5GSUA

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuA00
3W98D 3VH6A 3AV2A 3UTBD 4J8VC 4H9OA 3AV1A 2BYMA 2PYOA 3KWQC 4EO5C 5GSUC 2AROA 1P34D 4H9SC 3RELA 3AZND 5GXQC 3MGRD 4H9QA 4R8PC 5AV8B 1BH9A 4H9NA 2CV5B 5AVBB 3B6GD 3MGPC 3AYWA 4H9PB 1AOIA 1M1AA 3REKB 3W96D 5G49B 5CPIC 5B24C 1P3LC 2BYKA 5B32C 5AV5B 3AFAD 3MGQD 3C1BA 4G92C 3X1UA 4CSRB 4UUZB 5AV6C 3TU4A 2YFVB 3B6FB 3O62A 3KUYD 2HUEC 5B1MB 4X23C 2NZDB 4QLCB 1KX4C 5B0YC 4KHAA 1KX5B 3UTAB 3AZHD 3LZ0A 5AY8B 5DNNC 1A7WA 3LZ1B 3W99A 4KGCD 1TAFA 1P3FD 3LELA 3KXBC 3UT9D 4YM6B 3AZED 5F99A 1P3OB 4LD9A 1P3KD 5GT0D 3VH6T 3REID 1ID3C 3X1VC 3X1TC 3AZKD 3AZFB 4WU8C 5B0ZD 3REJA 1U35D 1P3MC 3W97C 3W98C 3MNNB 5E5AA 5JA4B 2RVQD 4WZSB 3UTBC 5AV9A 4XUJB 1P34C 5AVCD 2F8NB 3WA9A 3AZNC 3VH5A 4XZQC 3AV2B 1P3AD 3B6GC 2PYOB 3AV1B 3AZJA 2BYMB 1P3PA 4G91C 5CHLB 2AROB 3W96C 5CPJC 2HIOA 3RELB 2YFWA 4YS3D 4WU9C 1BH9B 3AYWB 1AOIB 1M1AB 4CAYA 3AZID 3R45A 3KUYC 2BYKB 5B31G 3WKJA 3X1UB 3VH6W 3TU4B 5AV8D 3B0DB 3O62B 3AZHC 3WAAA 4Z66D 3REKD 3LJAA 1P3FC 5B40B 3MGPD 5AV5D 3LZ0B 5GT0C 3B6FD 3REIC 1TAFB 1P3GB 3B0BA 5B32D 3X1SD 3AZGB 3LELB 2NQBC 3AN2B 1TZYB 3AZKC 4J8VA 4QLCD 1U35C 4LD9B 1HQ3D 2FJ7C 3KWQA 5GSUA 3VH5T 4J8WB 3MGSA 3UTAD 2RVQC 3AZLA 5AY8D 5GXQA 3NQJA 4WNNA 4R8PA 3LZ1D 4KUDA 4Z2MG 1M18A 5CP6D 5AVCC 5E5AB 5CPIA 5B24A 1P3OD 1P3LA 5JRGB 1P3AC 1EQZA 5AV9B 5BT1D 5DNMB 5BNVA 5AV6A 3WA9B 4YS3C 3WTPA 5B2JA 1P3IC 1S32A 4Z5TA 3X1TD 3AZJB 5KDMA 4X23A 4JJND 1KX4A 2IO5C 5B0YA 4WU8D 2F8NH 2HIOB 3W97D 4J8UB 1P3MD 2YFWB 4XUJD 5DNNA 5GT3A 1F1EA 4AWLB 3AZMA 5B33A 5AV8C 2CV5C 5AVBC 3KXBA 3R45B 4Z66C 5CPKA 3REKC 4NE6A 3WTPE 3REHD 4XZQD 5B1LA 3WKJB 1ID3A 5BS7C 3X1VA 5AV5C 3C1CA 5CPJD 1ZLAA 5B2IA 3LJAB 3B6FC 5B31A 4WU9D 3X1SC 4ZBJB 3V9RA 3UTBA 4QLCC 1HQ3C 3TU4D 1P34A 3UTAC 3AZNA 5AY8C 3MGRA 3NQUA 3LZ1C 3B6GA 5CP6C 1P3BD 4J8VB 5B40D 1F66D 5GSUB 3W96A 3AZLB 3MGSB 1P3OC 1N1JA 4J8XD 3KSYA 1M19D 4WNNB 4KUDB 1M18B 5BT1C 3AZGD 3AFAA 3MGQA 1P3GD 3B0CT 4NE5A 3AN2D 1TZYD 3AZFC 4H9RA 5B24B 1KU5A 3KUYA 1JFIA 3A6NB 4NFTA 4NE3A 4J8WD 1EQZB 2NQBD 5B32G 2F8NA 5BNVB 4JJNC 5AV6B 4ZUXB 3MVDB 4XUJC 2FJ7D 3WTPB 5B2JB 1S32B 4Z5TB 5E5AD 4KGCA 1KX3B 5JRGD 1P3FA 3UT9A 2PYOC 3AV1C 5DNMD 3AZEA 5GT3B 3REHC 1P3KA 3RELC 1H3OA 5GT0A 3AZMB 3REIA 5B33B 4H9OB 3KXBB 5BO0A 3AZKA 3AYWC 5CPKB 5B0ZA 1M1AC 4H9QB 1U35A 4J8UD 1P3ID 4H9NB 5B1LB 1ID3B 3C1CB 3X1UC 3TU4C 1ZLAB 5B2IB 5AVCA 5B31B 1BH8A 3B0CW 3O62C 3C1BB 3V9RB 1P3AA 5C3IB 2CV5D 1P3BC 5AVBD 5B40C 1F66C 1WWIA 4J8XC 3MGRB 4YS3A 1M19C 3NQUB 2JSSA 1P3GC 3AZGC 4KHAB 3AN2C 1TZYC 3W96B 1WWSA 3AZIA 3W99B 4LD9C 5B1MD 4J8WC 3AFAB 3MGQB 2NZDD 5F99B 5AV8A 4H9RB 1KX5D 4Z66A 4H9SA 1JFIB 3REKA 5E5AC 3MGSD 5JRGC 3MGPA 3REJB 5DNMC 5AV5A 4YM6D 4UUZA 3B6FA 4KGCB 2L5AA 3X1SA 5B32A 1P3FB 3A6ND 3UT9B 1EQZD 3AZEB 4QLCA 3AZFD 1HQ3A 4ZUXD 4J8UC 1P3KB 1H3OB 5GT0B 3MNND 3MVDD 3REIB 3UTAA 1P3PB 4E44A 1S32D 4Z5TD 4AWLC 5CP6A 1KX3D 5B0ZB 2F8ND 1P3OA 3AV2D 4CAYB 3AV1D 2PYOD 5AVCB 1BH8B 2AROD 3RELD 3LJAC 3VH5W 4DRAA 1ZLAD 5B1LD 2F8NK 3X1TA 3WAAB 3AYWD 4JJNA 1AOID 1HTAA 4WU8A 1M1AD 3W97A 1P3MA 3W98A 4XUJA 5B2ID 5B1MC 5B31D 4HGAB 3C1BD 2NZDC 3X1UD 2IO5B 1KX5C 3AZIB 3O62D 3REHA 3MGSC 3AZLC 4XZQA 2CWEA 4KUDC 1M18C 3KWQB 1B6WA 4EO5B 4YM6C 4Z66B 3LZ0D 5CPJA 5GXQB 3NQJB 4DRBA 3W99D 4R8PB 4WU9A 3A6NC 3MGPB 1EQZC 3LELD 5CPIB 5F99D 4ZUXC 