B2JA 3RELC 2HIOA 3TU4A 3REHB 5CPJD 3WKJB 3AZFC 1P3GB 3B0BA 1ID3A 4E45A 4H9PA 3KUYB 2F2AC 4EO5C 3A6ND 3REIA 4J8VB 5B1LC 4Z2MG 1P3IB 1KX3B 4ZUXD 3AZKB 3F6TA 4H9RA 3W97A 1U35A 2CV5A 1ZLAC 4X23A 4Z66D 5AV6D 1H3OB 5GT3C 5B0ZB 3MNND 3C1CA 2G5IC 3MVDC 5BNXA 1HQ3C 1P3MD 5GT0A 5CPKB 3AZIA 4XZQD 4M6BA 1P3KD 3REJC 3WA9B 5B2IB 5GXQC 3AZHD 1F1EA 3VH5W 5CPJA 3REKD 3EPJA 1AOID 1TZYC 2Y2KA 5B24D 5B1MB 4XUJD 4QLCD 3REHC 5AVCB 4H9NB 4DRBA 3AFAA 1EQZD 2PYOD 3WKJC 3AZJC 2FJ7A 1P3GC 1KU5A 4Z2MH 1P3AD 3KUYC 3X1TD 2ZY2A 3WTPE 3C1BD 4HGAB 4ZBJB 1P3LD 4LD9A 2ZY5A 1WWIA 3EPLA 1KX3C 3AZEB 5JA4A 1T3UA 1M1AB 5DNMD 4J8UD 1M18A 1KX5D 3LELB 2NZDA 5B0ZC 3MGPD 4UPKA 3WTPA 3X1UA 2F8ND 4J8WD 4J8XD 5CPKC 3X1SD 5AY8B 2HIOB 5B2IC 2L5AA 5AV5D 5DNNC 3O62A 4H9PB 2LY8A 3IP4C 3AZNA 2PYOA 4H9RB 3W97B 5B1MC 1U35B 3NQUA 2RVQC 2CV5B 2RIQA 3AZLD 5AVCC 1P3LA 3C1CB 2Y2JA 1Z2CB 5BNXB 3UT9A 5GT0B 3AZIB 3B6FA 3W96A 1M1AC 2F8NA 2XD1A 3AZJA 5AV9C 1P3PB 3AYWA 3X1SA 5E5AD 5CPJB 4Z5TD 3B6GD 5GSUD 5B2JC 2AROD 5AY8C 3TU4C 2HIOC 5B32A 3AFAB 3W99A 2FJ7B 4WU9D 4YM6A 2HUEB 1ID3C 4WU8D 1A7WA 3REIC 3AZMA 4LD9B 5JA4B 3W97C 1U35C 2CV5C 4X23C 1M18B 2NZDB 4H9SC 4H9QA 5F99A 1F66A 3WTPB 3AZGA 4KGCD 2JSSA 3X1UB 5GT0C 1P3BA 3AZIC 1N1JA 3AN2D 3KXBD 3UTBA 4KHAA 3AV2A 2W8SA 3O62B 3H0MC 1S32D 3B6GA 5GSUA 3MVDB 3AZNB 5CPJC 5AVBA 2Y2IA 4YS3D 3MGRD 5C3IB 4WU8A 2Y2QA 3LZ0D 3W98A 3AFAC 1P3LB 4JJNA 1P34A 2FJ7C 1JFIA 2HUEC 3UT9B 3KWQD 3B6FB 5CP6D 3MGQA 4WNNA 4LD9C 3VH6T 3W96B 3EPHA 2F8NB 3AZJB 1M18C 5B31A 3AYWB 2NZDC 3VH5A 3KXBA 3WTPC 3X1UC 1P3FD 1P3OD 5B33D 5BS7A 4R8PD 5B32B 3X1VD 3W99B 1BH8A 5B0YD 5JRGD 4YM6B 4H9SA 3O62C 1HTAA 3AZNC 2NQBD 3VH6A 3AZMB 2PYOC 3MGSA 5AV8D 5C3IC 2YFVA 4KUDD 2Y2MA 3LZ1D 1KX4D 5DNNB 1P3LC 5F99B 4H9QB 1M19D 3LJAD 1F66B 3AZGB 3H0RC 3UT9C 5B40D 3AV1D 1P3BB 3B6FC 5BT1C 1N1JB 3UTBB 4KHAB 3AV2B 3W96C 3A6NA 4CSRA 3UTAD 3B6GB 3AYWC 3X1SC 5CPID 4ZUXA 3RELD 3FDDA 1P3OB 1W2EA 3B0CT 5AVBB 3AZFD 4Z66A 5AV6A 3WAAD 3MNNA 3VH6W 3W98B 2G5HC 5B32C 1P3MA 5B1LD 4JJNB 3W99C 5AV9B 4XZQA 2ZM5A 1P34B 1P3KA 3H0LC 5AV8A 4YM6C 1JFIB 1ZLAD 4KUDA 2BYKA 3AZHA 3MGQB 4WNNB 5GT3D 3AZMC 5B2JB 3TU4B 3LJAA 1M19A 1HQ3D 1TAFA 3REKA 5B31B 5KDMA 5B24A 3REJD 1AOIA 1ID3B 5F99C 5G49A 1F66C 5GXQD 3AZGC 4XUJA 4QLCA 3REIB 1P3BC 1EQZA 5FUGA 3A1KA 2Y2LA 3UTBC 3AV2C 1P3AA 4X23B 3X1TA 1BH8B 3C1BA 1TZYD 2ZY4A 3WAAA 3B6GC 5GSUC 3KFUG 3REHD 3WKJD 5AVBC 5DNMA 3MGSB 4J8UA 1KX5A 1P3GD 3MGPA 4WU8C 3KUYD 3W98C 4J8VD 4J8WA 4J8XA 4JJNC 1P34C 1P3ID 1KX3D 1ULYA 2JE5A 3AZKD 3B0CW 4WZSB 5AV5A 3MGQC 5B0ZD 3A6NB 2YFWA 5CPKD 5B31C 4ZUXB 3WA9D 3KXBC 5B2ID 5BNVA 3AZLA 4Z66B 5AV6B 2UWXA 3MNNB 5BS7C 2XD5A 1P3MB 4CAYA 1P3KB 3A1IA 4XZQB 5CHLB 5B1MD 3NQJA 2RVQD 3LZ0C 2BYKB 3AZHB 5AVCD 3MGSC 3AZKA 1TAFB 5E5AA 3REKB 4Z5TA 5KDMB 5B24B 1AOIB 5G49B 2AROA 4XUJB 4QLCB 3AZED 1M1AD 2PYOB 1EQZB 3LELD 4WU9A 3NQUB 1P3AB 4WJ3C 3X1TB 3A6NC 3C1BB 1B6WA 2Y2OA 5AY8D 4ZUXC 2HIOD 5DNMB 4J8UB 1KX5B 4Z66C 5AV6C 2Y2NA 3MNNC 3MGPB 4KGCA 4J8WB 2J8PA 1P3MC 4J8XB 1P3KC 4XZQC 3X1SB 5AV8C 3V9RA 3AN2A 3W97D 1U35D 2CV5D 4E44A 4KUDC 3AZHC 5AV5B 4WV4B 3C1CD 1S32A 1M19C 3LJAC 1BH9A 2YFWB 5GT0D 3REKC 1WWSA 3AZID 3MGRA 4YS3A 1AOIC 5B24C 5B32G 3LELA 5BNVB 4QLCC 4XUJC 3LZ0A 3AZLB 1EQZC 1P3PD 1P3AC 3KWQA 4CAYB 3X1TC 3C1BC 5CP6A 4AWLC 3WAAC 3NQJB 3AFAD 4G91B 5DNMC 2FJ7D 4J8UC 1KX5C 5E5AB 3MGPC 2F8NH 4Z5TB 4J8WC 4G92C 1P3FA 1P3OA 4J8XC 4LD9D 5GSUB 5B33A 2AROB 4NE6A 4R8PA 3X1VA 1M18D 5AV5C 4WU9B 2NZDD 5B0YA 5JRGA 2Y2PA 4WU8B 3WTPD 2DF4C 3R45A 3X1UD 2NQBA 2BG1A 1P3PA 3EG5B 3AZLC 5BO0A 3LZ1A 1KX4A 3O62D 3MVDD 4KGCB 3AZND 5B40A 3AV1A 3B0DB 3V9RB 3AN2B 3KXBB 4H9OA 5B31G 4J8VC 4G91C 1S32B 3UTAA 1P3IC 4NFTA 5CPIA 2Y2GA 3RELA 3AZKC 1BH9B 5E5AC 3UT9D 3B6FD 5BT1D 3MGRB 4Z5TC 3AZFA 4YS3B 3P5JB 2AROC 3W96D 3LZ0B 4NE5A 5B1LA 3AZJD 3AYWD 4WU9C 2YFVB 3WA9C 1ZLAA 2Y2HA 3KWQB 5CP6B 5GT3A 3MVDA 1HQ3A 5B32D 3W99D 4YM6D 2BYMA 3REJA 5GXQA 4KGCC 2JCHA 1P3FB 4CSRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ A;  3AZM D;  5B33 B;  3B0D C;  4R8P B;  3AN2 C;  4NE3 A;  3X1V B;  1TZY A;  5DNN D;  5B0Y B;  4HGA C;  4ZBJ C;  5F99 D;  5JRG B;  1S32 C;  1F66 D;  3AZG D;  3R45 B;  3REH A;  3AZE C;  2NQB B;  3WKJ A;  1P3B D;  4YS3 C;  3MGR C;  5AV8 B;  2IO5 B;  3LEL C;  1P3G A;  3UTB D;  3AV2 D;  4KUD B;  3KUY A;  4DRA A;  5BO0 B;  3LZ1 B;  4J8V A;  1KX4 B;  1P3I A;  3LJA B;  1M19 B;  1KX3 A;  3KSY A;  5B40 B;  1B67 A;  5AVB D;  3KWQ C;  3AV1 B;  5CP6 C;  1H3O A;  1R4V A;  5B0Z A;  4H9O B;  3W98 D;  4JJN D;  5CPK A;  5AV9 D;  5FUG B;  3UTA B;  1P34 D;  5CPI B;  3REL B;  3WA9 A;  5B2I A;  1BFM A;  3AZF B;  2F8N K;  3MGQ D;  1P3F C;  4AWL B;  5DNN A;  1P3O C;  3WAA B;  3C1C C;  5B2J D;  3TU4 D;  5B33 C;  4EO5 B;  4R8P C;  5B1L B;  3X1V C;  5B31 D;  5B0Y C;  5JRG C;  1ID3 D;  5B1M A;  2CWE A;  1ZLA B;  3REI D;  1Q9C A;  4G92 B;  5AVC A;  4H9N A;  5GT3 B;  2NQB C;  1P3P C;  2IO5 C;  2F8N G;  1HQ3 B;  3VH5 T;  4X23 D;  3LZ1 C;  1KX4 C;  3REJ B;  2BYM B;  5GXQ B;  3AZE A;  1M1A A;  5B40 C;  4UUZ B;  3AV1 C;  3MGS D;  5AV9 A;  1TZY B;  3UTA C;  5CPI C;  5AY8 A;  5B2J A;  3REL C;  2HIO A;  3TU4 A;  3REH B;  5CPJ D;  3WKJ B;  3AZF C;  1P3G B;  3B0B A;  1ID3 A;  4E45 A;  4H9P A;  3KUY B;  4EO5 C;  3A6N D;  3REI A;  4J8V B;  5B1L C;  4Z2M G;  1P3I B;  1KX3 B;  4ZUX D;  3AZK B;  4H9R A;  3W97 A;  1U35 A;  2CV5 A;  1ZLA C;  4X23 A;  4Z66 D;  5AV6 D;  1H3O B;  5GT3 C;  5B0Z B;  3MNN D;  3C1C A;  3MVD C;  5BNX A;  1HQ3 C;  1P3M D;  5GT0 A;  5CPK B;  3AZI A;  4XZQ D;  4M6B A;  1P3K D;  3REJ C;  3WA9 B;  5B2I B;  5GXQ C;  3AZH D;  1F1E A;  3VH5 W;  5CPJ A;  3REK D;  1AOI D;  1TZY C;  5B24 D;  5B1M B;  4XUJ D;  4QLC D;  3REH C;  5AVC B;  4H9N B;  4DRB A;  3AFA A;  1EQZ D;  2PYO D;  3WKJ C;  3AZJ C;  2FJ7 A;  1P3G C;  1KU5 A;  4Z2M H;  1P3A D;  3KUY C;  3X1T D;  3C1B D;  3WTP E;  4HGA B;  4ZBJ B;  1P3L D;  4LD9 A;  1KX3 C;  1WWI A;  3AZE B;  5JA4 A;  1M1A B;  5DNM D;  4J8U D;  1M18 A;  1KX5 D;  3LEL B;  2NZD A;  5B0Z C;  3MGP D;  3WTP A;  3X1U A;  2F8N D;  4J8W D;  4J8X D;  5CPK C;  3X1S D;  5AY8 B;  2HIO B;  5B2I C;  2L5A A;  5AV5 D;  5DNN C;  3O62 A;  4H9P B;  2LY8 A;  3AZN A;  2PYO A;  4H9R B;  3W97 B;  5B1M C;  1U35 B;  3NQU