1P3LB 4LD9D 3MVDC 4WV4B 1ULYA 3MNNC 3WTPC 5B32B 3X1SB 4Z2MH 5B2JC 5FUGA 1S32C 4Z5TC 4G92B 1P3BA 1KX3C 5B40A 3AZHA 1HQ3B 3REJD 1F66A 2HUEB 4J8XA 5GT3C 1M19A 5KDMB 4X23B 3AV2C 3AZMC 1KX4B 5B0YB 1P3GA 1B67A 5CP6B 5B33C 5AV9D 3AZGA 2AROC 3AN2A 1TZYA 5DNNB 3WA9D 5CPKC 5B1LC 4J8WA 2NQBA 3AZJD 1P3PD 1AOIC 3C1CC 2FJ7A 2HIOD 1ZLAC 5B2IC 5B31C 3X1VB 3X1TB 3C1BC 5JRGA 4JJNB 5C3IC 4WU8B 3B0DC 1P3MB 3W97B 5DNMA 3W98B 5BNXA 1Q9CA 2F8NG 3MGRC 3UTBB 3WKJD 1P34B 3WAAD 3LZ0C 3AZNB 3REHB 3W99C 4XZQB 3LJAD 4J8UA 1P3IA 3B6GB 3LELC 3AFAC 4G91B 3MGQC 5CPJB 5F99C 1N1JB 4WU9B 2CV5A 5AVBA 4J8VD 3REJC 4H9PA 3KUYB 3KWQD 5GSUD 3AZLD 5G49A 5FUGB 5GXQD 4KGCC 5BS7A 4R8PD 1P3BB 4KUDD 5AV9C 1M18D 3UT9C 3AZHB 1F66B 4CSRA 2LY8A 2YFVA 3WA9C 3AZEC 4J8XB 5CPID 1M19B 5B24D 1P3KC 1P3LD 5B1MA 3AZJC 1P3PC 2NZDA 5AV6D 2HIOC 1KX5A 5B0ZC 3WTPD 5AY8A 4M6BA 5B2JD 5BO0B 3LZ1A 1R4VA 2NQBB 3AZKB 4X23D 1KX4D 1U35B 5B0YD 2FJ7B 4E45A 4YM6A 5DNND 5GT3D 3AZMD 3WKJC 3A6NA 5B33D 1BFMA 3KXBD 3WAAC 3AZFA 5CPKD 5BNXB 4ZUXA 3MVDA 3MNNA 1P3AB 4ZBJC 5JA4A 1ID3D 3X1VD 4HGAC 3C1CD 1KX3A 4YS3B 3AZIC 1P3IB
chains in the Genus database with same CATH superfamily
3W98D 3VH6A 3AV2A 2G5HC 3UTBD 4J8VC 4H9OA 3AV1A 2BYMA 2PYOA 3KWQC 4EO5C 5GSUC 2AROA 1P34D 2W8SA 4H9SC 3RELA 3AZND 5GXQC 3MGRD 4H9QA 4R8PC 5AV8B 1BH9A 4H9NA 2CV5B 5AVBB 3B6GD 3MGPC 3AYWA 4H9PB 1AOIA 1M1AA 3REKB 3W96D 5G49B 5CPIC 5B24C 2F2AC 1P3LC 2BYKA 5B32C 3IP4C 5AV5B 3AFAD 3MGQD 3C1BA 4G92C 3X1UA 4CSRB 3H0LC 4UUZB 5AV6C 2YFVB 3TU4A 2DF4C 3O62A 3B6FB 2Y2MA 4WJ3C 3KUYD 2HUEC 5B1MB 4X23C 2NZDB 4QLCB 1KX4C 5B0YC 4KHAA 1KX5B 2J8PA 3UTAB 3AZHD 3LZ0A 5AY8B 5DNNC 1A7WA 3LZ1B 3W99A 4KGCD 1TAFA 3EPHA 1P3FD 3LELA 3KXBC 3UT9D 4YM6B 3AZED 5F99A 1P3OB 4LD9A 1P3KD 5GT0D 3VH6T 3REID 1ID3C 3X1VC 3EPLA 3EPJA 3X1TC 3AZKD 3AZFB 4WU8C 5B0ZD 3REJA 1U35D 2ZY3A 1P3MC 3W97C 3W98C 3MNNB 2XD5A 5E5AA 5JA4B 2RVQD 4WZSB 3UTBC 1T3UA 5AV9A 4XUJB 1P34C 5AVCD 2F8NB 3WA9A 3AZNC 3VH5A 4XZQC 3AV2B 1P3AD 3B6GC 2PYOB 3AV1B 3AZJA 2BYMB 2Y2PA 1P3PA 4G91C 5CHLB 2AROB 3W96C 5CPJC 2HIOA 3RELB 2YFWA 4YS3D 4WU9C 1BH9B 3AYWB 1AOIB 1M1AB 4CAYA 3AZID 3R45A 3KUYC 2BYKB 5B31G 3WKJA 3X1UB 3VH6W 3TU4B 5AV8D 3B0DB 3O62B 3AZHC 3WAAA 4Z66D 3H0RC 3REKD 1W2EA 3LJAA 4UPKA 1P3FC 5B40B 3MGPD 5AV5D 2Y2QA 3LZ0B 2G5IC 2Y2GA 5GT0C 3REIC 3B6FD 1TAFB 1P3GB 3B0BA 5B32D 3X1SD 3AZGB 3LELB 2NQBC 3AN2B 1TZYB 3AZKC 4J8VA 4QLCD 1U35C 4LD9B 1HQ3D 2FJ7C 3KWQA 5GSUA 3VH5T 4J8WB 3MGSA 3UTAD 2RVQC 3AZLA 5AY8D 5GXQA 3NQJA 2ZY5A 4WNNA 4R8PA 3LZ1D 4KUDA 4Z2MG 3EPKA 1M18A 5CP6D 5AVCC 5E5AB 5CPIA 5B24A 1P3OD 1P3LA 5JRGB 1P3AC 1EQZA 5AV9B 5BT1D 5DNMB 5BNVA 5AV6A 3WA9B 4YS3C 3WTPA 5B2JA 1P3IC 1S32A 4Z5TA 1Z2CB 3X1TD 3AZJB 5KDMA 4X23A 4JJND 1KX4A 2IO5C 5B0YA 4WU8D 2F8NH 2HIOB 3W97D 4J8UB 1P3MD 2YFWB 4XUJD 5DNNA 5GT3A 1F1EA 4AWLB 3AZMA 5B33A 5AV8C 2CV5C 5AVBC 3KXBA 3R45B 4Z66C 5CPKA 3REKC 4NE6A 3WTPE 3REHD 4XZQD 5B1LA 3WKJB 1ID3A 2FFFB 5BS7C 3X1VA 5AV5C 3C1CA 5CPJD 1ZLAA 5B2IA 3LJAB 3B6FC 5B31A 4WU9D 4DQYB 3X1SC 4ZBJB 3V9RA 3UTBA 4QLCC 1HQ3C 3TU4D 2Y2OA 1P34A 3UTAC 3AZNA 5AY8C 3MGRA 3P5JB 3NQUA 3LZ1C 3B6GA 5CP6C 1P3BD 4J8VB 5B40D 1F66D 3F6TA 5GSUB 3W96A 3AZLB 3MGSB 1P3OC 1N1JA 4J8XD 3KSYA 1M19D 4WNNB 4KUDB 1M18B 5BT1C 3AZGD 3AFAA 3MGQA 1P3GD 3B0CT 4NE5A 3AN2D 1TZYD 3AZFC 4H9RA 5B24B 1KU5A 3KUYA 1JFIA 3A6NB 4NFTA 4NE3A 