A;  2RVQ C;  2CV5 B;  3AZL D;  5AVC C;  1P3L A;  3C1C B;  5BNX B;  3UT9 A;  5GT0 B;  3AZI B;  3B6F A;  3W96 A;  1M1A C;  2F8N A;  3AZJ A;  5AV9 C;  1P3P B;  3AYW A;  3X1S A;  5E5A D;  5CPJ B;  4Z5T D;  3B6G D;  5GSU D;  5B2J C;  2ARO D;  5AY8 C;  3TU4 C;  2HIO C;  5B32 A;  3AFA B;  3W99 A;  2FJ7 B;  4WU9 D;  4YM6 A;  2HUE B;  1ID3 C;  4WU8 D;  1A7W A;  3REI C;  3AZM A;  4LD9 B;  5JA4 B;  3W97 C;  1U35 C;  2CV5 C;  4X23 C;  1M18 B;  2NZD B;  4H9S C;  4H9Q A;  5F99 A;  1F66 A;  3WTP B;  3AZG A;  4KGC D;  2JSS A;  3X1U B;  5GT0 C;  1P3B A;  3AZI C;  1N1J A;  3AN2 D;  3KXB D;  3UTB A;  4KHA A;  3AV2 A;  3O62 B;  1S32 D;  3B6G A;  5GSU A;  3MVD B;  3AZN B;  5CPJ C;  5AVB A;  4YS3 D;  3MGR D;  5C3I B;  4WU8 A;  3LZ0 D;  3W98 A;  3AFA C;  1P3L B;  4JJN A;  1P34 A;  2FJ7 C;  1JFI A;  2HUE C;  3UT9 B;  3KWQ D;  3B6F B;  5CP6 D;  3MGQ A;  4WNN A;  4LD9 C;  3VH6 T;  3W96 B;  2F8N B;  3AZJ B;  1M18 C;  5B31 A;  3AYW B;  2NZD C;  3VH5 A;  3KXB A;  3WTP C;  3X1U C;  1P3F D;  1P3O D;  5B33 D;  5BS7 A;  4R8P D;  5B32 B;  3X1V D;  3W99 B;  1BH8 A;  5B0Y D;  5JRG D;  4YM6 B;  4H9S A;  3O62 C;  1HTA A;  3AZN C;  2NQB D;  3VH6 A;  3AZM B;  2PYO C;  3MGS A;  5AV8 D;  5C3I C;  2YFV A;  4KUD D;  3LZ1 D;  1KX4 D;  5DNN B;  1P3L C;  5F99 B;  4H9Q B;  1M19 D;  3LJA D;  1F66 B;  3AZG B;  3UT9 C;  5B40 D;  3AV1 D;  1P3B B;  3B6F C;  5BT1 C;  1N1J B;  3UTB B;  4KHA B;  3AV2 B;  3W96 C;  3A6N A;  4CSR A;  3UTA D;  3B6G B;  3AYW C;  3X1S C;  5CPI D;  4ZUX A;  3REL D;  1P3O B;  3B0C T;  5AVB B;  3AZF D;  4Z66 A;  5AV6 A;  3WAA D;  3MNN A;  3VH6 W;  3W98 B;  5B32 C;  1P3M A;  5B1L D;  4JJN B;  3W99 C;  5AV9 B;  4XZQ A;  1P34 B;  1P3K A;  5AV8 A;  4YM6 C;  1JFI B;  1ZLA D;  4KUD A;  2BYK A;  3AZH A;  3MGQ B;  4WNN B;  5GT3 D;  3AZM C;  5B2J B;  3TU4 B;  3LJA A;  1M19 A;  1HQ3 D;  1TAF A;  3REK A;  5B31 B;  5KDM A;  5B24 A;  3REJ D;  1AOI A;  1ID3 B;  5F99 C;  5G49 A;  1F66 C;  5GXQ D;  3AZG C;  4XUJ A;  4QLC A;  3REI B;  1P3B C;  1EQZ A;  5FUG A;  3UTB C;  3AV2 C;  1P3A A;  4X23 B;  3X1T A;  1BH8 B;  3C1B A;  1TZY D;  3WAA A;  3B6G C;  5GSU C;  3REH D;  3WKJ D;  5AVB C;  5DNM A;  3MGS B;  4J8U A;  1KX5 A;  1P3G D;  3MGP A;  4WU8 C;  3KUY D;  3W98 C;  4J8V D;  4J8W A;  4J8X A;  4JJN C;  1P34 C;  1P3I D;  1KX3 D;  1ULY A;  3AZK D;  3B0C W;  4WZS B;  5AV5 A;  3MGQ C;  5B0Z D;  3A6N B;  2YFW A;  5CPK D;  5B31 C;  4ZUX B;  3WA9 D;  3KXB C;  5B2I D;  5BNV A;  3AZL A;  4Z66 B;  5AV6 B;  3MNN B;  5BS7 C;  1P3M B;  4CAY A;  1P3K B;  4XZQ B;  5CHL B;  5B1M D;  3NQJ A;  2RVQ D;  3LZ0 C;  2BYK B;  3AZH B;  5AVC D;  3MGS C;  3AZK A;  1TAF B;  5E5A A;  3REK B;  4Z5T A;  5KDM B;  5B24 B;  1AOI B;  5G49 B;  2ARO A;  4XUJ B;  4QLC B;  3AZE D;  1M1A D;  2PYO B;  1EQZ B;  3LEL D;  4WU9 A;  3NQU B;  1P3A B;  3X1T B;  3A6N C;  3C1B B;  1B6W A;  5AY8 D;  4ZUX C;  2HIO D;  5DNM B;  4J8U B;  1KX5 B;  4Z66 C;  5AV6 C;  3MNN C;  3MGP B;  4KGC A;  4J8W B;  1P3M C;  4J8X B;  1P3K C;  4XZQ C;  3X1S B;  5AV8 C;  3V9R A;  3AN2 A;  3W97 D;  1U35 D;  2CV5 D;  4E44 A;  4KUD C;  3AZH C;  5AV5 B;  4WV4 B;  3C1C D;  1S32 A;  1M19 C;  3LJA C;  2YFW B;  1BH9 A;  5GT0 D;  3REK C;  1WWS A;  3AZI D;  3MGR A;  4YS3 A;  1AOI C;  5B24 C;  5B32 G;  3LEL A;  5BNV B;  4QLC C;  4XUJ C;  3LZ0 A;  3AZL B;  1EQZ C;  1P3P D;  1P3A C;  3KWQ A;  4CAY B;  3X1T C;  3C1B C;  5CP6 A;  4AWL C;  3WAA C;  3NQJ B;  3AFA D;  4G91 B;  5DNM C;  2FJ7 D;  4J8U C;  1KX5 C;  5E5A B;  3MGP C;  2F8N H;  4Z5T B;  4J8W C;  4G92 C;  1P3F A;  1P3O A;  4J8X C;  4LD9 D;  5GSU B;  5B33 A;  2ARO B;  4NE6 A;  4R8P A;  3X1V A;  1M18 D;  5AV5 C;  4WU9 B;  2NZD D;  5B0Y A;  5JRG A;  4WU8 B;  3WTP D;  3R45 A;  3X1U D;  2NQB A;  1P3P A;  3AZL C;  5BO0 A;  3LZ1 A;  1KX4 A;  3O62 D;  3MVD D;  4KGC B;  3AZN D;  5B40 A;  3AV1 A;  3B0D B;  3V9R B;  3AN2 B;  3KXB B;  4H9O A;  5B31 G;  4J8V C;  4G91 C;  1S32 B;  3UTA A;  1P3I C;  4NFT A;  5CPI A;  3REL A;  3AZK C;  1BH9 B;  5E5A C;  3UT9 D;  3B6F D;  5BT1 D;  3MGR B;  4Z5T C;  3AZF A;  4YS3 B;  2ARO C;  3W96 D;  3LZ0 B;  4NE5 A;  5B1L A;  3AZJ D;  3AYW D;  4WU9 C;  2YFV B;  3WA9 C;  1ZLA A;  3KWQ B;  5CP6 B;  5GT3 A;  3MVD A;  1HQ3 A;  5B32 D;  3W99 D;  4YM6 D;  2BYM A;  3REJ A;  5GXQ A;  4KGC C;  1P3F B;  4CSR B; 
#chains in the Genus database with same CATH topology
 4UUZ A;  3AZM D;  5B33 B;  3B0D C;  4R8P B;  3AN2 C;  4NE3 A;  3X1V B;  1TZY A;  5DNN D;  5B0Y B;  4HGA C;  4ZBJ C;  5F99 D;  5JRG B;  1S32 C;  1F66 D;  3AZG D;  1PZR A;  3R45 B;  2FFF B;  3REH A;  3AZE C;  2NQB B;  3WKJ A;  1P3B D;  4YS3 C;  3MGR C;  5AV8 B;  2IO5 B;  3LEL C;  4DQY B;  1P3G A;  3UTB D;  3AV2 D;  4KUD B;  3KUY A;  4DRA A;  5BO0 B;  3LZ1 B;  4J8V A;  1KX4 B;  1P3I A;  3LJA B;  1M19 B;  1KX3 A;  3KSY A;  5B40 B;  1B67 A;  5AVB D;  3KWQ C;  3AV1 B;  5CP6 C;  1H3O A;  1R4V A;  5B0Z A;  4H9O B;  3W98 D;  4JJN D;  5CPK A;  5AV9 D;  5FUG B;  3UTA B;  1P34 D;  5CPI B;  3REL B;  3WA9 A;  5B2I A;  2VQR A;  1BFM A;  3AZF B;  2F8N K;  3MGQ D;  1P3F C;  4AWL B;  5DNN A;  1P3O C;  3WAA B;  3EPK A;  3C1C C;  5B2J D;  3TU4 D;  5B33 C;  4EO5 B;  4R8P C;  5B1L B;  3X1V C;  5B31 D;  5B0Y C;  5JRG C;  1ID3 D;  2DQN C;  5B1M A;  2CWE A;  1ZLA B;  3REI D;  1Q9C A;  4G92 B;  5AVC A;  4H9N A;  5GT3 B;  2NQB C;  1P3P C;  2IO5 C;  2F8N G;  1HQ3 B;  3VH5 T;  4X23 D;  3LZ1 C;  1KX4 C;  3REJ B;  2BYM B;  3AL0 C;  2ZY3 A;  5GXQ B;  3AZE A;  1M1A A;  5B40 C;  4UUZ B;  3AV1 C;  3MGS D;  5AV9 A;  1TZY B;  3UTA C;  5CPI C;  5AY8 A;  5B2J A;  3REL C;  2HIO A;  3TU4 A;  3REH B;  5CPJ D;  3WKJ B;  3AZF C;  1P3G B;  3B0B A;  1ID3 A;  4E45 A;  4H9P A;  3KUY B;  2F2A C;  4EO5 C;  3A6N D;  3REI A;  4J8V B;  5B1L C;  4Z2M G;  1P3I B;  1KX3 B;  4ZUX D;  3AZK B;  3F6T A;  4H9R A;  3W97 A;  1U35 A;  2CV5 A;  1ZLA C;  4X23 A;  4Z66 D;  5AV6 D;  1H3O B;  5GT3 C;  5B0Z B;  3MNN D;  3C1C A;  2G5I C;  3MVD C;  5BNX A;  1HQ3 C;  1P3M D;  5GT0 A;  5CPK B;  3AZI A;  4XZQ D;  4M6B A;  1P3K D;  3REJ C;  3WA9 B;  5B2I B;  5GXQ C;  3AZH D;  1F1E A;  3VH5 W;  5CPJ A;  3REK D;  3EPJ A;  1AOI D;  1TZY C;  2Y2K A;  5B24 D;  5B1M B;  4XUJ D;  4QLC D;  3REH C;  5AVC