4J8WD 1EQZB 2NQBD 5B32G 2F8NA 5BNVB 4JJNC 5AV6B 4ZUXB 3MVDB 4XUJC 2FJ7D 2Y2KA 3WTPB 5B2JB 1S32B 4Z5TB 5E5AD 4KGCA 1KX3B 5JRGD 1P3FA 3UT9A 2PYOC 3AV1C 5DNMD 3AZEA 5GT3B 3REHC 1P3KA 3RELC 1H3OA 2Y2JA 5GT0A 3REIA 3AZMB 5B33B 4H9OB 3KXBB 5BO0A 3AZKA 3AYWC 5CPKB 5B0ZA 1M1AC 4H9QB 1U35A 2Y2IA 4J8UD 1P3ID 4H9NB 5B1LB 1ID3B 3C1CB 3X1UC 3TU4C 1ZLAB 5B2IB 5AVCA 5B31B 1BH8A 3B0CW 3O62C 3C1BB 3V9RB 1P3AA 5C3IB 2CV5D 1P3BC 5AVBD 5B40C 1F66C 3A1IA 1WWIA 4J8XC 3MGRB 4YS3A 1M19C 3NQUB 2JSSA 1P3GC 3AZGC 4KHAB 3AN2C 1TZYC 3W96B 1WWSA 3AZIA 3W99B 4LD9C 5B1MD 4J8WC 3AFAB 3MGQB 2NZDD 2VQRA 5F99B 5AV8A 4H9RB 1KX5D 4Z66A 4H9SA 1JFIB 3REKA 5E5AC 3MGSD 5JRGC 3MGPA 3REJB 5DNMC 5AV5A 4YM6D 4UUZA 3B6FA 4KGCB 2L5AA 3X1SA 5B32A 1P3FB 3A6ND 3UT9B 1EQZD 3AZEB 4QLCA 3AZFD 1HQ3A 4ZUXD 4J8UC 1P3KB 1H3OB 5GT0B 3MNND 3MVDD 3REIB 3UTAA 1P3PB 4E44A 1S32D 4Z5TD 4AWLC 5CP6A 1KX3D 5B0ZB 2F8ND 2UWXA 1P3OA 3AV2D 4CAYB 3AV1D 2PYOD 5AVCB 1BH8B 2AROD 3RELD 3LJAC 3VH5W 4DRAA 1ZLAD 5B1LD 2F8NK 3X1TA 3WAAB 3KFUG 3AYWD 4JJNA 1AOID 1HTAA 4WU8A 1M1AD 3W97A 1P3MA 3W98A 4XUJA 5B2ID 2DQNC 5B1MC 1PZRA 5B31D 3A1KA 4HGAB 3C1BD 2NZDC 3X1UD 2IO5B 1KX5C 3AZIB 3O62D 3REHA 3MGSC 3AZLC 4XZQA 2CWEA 4KUDC 1M18C 3KWQB 1B6WA 4EO5B 4YM6C 4Z66B 2Y2LA 3LZ0D 5CPJA 2ZY4A 5GXQB 3NQJB 4DRBA 3W99D 4R8PB 4WU9A 3A6NC 3MGPB 1EQZC 3LELD 5CPIB 5F99D 4ZUXC 1P3LB 3EG5B 3MVDC 4LD9D 4WV4B 1ULYA 3MNNC 3WTPC 5B32B 4Z2MH 3X1SB 5B2JC 5FUGA 1S32C 4Z5TC 4G92B 1P3BA 1KX3C 5B40A 3AZHA 1HQ3B 3REJD 1F66A 2HUEB 2Y2HA 4J8XA 5GT3C 1M19A 5KDMB 4X23B 3AV2C 3AZMC 1KX4B 5B0YB 1P3GA 1B67A 5CP6B 5B33C 5AV9D 3AZGA 2AROC 3AN2A 1TZYA 5DNNB 3WA9D 5CPKC 5B1LC 4J8WA 2NQBA 3AZJD 1P3PD 1AOIC 3C1CC 3H0MC 2JE5A 2FJ7A 2HIOD 1ZLAC 5B2IC 5B31C 3X1VB 3X1TB 3C1BC 2RIQA 5JRGA 4JJNB 5C3IC 4WU8B 3B0DC 1P3MB 3W97B 5DNMA 3W98B 5BNXA 1Q9CA 2F8NG 3MGRC 3UTBB 3WKJD 1P34B 3WAAD 3LZ0C 3AZNB 2Y2NA 3REHB 3W99C 4XZQB 3LJAD 4J8UA 1P3IA 3B6GB 3LELC 3AFAC 4G91B 3MGQC 5CPJB 2ZY2A 5F99C 1N1JB 4WU9B 2CV5A 5AVBA 4J8VD 3REJC 4H9PA 3KUYB 3KWQD 5GSUD 3AZLD 5G49A 5FUGB 5GXQD 4KGCC 5BS7A 4R8PD 1P3BB 2ZM5A 5AV9C 1M18D 4KUDD 3UT9C 3AZHB 1F66B 4CSRA 2LY8A 2YFVA 3WA9C 3AZEC 4J8XB 5CPID 1M19B 5B24D 1P3KC 1P3LD 5B1MA 3AZJC 1P3PC 2NZDA 3AL0C 3FDDA 5AV6D 2HIOC 2XD1A 1KX5A 5B0ZC 3WTPD 5AY8A 4M6BA 5B2JD 5BO0B 3LZ1A 1R4VA 2NQBB 3AZKB 4X23D 1KX4D 1U35B 5B0YD 2FJ7B 4E45A 4YM6A 5DNND 5GT3D 3AZMD 3WKJC 2JCHA 3A6NA 5B33D 1BFMA 3KXBD 3WAAC 3AZFA 5CPKD 5BNXB 4ZUXA 3MVDA 3MNNA 1P3AB 4ZBJC 5JA4A 1ID3D 3X1VD 4HGAC 3C1CD 1KX3A 2BG1A 4YS3B 3AZIC 1P3IB
chains in the Genus database with same CATH topology
3W98D 3VH6A 3AV2A 2G5HC 3UTBD 4J8VC 4H9OA 3AV1A 2BYMA 2PYOA 3KWQC 4EO5C 5GSUC 2AROA 1P34D 2W8SA 4H9SC 3RELA 3AZND 5GXQC 3MGRD 4H9QA 4R8PC 5AV8B 1BH9A 4H9NA 2CV5B 5AVBB 3B6GD 3MGPC 3AYWA 4H9PB 1AOIA 1M1AA 3REKB 3W96D 5G49B 5CPIC 5B24C 2F2AC 1P3LC 2BYKA 5B32C 3IP4C 5AV5B 3AFAD 3MGQD 3C1BA 4G92C 3X1UA 4CSRB 3H0LC 4UUZB 5AV6C 2YFVB 3TU4A 2DF4C 3O62A 3B6FB 2Y2MA 4WJ3C 3KUYD 2HUEC 5B1MB 4X23C 2NZDB 4QLCB 1KX4C 5B0YC 4KHAA 1KX5B 2J8PA 3UTAB 3AZHD 3LZ0A 5AY8B 5DNNC 1A7WA 3LZ1B 3W99A 4KGCD 1TAFA 3EPHA 1P3FD 3LELA 3KXBC 3UT9D 4YM6B 3AZED 5F99A 1P3OB 4LD9A 1P3KD 5GT0D 3VH6T 3REID 1ID3C 3X1VC 3EPLA 3EPJA 3X1TC 3AZKD 3AZFB 4WU8C 5B0ZD 3REJA 1U35D 2ZY3A 1P3MC 3W97C 3W98C 3MNNB 2XD5A 5E5AA 5JA4B 2RVQD 4WZSB 