B;  4H9N B;  4DRB A;  3AFA A;  1EQZ D;  2PYO D;  3WKJ C;  3AZJ C;  2FJ7 A;  1P3G C;  1KU5 A;  4Z2M H;  1P3A D;  3KUY C;  3X1T D;  2ZY2 A;  3WTP E;  3C1B D;  4HGA B;  4ZBJ B;  1P3L D;  4LD9 A;  2ZY5 A;  1WWI A;  3EPL A;  1KX3 C;  3AZE B;  5JA4 A;  1T3U A;  1M1A B;  5DNM D;  4J8U D;  1M18 A;  1KX5 D;  3LEL B;  2NZD A;  5B0Z C;  3MGP D;  4UPK A;  3WTP A;  3X1U A;  2F8N D;  4J8W D;  4J8X D;  5CPK C;  3X1S D;  5AY8 B;  2HIO B;  5B2I C;  2L5A A;  5AV5 D;  5DNN C;  3O62 A;  4H9P B;  2LY8 A;  3IP4 C;  3AZN A;  2PYO A;  4H9R B;  3W97 B;  5B1M C;  1U35 B;  3NQU A;  2RVQ C;  2CV5 B;  2RIQ A;  3AZL D;  5AVC C;  1P3L A;  3C1C B;  2Y2J A;  1Z2C B;  5BNX B;  3UT9 A;  5GT0 B;  3AZI B;  3B6F A;  3W96 A;  1M1A C;  2F8N A;  2XD1 A;  3AZJ A;  5AV9 C;  1P3P B;  3AYW A;  3X1S A;  5E5A D;  5CPJ B;  4Z5T D;  3B6G D;  5GSU D;  5B2J C;  2ARO D;  5AY8 C;  3TU4 C;  2HIO C;  5B32 A;  3AFA B;  3W99 A;  2FJ7 B;  4WU9 D;  4YM6 A;  2HUE B;  1ID3 C;  4WU8 D;  1A7W A;  3REI C;  3AZM A;  4LD9 B;  5JA4 B;  3W97 C;  1U35 C;  2CV5 C;  4X23 C;  1M18 B;  2NZD B;  4H9S C;  4H9Q A;  5F99 A;  1F66 A;  3WTP B;  3AZG A;  4KGC D;  2JSS A;  3X1U B;  5GT0 C;  1P3B A;  3AZI C;  1N1J A;  3AN2 D;  3KXB D;  3UTB A;  4KHA A;  3AV2 A;  2W8S A;  3O62 B;  3H0M C;  1S32 D;  3B6G A;  5GSU A;  3MVD B;  3AZN B;  5CPJ C;  5AVB A;  2Y2I A;  4YS3 D;  3MGR D;  5C3I B;  4WU8 A;  2Y2Q A;  3LZ0 D;  3W98 A;  3AFA C;  1P3L B;  4JJN A;  1P34 A;  2FJ7 C;  1JFI A;  2HUE C;  3UT9 B;  3KWQ D;  3B6F B;  5CP6 D;  3MGQ A;  4WNN A;  4LD9 C;  3VH6 T;  3W96 B;  3EPH A;  2F8N B;  3AZJ B;  1M18 C;  5B31 A;  3AYW B;  2NZD C;  3VH5 A;  3KXB A;  3WTP C;  3X1U C;  1P3F D;  1P3O D;  5B33 D;  5BS7 A;  4R8P D;  5B32 B;  3X1V D;  3W99 B;  1BH8 A;  5B0Y D;  5JRG D;  4YM6 B;  4H9S A;  3O62 C;  1HTA A;  3AZN C;  2NQB D;  3VH6 A;  3AZM B;  2PYO C;  3MGS A;  5AV8 D;  5C3I C;  2YFV A;  4KUD D;  2Y2M A;  3LZ1 D;  1KX4 D;  5DNN B;  1P3L C;  5F99 B;  4H9Q B;  1M19 D;  3LJA D;  1F66 B;  3AZG B;  3H0R C;  3UT9 C;  5B40 D;  3AV1 D;  1P3B B;  3B6F C;  5BT1 C;  1N1J B;  3UTB B;  4KHA B;  3AV2 B;  3W96 C;  3A6N A;  4CSR A;  3UTA D;  3B6G B;  3AYW C;  3X1S C;  5CPI D;  4ZUX A;  3REL D;  3FDD A;  1P3O B;  1W2E A;  3B0C T;  5AVB B;  3AZF D;  4Z66 A;  5AV6 A;  3WAA D;  3MNN A;  3VH6 W;  3W98 B;  2G5H C;  5B32 C;  1P3M A;  5B1L D;  4JJN B;  3W99 C;  5AV9 B;  4XZQ A;  2ZM5 A;  1P34 B;  1P3K A;  3H0L C;  5AV8 A;  4YM6 C;  1JFI B;  1ZLA D;  4KUD A;  2BYK A;  3AZH A;  3MGQ B;  4WNN B;  5GT3 D;  3AZM C;  5B2J B;  3TU4 B;  3LJA A;  1M19 A;  1HQ3 D;  1TAF A;  3REK A;  5B31 B;  5KDM A;  5B24 A;  3REJ D;  1AOI A;  1ID3 B;  5F99 C;  5G49 A;  1F66 C;  5GXQ D;  3AZG C;  4XUJ A;  4QLC A;  3REI B;  1P3B C;  1EQZ A;  5FUG A;  3A1K A;  2Y2L A;  3UTB C;  3AV2 C;  1P3A A;  4X23 B;  3X1T A;  1BH8 B;  3C1B A;  1TZY D;  2ZY4 A;  3WAA A;  3B6G C;  5GSU C;  3KFU G;  3REH D;  3WKJ D;  5AVB C;  5DNM A;  3MGS B;  4J8U A;  1KX5 A;  1P3G D;  3MGP A;  4WU8 C;  3KUY D;  3W98 C;  4J8V D;  4J8W A;  4J8X A;  4JJN C;  1P34 C;  1P3I D;  1KX3 D;  1ULY A;  