3UTBC 1T3UA 5AV9A 4XUJB 1P34C 5AVCD 2F8NB 3WA9A 3AZNC 3VH5A 4XZQC 3AV2B 1P3AD 3B6GC 2PYOB 3AV1B 3AZJA 2BYMB 2Y2PA 1P3PA 4G91C 5CHLB 2AROB 3W96C 5CPJC 2HIOA 3RELB 2YFWA 4YS3D 4WU9C 1BH9B 3AYWB 1AOIB 1M1AB 4CAYA 3AZID 3R45A 3KUYC 2BYKB 5B31G 3WKJA 3X1UB 3VH6W 3TU4B 5AV8D 3B0DB 3O62B 3AZHC 3WAAA 4Z66D 3H0RC 3REKD 1W2EA 3LJAA 4UPKA 1P3FC 5B40B 3MGPD 5AV5D 2Y2QA 3LZ0B 2G5IC 2Y2GA 5GT0C 3REIC 3B6FD 1TAFB 1P3GB 3B0BA 5B32D 3X1SD 3AZGB 3LELB 2NQBC 3AN2B 1TZYB 3AZKC 4J8VA 4QLCD 1U35C 4LD9B 1HQ3D 2FJ7C 3KWQA 5GSUA 3VH5T 4J8WB 3MGSA 3UTAD 2RVQC 3AZLA 5AY8D 5GXQA 3NQJA 2ZY5A 4WNNA 4R8PA 3LZ1D 4KUDA 4Z2MG 3EPKA 1M18A 5CP6D 5AVCC 5E5AB 5CPIA 5B24A 1P3OD 1P3LA 5JRGB 1P3AC 1EQZA 5AV9B 5BT1D 5DNMB 5BNVA 5AV6A 3WA9B 4YS3C 3WTPA 5B2JA 1P3IC 1S32A 4Z5TA 1Z2CB 3X1TD 3AZJB 5KDMA 4X23A 4JJND 1KX4A 2IO5C 5B0YA 4WU8D 2F8NH 2HIOB 3W97D 4J8UB 1P3MD 2YFWB 4XUJD 5DNNA 5GT3A 1F1EA 4AWLB 3AZMA 5B33A 5AV8C 2CV5C 5AVBC 3KXBA 3R45B 4Z66C 5CPKA 3REKC 4NE6A 3WTPE 3REHD 4XZQD 5B1LA 3WKJB 1ID3A 2FFFB 5BS7C 3X1VA 5AV5C 3C1CA 5CPJD 1ZLAA 5B2IA 3LJAB 3B6FC 5B31A 4WU9D 4DQYB 3X1SC 4ZBJB 3V9RA 3UTBA 4QLCC 1HQ3C 3TU4D 2Y2OA 1P34A 3UTAC 3AZNA 5AY8C 3MGRA 3P5JB 3NQUA 3LZ1C 3B6GA 5CP6C 1P3BD 4J8VB 5B40D 1F66D 3F6TA 5GSUB 3W96A 3AZLB 3MGSB 1P3OC 1N1JA 4J8XD 3KSYA 1M19D 4WNNB 4KUDB 1M18B 5BT1C 3AZGD 3AFAA 3MGQA 1P3GD 3B0CT 4NE5A 3AN2D 1TZYD 3AZFC 4H9RA 5B24B 1KU5A 3KUYA 1JFIA 3A6NB 4NFTA 4NE3A 4J8WD 1EQZB 2NQBD 5B32G 2F8NA 5BNVB 4JJNC 5AV6B 4ZUXB 3MVDB 4XUJC 2FJ7D 2Y2KA 3WTPB 5B2JB 1S32B 4Z5TB 5E5AD 4KGCA 1KX3B 5JRGD 1P3FA 3UT9A 2PYOC 3AV1C 5DNMD 3AZEA 5GT3B 3REHC 1P3KA 3RELC 1H3OA 2Y2JA 5GT0A 3REIA 3AZMB 5B33B 4H9OB 3KXBB 5BO0A 3AZKA 3AYWC 5CPKB 5B0ZA 1M1AC 4H9QB 1U35A 2Y2IA 4J8UD 1P3ID 4H9NB 5B1LB 1ID3B 3C1CB 3X1UC 3TU4C 1ZLAB 5B2IB 5AVCA 5B31B 1BH8A 3B0CW 3O62C 3C1BB 3V9RB 1P3AA 5C3IB 2CV5D 1P3BC 5AVBD 5B40C 1F66C 3A1IA 1WWIA 4J8XC 3MGRB 4YS3A 1M19C 3NQUB 2JSSA 1P3GC 3AZGC 4KHAB 3AN2C 1TZYC 3W96B 1WWSA 3AZIA 3W99B 4LD9C 5B1MD 4J8WC 3AFAB 3MGQB 2NZDD 2VQRA 5F99B 5AV8A 4H9RB 1KX5D 4Z66A 4H9SA 1JFIB 3REKA 5E5AC 3MGSD 5JRGC 3MGPA 3REJB 5DNMC 5AV5A 4YM6D 4UUZA 3B6FA 4KGCB 2L5AA 3X1SA 5B32A 1P3FB 3A6ND 3UT9B 1EQZD 3AZEB 4QLCA 3AZFD 1HQ3A 4ZUXD 4J8UC 1P3KB 1H3OB 5GT0B 3MNND 3MVDD 3REIB 3UTAA 1P3PB 4E44A 1S32D 4Z5TD 4AWLC 5CP6A 1KX3D 5B0ZB 2F8ND 2UWXA 1P3OA 3AV2D 4CAYB 3AV1D 2PYOD 5AVCB 1BH8B 2AROD 3RELD 3LJAC 3VH5W 4DRAA 1ZLAD 5B1LD 2F8NK 3X1TA 3WAAB 3KFUG 3AYWD 4JJNA 1AOID 1HTAA 4WU8A 1M1AD 3W97A 1P3MA 3W98A 4XUJA 5B2ID 2DQNC 5B1MC 1PZRA 5B31D 3A1KA 4HGAB 3C1BD 2NZDC 3X1UD 2IO5B 1KX5C 3AZIB 3O62D 3REHA 3MGSC 3AZLC 4XZQA 2CWEA 4KUDC 1M18C 3KWQB 1B6WA 4EO5B 4YM6C 4Z66B 2Y2LA 3LZ0D 5CPJA 2ZY4A 5GXQB 3NQJB 4DRBA 3W99D 4R8PB 4WU9A 3A6NC 3MGPB 1EQZC 3LELD 5CPIB 5F99D 4ZUXC 1P3LB 3EG5B 3MVDC 4LD9D 4WV4B 1ULYA 3MNNC 3WTPC 5B32B 4Z2MH 3X1SB 5B2JC 5FUGA 1S32C 4Z5TC 4G92B 1P3BA 1KX3C 5B40A 3AZHA 1HQ3B 3REJD 1F66A 2HUEB 2Y2HA 4J8XA 5GT3C 1M19A 5KDMB 4X23B 3AV2C 3AZMC 1KX4B 5B0YB 1P3GA 1B67A 5CP6B 5B33C 5AV9D 3AZGA 2AROC 3AN2A 1TZYA 5DNNB 3WA9D 5CPKC 5B1LC 4J8WA 2NQBA 3AZJD 1P3PD 1AOIC 3C1CC 3H0MC 2JE5A 2FJ7A 2HIOD 1ZLAC 5B2IC 5B31C 3X1VB 3X1TB 3C1BC 2RIQA 5JRGA 4JJNB 5C3IC 4WU8B 3B0DC 1P3MB 3W97B 5DNMA 3W98B 5BNXA 1Q9CA 2F8NG 3MGRC 3UTBB 3WKJD 1P34B 3WAAD 3LZ0C 3AZNB 2Y2NA 3REHB 3W99C 4XZQB 3LJAD 4J8UA 1P3IA 3B6GB 3LELC 3AFAC 4G91B 3MGQC 5CPJB 2ZY2A 5F99C 1N1JB 4WU9B 2CV5A 5AVBA 4J8VD 3REJC 4H9PA 3KUYB 3KWQD 5GSUD 3AZLD 5G49A 5FUGB 5GXQD 4KGCC 5BS7A 4R8PD 1P3BB 2ZM5A 5AV9C 1M18D 4KUDD 3UT9C 3AZHB 1F66B 4CSRA 2LY8A 2YFVA 3WA9C 3AZEC 4J8XB 5CPID 1M19B 5B24D 1P3KC 1P3LD 5B1MA 3AZJC 1P3PC 2NZDA 3AL0C 3FDDA 5AV6D 2HIOC 2XD1A 1KX5A 5B0ZC 3WTPD 5AY8A 4M6BA 5B2JD 5BO0B 3LZ1A 1R4VA 2NQBB 3AZKB 4X23D 1KX4D 1U35B 5B0YD 2FJ7B 4E45A 4YM6A 5DNND 5GT3D 3AZMD 3WKJC 2JCHA 3A6NA 5B33D 1BFMA 3KXBD 3WAAC 3AZFA 5CPKD 5BNXB 4ZUXA 3MVDA 3MNNA 1P3AB 4ZBJC 5JA4A 1ID3D 3X1VD 4HGAC 3C1CD 1KX3A 2BG1A 4YS3B 3AZIC 1P3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 D;  3VH6 A;  3AV2 A;  3UTB D;  4J8V C;  4H9O A;  3AV1 A;  2BYM A;  2PYO A;  3KWQ C;  4EO5 C;  5GSU C;  2ARO A;  1P34 D;  4H9S C;  3REL A;  3AZN D;  5GXQ C;  3MGR D;  4H9Q A;  4R8P C;  5AV8 B;  1BH9 A;  4H9N A;  2CV5 B;  5AVB B;  3B6G D;  3MGP C;  3AYW A;  4H9P B;  1AOI A;  1M1A A;  3REK B;  3W96 D;  5G49 B;  5CPI C;  5B24 C;  1P3L C;  2BYK A;  5B32 C;  5AV5 B;  3AFA D;  3MGQ D;  3C1B A;  4G92 C;  3X1U A;  4CSR B;  4UUZ B;  5AV6 C;  3TU4 A;  2YFV B;  3B6F B;  3O62 A;  3KUY D;  2HUE C;  5B1M B;  4X23 C;  2NZD B;  4QLC B;  1KX4 C;  5B0Y C;  4KHA A;  1KX5 B;  3UTA B;  3AZH D;  3LZ0 A;  5AY8 B;  5DNN C;  1A7W A;  3LZ1 B;  3W99 A;  4KGC D;  1TAF A;  1P3F D;  3LEL A;  3KXB C;  3UT9 D;  4YM6 B;  3AZE D;  5F99 A;  1P3O B;  4LD9 A;  1P3K D;  5GT0 D;  3VH6 T;  3REI D;  1ID3 C;  3X1V C;  3X1T C;  3AZK D;  3AZF B;  4WU8 C;  5B0Z D;  3REJ A;  1U35 D;  1P3M C;  3W97 C;  3W98 C;  3MNN B;  5E5A A;  5JA4 B;  2RVQ D;  4WZS B;  3UTB C;  5AV9 A;  4XUJ B;  1P34 C;  5AVC D;  2F8N B;  3WA9 A;  3AZN C;  3VH5 A;  4XZQ C;  3AV2 B;  1P3A D;  3B6G C;  2PYO B;  3AV1 B;  3AZJ A;  2BYM B;  1P3P A;  4G91 C;  5CHL B;  2ARO B;  3W96 C;  5CPJ C;  2HIO A;  3REL B;  2YFW A;  4YS3 D;  4WU9 C;  1BH9 B;  3AYW B;  1AOI B;  1M1A B;  4CAY A;  3AZI D;  3R45 A;  3KUY C;  2BYK B;  5B31 G;  3WKJ A;  3X1U B;  3VH6 W;  3TU4 B;  5AV8 D;  3B0D B;  3O62 B;  3AZH C;  3WAA A;  4Z66 D;  3REK D;  3LJA A;  1P3F C;  5B40 B;  3MGP D;  5AV5 D;  3LZ0 B;  5GT0 C;  3B6F D;  3REI C;  1TAF B;  1P3G B;  3B0B A;  5B32 D;  3X1S D;  3AZG B;  3LEL B;  2NQB C;  3AN2 B;  1TZY B;  3AZK C;  4J8V A;  4QLC D;  1U35 C;  4LD9 B;  1HQ3 D;  2FJ7 C;  3KWQ A;  5GSU A;  3VH5 T;  4J8W B;  3MGS A;  3UTA D;  2RVQ C;  3AZL A;  5AY8 D;  5GXQ A;  3NQJ A;  4WNN A;  4R8P A;  3LZ1 D;  4KUD A;  4Z2M G;  1M18 A;  5CP6 D;  5AVC C;  5E5A B;  5CPI A;  5B24 A;  1P3O D;  1P3L A;  5JRG B;  1P3A C;  1EQZ A;  5AV9 B;  5BT1 D;  5DNM B;  5BNV A;  5AV6 A;  3WA9 B;  4YS3 C;  3WTP A;  5B2J A;  1P3I C;  1S32 A;  4Z5T A;  3X1T D;  3AZJ B;  5KDM A;  4X23 A;  4JJN D;  1KX4 A;  2IO5 C;  5B0Y A;  4WU8 D;  2F8N H;  2HIO B;  3W97 D;  4J8U B;  1P3M D;  2YFW B;  4XUJ D;  5DNN A;  5GT3 A;  1F1E A;  4AWL B;  3AZM A;  5B33 A;  5AV8 C;  2CV5 C;  5AVB C;  3KXB A;  3R45 B;  4Z66 C;  5CPK A;  3REK C;  4NE6 A;  3WTP E;  3REH D;  4XZQ D;  5B1L A;  3WKJ B;  1ID3 A;  5BS7 C;  3X1V A;  5AV5 C;  3C1C A;  5CPJ D;  1ZLA A;  5B2I A;  3LJA B;  3B6F C;  5B31 A;  4WU9 D;  3X1S C;  4ZBJ B;  3V9R A;  3UTB A;  4QLC C;  1HQ3 C;  3TU4 D;  1P34 A;  3UTA C;  3AZN A;  5AY8 C;  3MGR A;  3NQU A;  3LZ1 C;  3B6G