2JE5 A;  3AZK D;  3B0C W;  4WZS B;  5AV5 A;  3MGQ C;  5B0Z D;  3A6N B;  2YFW A;  5CPK D;  5B31 C;  4ZUX B;  3WA9 D;  3KXB C;  5B2I D;  5BNV A;  3AZL A;  4Z66 B;  5AV6 B;  2UWX A;  3MNN B;  5BS7 C;  2XD5 A;  1P3M B;  4CAY A;  1P3K B;  3A1I A;  4XZQ B;  5CHL B;  5B1M D;  3NQJ A;  2RVQ D;  3LZ0 C;  2BYK B;  3AZH B;  5AVC D;  3MGS C;  3AZK A;  1TAF B;  5E5A A;  3REK B;  4Z5T A;  5KDM B;  5B24 B;  1AOI B;  5G49 B;  2ARO A;  4XUJ B;  4QLC B;  3AZE D;  1M1A D;  2PYO B;  1EQZ B;  3LEL D;  4WU9 A;  3NQU B;  1P3A B;  4WJ3 C;  3X1T B;  3A6N C;  3C1B B;  1B6W A;  2Y2O A;  5AY8 D;  4ZUX C;  2HIO D;  5DNM B;  4J8U B;  1KX5 B;  4Z66 C;  5AV6 C;  2Y2N A;  3MNN C;  3MGP B;  4KGC A;  4J8W B;  2J8P A;  1P3M C;  4J8X B;  1P3K C;  4XZQ C;  3X1S B;  5AV8 C;  3V9R A;  3AN2 A;  3W97 D;  1U35 D;  2CV5 D;  4E44 A;  4KUD C;  3AZH C;  5AV5 B;  4WV4 B;  3C1C D;  1S32 A;  1M19 C;  3LJA C;  1BH9 A;  2YFW B;  5GT0 D;  3REK C;  1WWS A;  3AZI D;  3MGR A;  4YS3 A;  1AOI C;  5B24 C;  5B32 G;  3LEL A;  5BNV B;  4QLC C;  4XUJ C;  3LZ0 A;  3AZL B;  1EQZ C;  1P3P D;  1P3A C;  3KWQ A;  4CAY B;  3X1T C;  3C1B C;  5CP6 A;  4AWL C;  3WAA C;  3NQJ B;  3AFA D;  4G91 B;  5DNM C;  2FJ7 D;  4J8U C;  1KX5 C;  5E5A B;  3MGP C;  2F8N H;  4Z5T B;  4J8W C;  4G92 C;  1P3F A;  1P3O A;  4J8X C;  4LD9 D;  5GSU B;  5B33 A;  2ARO B;  4NE6 A;  4R8P A;  3X1V A;  1M18 D;  5AV5 C;  4WU9 B;  2NZD D;  5B0Y A;  5JRG A;  2Y2P A;  4WU8 B;  3WTP D;  2DF4 C;  3R45 A;  3X1U D;  2NQB A;  2BG1 A;  1P3P A;  3EG5 B;  3AZL C;  5BO0 A;  3LZ1 A;  1KX4 A;  3O62 D;  3MVD D;  4KGC B;  3AZN D;  5B40 A;  3AV1 A;  3B0D B;  3V9R B;  3AN2 B;  3KXB B;  4H9O A;  5B31 G;  4J8V C;  4G91 C;  1S32 B;  3UTA A;  1P3I C;  4NFT A;  5CPI A;  2Y2G A;  3REL A;  3AZK C;  1BH9 B;  5E5A C;  3UT9 D;  3B6F D;  5BT1 D;  3MGR B;  4Z5T C;  3AZF A;  4YS3 B;  3P5J B;  2ARO C;  3W96 D;  3LZ0 B;  4NE5 A;  5B1L A;  3AZJ D;  3AYW D;  4WU9 C;  2YFV B;  3WA9 C;  1ZLA A;  2Y2H A;  3KWQ B;  5CP6 B;  5GT3 A;  3MVD A;  1HQ3 A;  5B32 D;  3W99 D;  4YM6 D;  2BYM A;  3REJ A;  5GXQ A;  4KGC C;  2JCH A;  1P3F B;  4CSR B; 
#chains in the Genus database with same CATH homology
 4UUZ A;  3AZM D;  5B33 B;  3B0D C;  4R8P B;  3AN2 C;  4NE3 A;  3X1V B;  1TZY A;  5DNN D;  5B0Y B;  4HGA C;  4ZBJ C;  5F99 D;  5JRG B;  1S32 C;  1F66 D;  3AZG D;  1PZR A;  3R45 B;  2FFF B;  3REH A;  3AZE C;  2NQB B;  3WKJ A;  1P3B D;  4YS3 C;  3MGR C;  5AV8 B;  2IO5 B;  3LEL C;  4DQY B;  1P3G A;  3UTB D;  3AV2 D;  4KUD B;  3KUY A;  4DRA A;  5BO0 B;  3LZ1 B;  4J8V A;  1KX4 B;  1P3I A;  3LJA B;  1M19 B;  1KX3 A;  3KSY A;  5B40 B;  1B67 A;  5AVB D;  3KWQ C;  3AV1 B;  5CP6 C;  1H3O A;  1R4V A;  5B0Z A;  4H9O B;  3W98 D;  4JJN D;  5CPK A;  5AV9 D;  5FUG B;  3UTA B;  1P34 D;  5CPI B;  3REL B;  3WA9 A;  5B2I A;  2VQR A;  1BFM A;  3AZF B;  2F8N K;  3MGQ D;  1P3F C;  4AWL B;  5DNN A;  1P3O C;  3WAA B;  3EPK A;  3C1C C;  5B2J D;  3TU4 D;  5B33 C;  4EO5 B;  4R8P C;  5B1L B;  3X1V C;  5B31 D;  5B0Y C;  5JRG C;  1ID3 D;  2DQN C;  5B1M A;  2CWE A;  1ZLA B;  3REI D;  1Q9C A;  