A;  5CP6 C;  1P3B D;  4J8V B;  5B40 D;  1F66 D;  5GSU B;  3W96 A;  3AZL B;  3MGS B;  1P3O C;  1N1J A;  4J8X D;  3KSY A;  1M19 D;  4WNN B;  4KUD B;  1M18 B;  5BT1 C;  3AZG D;  3AFA A;  3MGQ A;  1P3G D;  3B0C T;  4NE5 A;  3AN2 D;  1TZY D;  3AZF C;  4H9R A;  5B24 B;  1KU5 A;  3KUY A;  1JFI A;  3A6N B;  4NFT A;  4NE3 A;  4J8W D;  1EQZ B;  2NQB D;  5B32 G;  2F8N A;  5BNV B;  4JJN C;  5AV6 B;  4ZUX B;  3MVD B;  4XUJ C;  2FJ7 D;  3WTP B;  5B2J B;  1S32 B;  4Z5T B;  5E5A D;  4KGC A;  1KX3 B;  5JRG D;  1P3F A;  3UT9 A;  2PYO C;  3AV1 C;  5DNM D;  3AZE A;  5GT3 B;  3REH C;  1P3K A;  3REL C;  1H3O A;  5GT0 A;  3AZM B;  3REI A;  5B33 B;  4H9O B;  3KXB B;  5BO0 A;  3AZK A;  3AYW C;  5CPK B;  5B0Z A;  1M1A C;  4H9Q B;  1U35 A;  4J8U D;  1P3I D;  4H9N B;  5B1L B;  1ID3 B;  3C1C B;  3X1U C;  3TU4 C;  1ZLA B;  5B2I B;  5AVC A;  5B31 B;  1BH8 A;  3B0C W;  3O62 C;  3C1B B;  3V9R B;  1P3A A;  5C3I B;  2CV5 D;  1P3B C;  5AVB D;  5B40 C;  1F66 C;  1WWI A;  4J8X C;  3MGR B;  4YS3 A;  1M19 C;  3NQU B;  2JSS A;  1P3G C;  3AZG C;  4KHA B;  3AN2 C;  1TZY C;  3W96 B;  1WWS A;  3AZI A;  3W99 B;  4LD9 C;  5B1M D;  4J8W C;  3AFA B;  3MGQ B;  2NZD D;  5F99 B;  5AV8 A;  4H9R B;  1KX5 D;  4Z66 A;  4H9S A;  1JFI B;  3REK A;  5E5A C;  3MGS D;  5JRG C;  3MGP A;  3REJ B;  5DNM C;  5AV5 A;  4YM6 D;  4UUZ A;  3B6F A;  4KGC B;  2L5A A;  3X1S A;  5B32 A;  1P3F B;  3A6N D;  3UT9 B;  1EQZ D;  3AZE B;  4QLC A;  3AZF D;  1HQ3 A;  4ZUX D;  4J8U C;  1P3K B;  1H3O B;  5GT0 B;  3MNN D;  3MVD D;  3REI B;  3UTA A;  1P3P B;  4E44 A;  1S32 D;  4Z5T D;  4AWL C;  5CP6 A;  1KX3 D;  5B0Z B;  2F8N D;  1P3O A;  3AV2 D;  4CAY B;  3AV1 D;  2PYO D;  5AVC B;  1BH8 B;  2ARO D;  3REL D;  3LJA C;  3VH5 W;  4DRA A;  1ZLA D;  5B1L D;  2F8N K;  3X1T A;  3WAA B;  3AYW D;  4JJN A;  1AOI D;  1HTA A;  4WU8 A;  1M1A D;  3W97 A;  1P3M A;  3W98 A;  4XUJ A;  5B2I D;  5B1M C;  5B31 D;  4HGA B;  3C1B D;  2NZD C;  3X1U D;  2IO5 B;  1KX5 C;  3AZI B;  3O62 D;  3REH A;  3MGS C;  3AZL C;  4XZQ A;  2CWE A;  4KUD C;  1M18 C;  3KWQ B;  1B6W A;  4EO5 B;  4YM6 C;  4Z66 B;  3LZ0 D;  5CPJ A;  5GXQ B;  3NQJ B;  4DRB A;  3W99 D;  4R8P B;  4WU9 A;  3A6N C;  3MGP B;  1EQZ C;  3LEL D;  5CPI B;  5F99 D;  4ZUX C;  1P3L B;  4LD9 D;  3MVD C;  4WV4 B;  1ULY A;  3MNN C;  3WTP C;  5B32 B;  3X1S B;  4Z2M H;  5B2J C;  5FUG A;  1S32 C;  4Z5T C;  4G92 B;  1P3B A;  1KX3 C;  5B40 A;  3AZH A;  1HQ3 B;  3REJ D;  1F66 A;  2HUE B;  4J8X A;  5GT3 C;  1M19 A;  5KDM B;  4X23 B;  3AV2 C;  3AZM C;  1KX4 B;  5B0Y B;  1P3G A;  1B67 A;  5CP6 B;  5B33 C;  5AV9 D;  3AZG A;  2ARO C;  3AN2 A;  1TZY A;  5DNN B;  3WA9 D;  5CPK C;  5B1L C;  4J8W A;  2NQB A;  3AZJ D;  1P3P D;  1AOI C;  3C1C C;  2FJ7 A;  2HIO D;  1ZLA C;  5B2I C;  5B31 C;  3X1V B;  3X1T B;  3C1B C;  5JRG A;  4JJN B;  5C3I C;  4WU8 B;  3B0D C;  1P3M B;  3W97 B;  5DNM A;  3W98 B;  5BNX A;  1Q9C A;  2F8N G;  3MGR C;  3UTB B;  3WKJ D;  1P34 B;  3WAA D;  3LZ0 C;  3AZN B;  3REH B;  3W99 C;  4XZQ B;  3LJA D;  4J8U A;  1P3I A;  3B6G B;  3LEL C;  3AFA C;  4G91 B;  3MGQ C;  5CPJ B;  5F99 C;  1N1J B;  4WU9 B;  2CV5 A;  5AVB A;  4J8V D;  3REJ C;  4H9P A;  3KUY B;  3KWQ D;  5GSU D;  3AZL D;  5G49 A;  5FUG B;  5GXQ D;  4KGC C;  5BS7 A;  4R8P D;  1P3B B;  4KUD D;  5AV9 C;  1M18 D;  3UT9 C;  3AZH B;  