4G92 B;  5AVC A;  4H9N A;  5GT3 B;  2NQB C;  1P3P C;  2IO5 C;  2F8N G;  1HQ3 B;  3VH5 T;  4X23 D;  3LZ1 C;  1KX4 C;  3REJ B;  2BYM B;  3AL0 C;  2ZY3 A;  5GXQ B;  3AZE A;  1M1A A;  5B40 C;  4UUZ B;  3AV1 C;  3MGS D;  5AV9 A;  1TZY B;  3UTA C;  5CPI C;  5AY8 A;  5B2J A;  3REL C;  2HIO A;  3TU4 A;  3REH B;  5CPJ D;  3WKJ B;  3AZF C;  1P3G B;  3B0B A;  1ID3 A;  4E45 A;  4H9P A;  3KUY B;  2F2A C;  4EO5 C;  3A6N D;  3REI A;  4J8V B;  5B1L C;  4Z2M G;  1P3I B;  1KX3 B;  4ZUX D;  3AZK B;  3F6T A;  4H9R A;  3W97 A;  1U35 A;  2CV5 A;  1ZLA C;  4X23 A;  4Z66 D;  5AV6 D;  1H3O B;  5GT3 C;  5B0Z B;  3MNN D;  3C1C A;  2G5I C;  3MVD C;  5BNX A;  1HQ3 C;  1P3M D;  5GT0 A;  5CPK B;  3AZI A;  4XZQ D;  4M6B A;  1P3K D;  3REJ C;  3WA9 B;  5B2I B;  5GXQ C;  3AZH D;  1F1E A;  3VH5 W;  5CPJ A;  3REK D;  3EPJ A;  1AOI D;  1TZY C;  2Y2K A;  5B24 D;  5B1M B;  4XUJ D;  4QLC D;  3REH C;  5AVC B;  4H9N B;  4DRB A;  3AFA A;  1EQZ D;  2PYO D;  3WKJ C;  3AZJ C;  2FJ7 A;  1P3G C;  1KU5 A;  4Z2M H;  1P3A D;  3KUY C;  3X1T D;  2ZY2 A;  3WTP E;  3C1B D;  4HGA B;  4ZBJ B;  1P3L D;  4LD9 A;  2ZY5 A;  1WWI A;  3EPL A;  1KX3 C;  3AZE B;  5JA4 A;  1T3U A;  1M1A B;  5DNM D;  4J8U D;  1M18 A;  1KX5 D;  3LEL B;  2NZD A;  5B0Z C;  3MGP D;  4UPK A;  3WTP A;  3X1U A;  2F8N D;  4J8W D;  4J8X D;  5CPK C;  3X1S D;  5AY8 B;  2HIO B;  5B2I C;  2L5A A;  5AV5 D;  5DNN C;  3O62 A;  4H9P B;  2LY8 A;  3IP4 C;  3AZN A;  2PYO A;  4H9R B;  3W97 B;  5B1M C;  1U35 B;  3NQU A;  2RVQ C;  2CV5 B;  2RIQ A;  3AZL D;  5AVC C;  1P3L A;  3C1C B;  2Y2J A;  1Z2C B;  5BNX B;  3UT9 A;  5GT0 B;  3AZI B;  3B6F A;  3W96 A;  1M1A C;  2F8N A;  2XD1 A;  3AZJ A;  5AV9 C;  1P3P B;  3AYW A;  3X1S A;  5E5A D;  5CPJ B;  4Z5T D;  3B6G D;  5GSU D;  5B2J C;  2ARO D;  5AY8 C;  3TU4 C;  2HIO C;  5B32 A;  3AFA B;  3W99 A;  2FJ7 B;  4WU9 D;  4YM6 A;  2HUE B;  1ID3 C;  4WU8 D;  1A7W A;  3REI C;  3AZM A;  4LD9 B;  5JA4 B;  3W97 C;  1U35 C;  2CV5 C;  4X23 C;  1M18 B;  2NZD B;  4H9S C;  4H9Q A;  5F99 A;  1F66 A;  3WTP B;  3AZG A;  4KGC D;  2JSS A;  3X1U B;  5GT0 C;  1P3B A;  3AZI C;  1N1J A;  3AN2 D;  3KXB D;  3UTB A;  4KHA A;  3AV2 A;  2W8S A;  3O62 B;  3H0M C;  1S32 D;  3B6G A;  5GSU A;  3MVD B;  3AZN B;  5CPJ C;  5AVB A;  2Y2I A;  4YS3 D;  3MGR D;  5C3I B;  4WU8 A;  2Y2Q A;  3LZ0 D;  3W98 A;  3AFA C;  1P3L B;  4JJN A;  1P34 A;  2FJ7 C;  1JFI A;  2HUE C;  3UT9 B;  3KWQ D;  3B6F B;  5CP6 D;  3MGQ A;  4WNN A;  4LD9 C;  3VH6 T;  3W96 B;  3EPH A;  2F8N B;  3AZJ B;  1M18 C;  5B31 A;  3AYW B;  2NZD C;  3VH5 A;  3KXB A;  3WTP C;  3X1U C;  1P3F D;  1P3O D;  5B33 D;  5BS7 A;  4R8P D;  5B32 B;  3X1V D;  3W99 B;  1BH8 A;  5B0Y D;  5JRG D;  4YM6 B;  4H9S A;  3O62 C;  1HTA A;  3AZN C;  2NQB D;  3VH6 A;  3AZM B;  2PYO C;  3MGS A;  5AV8 D;  5C3I C;  2YFV A;  4KUD D;  2Y2M A;  3LZ1 D;  1KX4 D;  5DNN B;  1P3L C;  5F99 B;  4H9Q B;  1M19 D;  3LJA D;  1F66 B;  3AZG B;  3H0R C;  3UT9 C;  5B40 D;  3AV1 D;  1P3B B;  3B6F C;  5BT1 C;  1N1J B;  3UTB B;  4KHA B;  3AV2 B;  3W96 C;  3A6N A;  4CSR A;  3UTA D;  3B6G B;  3AYW C;  3X1S C;  5CPI D;  4ZUX A;  3REL D;  3FDD A;  1P3O B;  1W2E A;  3B0C T;  5AVB B;  3AZF D;  4Z66 A;  5AV6 A;  3WAA D;  3MNN A;  3VH6 W;  3W98 B;  2G5H C;  5B32 C;  1P3M A;  5B1L D;  4JJN B;  3W99 C;  5AV9 B;  4XZQ A;  2ZM5 A;  1P34 B;  1P3K A;  3H0L C;  5AV8 A;  4YM6 C;  1JFI B;  1ZLA D;  4KUD A;  2BYK A;  3AZH A;  3MGQ B;  4WNN B;  5GT3 D;  3AZM C;  5B2J B;  3TU4 B;  3LJA A;  1M19 A;  1HQ3 D;  1TAF A;  3REK A;  5B31 B;  5KDM A;  5B24 A;  3REJ D;  1AOI A;  1ID3 B;  5F99 C;  5G49 A;  1F66 C;  5GXQ D;  3AZG C;  4XUJ A;  4QLC A;  3REI B;  1P3B C;  1EQZ A;  5FUG A;  3A1K A;  2Y2L A;  3UTB C;  3AV2 C;  1P3A A;  4X23 B;  3X1T A;  1BH8 B;  3C1B A;  1TZY D;  2ZY4 A;  3WAA A;  3B6G C;  5GSU C;  3KFU G;  3REH D;  3WKJ D;  5AVB C;  5DNM A;  3MGS B;  4J8U A;  1KX5 A;  1P3G D;  3MGP A;  4WU8 C;  3KUY D;  3W98 C;  4J8V D;  4J8W A;  4J8X A;  4JJN C;  1P34 C;  1P3I D;  1KX3 D;  1ULY A;  2JE5 A;  3AZK D;  3B0C W;  4WZS B;  5AV5 A;  3MGQ C;  5B0Z D;  3A6N B;  2YFW A;  5CPK D;  5B31 C;  4ZUX B;  3WA9 D;  3KXB C;  5B2I D;  5BNV A;  3AZL A;  4Z66 B;  5AV6 B;  2UWX A;  3MNN B;  5BS7 C;  2XD5 A;  1P3M B;  4CAY A;  1P3K B;  3A1I A;  4XZQ B;  5CHL B;  5B1M D;  3NQJ A;  2RVQ D;  3LZ0 C;  2BYK B;  3AZH B;  5AVC D;  3MGS C;  3AZK A;  1TAF B;  5E5A A;  3REK B;  4Z5T A;  5KDM B;  5B24 B;  1AOI B;  5G49 B;  2ARO A;  4XUJ B;  4QLC B;  3AZE D;  1M1A D;  2PYO B;  1EQZ B;  3LEL D;  4WU9 A;  3NQU B;  1P3A B;  4WJ3 C;  3X1T B;  3A6N C;  3C1B B;  1B6W A;  2Y2O A;  5AY8 D;  4ZUX C;  2HIO D;  5DNM B;  4J8U B;  1KX5 B;  4Z66 C;  5AV6 C;  2Y2N A;  3MNN C;  3MGP B;  4KGC A;  4J8W B;  2J8P A;  1P3M C;  4J8X B;  1P3K C;  4XZQ C;  3X1S B;  5AV8 C;  3V9R A;  3AN2 A;  3W97 D;  1U35 D;  2CV5 D;  4E44 A;  4KUD C;  3AZH C;  5AV5 B;  4WV4 B;  3C1C D;  1S32 A;  1M19 C;  3LJA C;  1BH9 A;  2YFW B;  5GT0 D;  3REK C;  1WWS A;  3AZI D;  3MGR A;  4YS3 A;  1AOI C;  5B24 C;  5B32 G;  3LEL A;  5BNV B;  4QLC C;  4XUJ C;  3LZ0 A;  3AZL B;  1EQZ C;  1P3P D;  1P3A C;  3KWQ A;  4CAY B;  3X1T C;  3C1B C;  5CP6 A;  4AWL C;  3WAA C;  3NQJ B;  3AFA D;  4G91 B;  5DNM C;  2FJ7 D;  4J8U C;  1KX5 C;  5E5A B;  3MGP C;  2F8N H;  4Z5T B;  4J8W C;  4G92 C;  1P3F A;  1P3O A;  4J8X C;  4LD9 D;  5GSU B;  5B33 A;  2ARO B;  4NE6 A;  4R8P A;  3X1V A;  1M18 D;  5AV5 C;  4WU9 B;  2NZD D;  5B0Y A;  5JRG A;  2Y2P A;  4WU8 B;  3WTP D;  2DF4 C;  3R45 A;  3X1U D;  2NQB A;  2BG1 A;  1P3P A;  3EG5 B;  3AZL C;  5BO0 A;  3LZ1 A;  1KX4 A;  3O62 D;  3MVD D;  4KGC B;  3AZN D;  5B40 A;  3AV1 A;  3B0D B;  3V9R B;  3AN2 B;  3KXB B;  4H9O A;  5B31 G;  4J8V C;  4G91 C;  1S32 B;  3UTA A;  1P3I C;  4NFT A;  5CPI A;  2Y2G A;  3REL A;  3AZK C;  1BH9 B;  5E5A C;  3UT9 D;  3B6F D;  5BT1 D;  3MGR B;  4Z5T C;  3AZF A;  4YS3 B;  3P5J B;  2ARO C;  3W96 D;  3LZ0 B;  4NE5 A;  5B1L A;  3AZJ D;  3AYW D;  4WU9 C;  2YFV B;  3WA9 C;  1ZLA A;  2Y2H A;  3KWQ B;  5CP6 B;  5GT3 A;  3MVD A;  1HQ3 A;  5B32 D;  3W99 D;  4YM6 D;  2BYM A;  3REJ A;  5GXQ A;  4KGC C;  2JCH A;  1P3F B;  4CSR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...