1F66 B;  4CSR A;  2LY8 A;  2YFV A;  3WA9 C;  3AZE C;  4J8X B;  5CPI D;  1M19 B;  5B24 D;  1P3K C;  1P3L D;  5B1M A;  3AZJ C;  1P3P C;  2NZD A;  5AV6 D;  2HIO C;  1KX5 A;  5B0Z C;  3WTP D;  5AY8 A;  4M6B A;  5B2J D;  5BO0 B;  3LZ1 A;  1R4V A;  2NQB B;  3AZK B;  4X23 D;  1KX4 D;  1U35 B;  5B0Y D;  2FJ7 B;  4E45 A;  4YM6 A;  5DNN D;  5GT3 D;  3AZM D;  3WKJ C;  3A6N A;  5B33 D;  1BFM A;  3KXB D;  3WAA C;  3AZF A;  5CPK D;  5BNX B;  4ZUX A;  3MVD A;  3MNN A;  1P3A B;  4ZBJ C;  5JA4 A;  1ID3 D;  3X1V D;  4HGA C;  3C1C D;  1KX3 A;  4YS3 B;  3AZI C;  1P3I B; 
#chains in the Genus database with same CATH topology
 3W98 D;  3VH6 A;  3AV2 A;  2G5H C;  3UTB D;  4J8V C;  4H9O A;  3AV1 A;  2BYM A;  2PYO A;  3KWQ C;  4EO5 C;  5GSU C;  2ARO A;  1P34 D;  2W8S A;  4H9S C;  3REL A;  3AZN D;  5GXQ C;  3MGR D;  4H9Q A;  4R8P C;  5AV8 B;  1BH9 A;  4H9N A;  2CV5 B;  5AVB B;  3B6G D;  3MGP C;  3AYW A;  4H9P B;  1AOI A;  1M1A A;  3REK B;  3W96 D;  5G49 B;  5CPI C;  5B24 C;  2F2A C;  1P3L C;  2BYK A;  5B32 C;  3IP4 C;  5AV5 B;  3AFA D;  3MGQ D;  3C1B A;  4G92 C;  3X1U A;  4CSR B;  3H0L C;  4UUZ B;  5AV6 C;  2YFV B;  3TU4 A;  2DF4 C;  3O62 A;  3B6F B;  2Y2M A;  4WJ3 C;  3KUY D;  2HUE C;  5B1M B;  4X23 C;  2NZD B;  4QLC B;  1KX4 C;  5B0Y C;  4KHA A;  1KX5 B;  2J8P A;  3UTA B;  3AZH D;  3LZ0 A;  5AY8 B;  5DNN C;  1A7W A;  3LZ1 B;  3W99 A;  4KGC D;  1TAF A;  3EPH A;  1P3F D;  3LEL A;  3KXB C;  3UT9 D;  4YM6 B;  3AZE D;  5F99 A;  1P3O B;  4LD9 A;  1P3K D;  5GT0 D;  3VH6 T;  3REI D;  1ID3 C;  3X1V C;  3EPL A;  3EPJ A;  3X1T C;  3AZK D;  3AZF B;  4WU8 C;  5B0Z D;  3REJ A;  1U35 D;  2ZY3 A;  1P3M C;  3W97 C;  3W98 C;  3MNN B;  2XD5 A;  5E5A A;  5JA4 B;  2RVQ D;  4WZS B;  3UTB C;  1T3U A;  5AV9 A;  4XUJ B;  1P34 C;  5AVC D;  2F8N B;  3WA9 A;  3AZN C;  3VH5 A;  4XZQ C;  3AV2 B;  1P3A D;  3B6G C;  2PYO B;  3AV1 B;  3AZJ A;  2BYM B;  2Y2P A;  1P3P A;  4G91 C;  5CHL B;  2ARO B;  3W96 C;  5CPJ C;  2HIO A;  3REL B;  2YFW A;  4YS3 D;  4WU9 C;  1BH9 B;  3AYW B;  1AOI B;  1M1A B;  4CAY A;  3AZI D;  3R45 A;  3KUY C;  2BYK B;  5B31 G;  3WKJ A;  3X1U B;  3VH6 W;  3TU4 B;  5AV8 D;  3B0D B;  3O62 B;  3AZH C;  3WAA A;  4Z66 D;  3H0R C;  3REK D;  1W2E A;  3LJA A;  4UPK A;  1P3F C;  5B40 B;  3MGP D;  5AV5 D;  2Y2Q A;  3LZ0 B;  2G5I C;  2Y2G A;  5GT0 C;  3REI C;  3B6F D;  1TAF B;  1P3G B;  3B0B A;  5B32 D;  3X1S D;  3AZG B;  3LEL B;  2NQB C;  3AN2 B;  1TZY B;  3AZK C;  4J8V A;  4QLC D;  1U35 C;  4LD9 B;  1HQ3 D;  2FJ7 C;  3KWQ A;  5GSU A;  3VH5 T;  4J8W B;  3MGS A;  3UTA D;  2RVQ C;  3AZL A;  5AY8 D;  5GXQ A;  3NQJ A;  2ZY5 A;  4WNN A;  4R8P A;  3LZ1 D;  4KUD A;  4Z2M G;  3EPK A;  1M18 A;  5CP6 D;  5AVC C;  5E5A B;  5CPI A;  5B24 A;  1P3O D;  1P3L A;  5JRG B;  1P3A C;  1EQZ A;  5AV9 B;  5BT1 D;  5DNM B;  5BNV A;  5AV6 A;  3WA9 B;  4YS3 C;  3WTP A;  5B2J A;  1P3I C;  1S32 A;  4Z5T A;  1Z2C B;  3X1T D;  3AZJ B;  5KDM A;  4X23 A;  4JJN D;  1KX4 A;  2IO5 C;  5B0Y A;  4WU8 D;  2F8N H;  2HIO B;  3W97 D;  4J8U B;  1P3M D;  2YFW B;  4XUJ D;  5DNN A;  5GT3 A;  1F1E A;  4AWL B;  3AZM A;  5B33 A;  5AV8 C;  2CV5 C;  5AVB C;  3KXB A;  3R45 B;  4Z66 C;  5CPK A;  3REK C;  4NE6 A;  3WTP E;  3REH D;  4XZQ D;  5B1L A;  3WKJ B;  1ID3 A;  2FFF B;  5BS7 C;  3X1V A;  5AV5 C;  3C1C A;  5CPJ D;  1ZLA A;  5B2I A;  3LJA B;  3B6F C;  5B31 A;  4WU9 D;  4DQY B;  3X1S C;  4ZBJ B;  3V9R A;  3UTB A;  4QLC C;  1HQ3 C;  3TU4 D;  2Y2O A;  1P34 A;  3UTA C;  3AZN A;  5AY8 C;  3MGR A;  3P5J B;  3NQU A;  3LZ1 C;  3B6G A;  5CP6 C;  1P3B D;  4J8V B;  5B40 D;  1F66 D;  3F6T A;  5GSU B;  3W96 A;  3AZL B;  3MGS B;  1P3O C;  1N1J A;  4J8X D;  3KSY A;  1M19 D;  4WNN B;  4KUD B;  1M18 B;  5BT1 C;  3AZG D;  3AFA A;  3MGQ A;  1P3G D;  3B0C T;  4NE5 A;  3AN2 D;  1TZY D;  3AZF C;  4H9R A;  5B24 B;  1KU5 A;  3KUY A;  1JFI A;  3A6N B;  4NFT A;  4NE3 A;  4J8W D;  1EQZ B;  2NQB D;  5B32 G;  2F8N A;  5BNV B;  4JJN C;  5AV6 B;  4ZUX B;  3MVD B;  4XUJ C;  2FJ7 D;  2Y2K A;  3WTP B;  5B2J B;  1S32 B;  4Z5T B;  5E5A D;  4KGC A;  1KX3 B;  5JRG D;  1P3F A;  3UT9 A;  2PYO C;  3AV1 C;  5DNM D;  3AZE A;  5GT3 B;  3REH C;  1P3K A;  3REL C;  1H3O A;  2Y2J A;  5GT0 A;  3REI A;  3AZM B;  5B33 B;  4H9O B;  3KXB B;  5BO0 A;  3AZK A;  3AYW C;  5CPK B;  5B0Z A;  1M1A C;  4H9Q B;  1U35 A;  2Y2I A;  4J8U D;  1P3I D;  4H9N B;  5B1L B;  1ID3 B;  3C1C B;  3X1U C;  3TU4 C;  1ZLA B;  5B2I B;  5AVC A;  5B31 B;  1BH8 A;  3B0C W;  3O62 C;  3C1B B;  3V9R B;  1P3A A;  5C3I B;  2CV5 D;  1P3B C;  5AVB D;  5B40 C;  1F66 C;  3A1I A;  1WWI A;  4J8X C;  3MGR B;  4YS3 A;  1M19 C;  3NQU B;  2JSS A;  1P3G C;  3AZG C;  4KHA B;  3AN2 C;  1TZY C;  3W96 B;  1WWS A;  3AZI A;  3W99 B;  4LD9 C;  5B1M D;  4J8W C;  3AFA B;  3MGQ B;  2NZD D;  2VQR A;  5F99 B;  5AV8 A;  4H9R B;  1KX5 D;  4Z66 A;  4H9S A;  1JFI B;  3REK A;  5E5A C;  3MGS D;  5JRG C;  3MGP A;  3REJ B;  5DNM C;  5AV5 A;  4YM6 D;  4UUZ A;  3B6F A;  4KGC B;  2L5A A;  3X1S A;  5B32 A;  1P3F B;  3A6N D;  3UT9 B;  1EQZ D;  3AZE B;  4QLC A;  3AZF D;  1HQ3 A;  4ZUX D;  4J8U C;  1P3K B;  1H3O B;  5GT0 B;  3MNN D;  3MVD D;  3REI B;  3UTA A;  1P3P B;  4E44 A;  1S32 D;  4Z5T D;  4AWL C;  5CP6 A;  1KX3 D;  5B0Z B;  2F8N D;  2UWX A;  1P3O A;  3AV2 D;  4CAY B;  3AV1 D;  2PYO D;  5AVC B;  1BH8 B;  2ARO D;  3REL D;  3LJA C;  3VH5 W;  4DRA A;  1ZLA D;  5B1L D;  2F8N K;  3X1T A;  3WAA B;  3KFU G;  3AYW D;  4JJN A;  1AOI D;  1HTA A;  4WU8 A;  1M1A D;  3W97 A;  1P3M A;  3W98 A;  4XUJ A;  5B2I D;  2DQN C;  5B1M C;  1PZR A;  5B31 D;  3A1K A;  4HGA B;  3C1B D;  2NZD C;  3X1U D;  2IO5 B;  1KX5 C;  3AZI B;  3O62 D;  3REH A;  3MGS C;  3AZL C;  4XZQ A;  2CWE A;  4KUD C;  1M18 C;  3KWQ B;  1B6W A;  4EO5 B;  4YM6 C;  4Z66 B;  2Y2L A;  3LZ0 D;  5CPJ A;  2ZY4 A;  5GXQ B;  3NQJ B;  4DRB A;  3W99 D;  4R8P B;  4WU9 A;  3A6N C;  3MGP B;  1EQZ C;  3LEL D;  5CPI B;  5F99 D;  4ZUX C;  1P3L B;  3EG5 B;  3MVD C;  4LD9 D;  4WV4 B;  1ULY A;  3MNN C;  3WTP C;  5B32 B;  4Z2M H;  3X1S B;  5B2J C;  5FUG A;  1S32 C;  4Z5T C;  4G92 B;  1P3B A;  1KX3 C;  5B40 A;  3AZH A;  1HQ3 B;  3REJ D;  1F66 A;  2HUE B;  2Y2H A;  4J8X A;  5GT3 C;  1M19 A;  5KDM B;  4X23 B;  3AV2 C;  3AZM C;  1KX4 B;  5B0Y B;  1P3G A;  1B67 A;  5CP6 B;  5B33 C;  5AV9 D;  3AZG A;  2ARO C;  3AN2 A;  1TZY A;  5DNN B;  3WA9 D;  5CPK C;  5B1L C;  4J8W A;  2NQB A;  3AZJ D;  1P3P D;  1AOI C;  3C1C C;  3H0M C;  2JE5 A;  2FJ7 A;  2HIO D;  1ZLA C;  5B2I C;  5B31 C;  3X1V B;  3X1T B;  3C1B C;  2RIQ A;  5JRG A;  4JJN B;  5C3I C;  4WU8 B;  3B0D C;  1P3M B;  3W97 B;  5DNM A;  3W98 B;  5BNX A;  1Q9C A;  2F8N G;  3MGR C;  3UTB B;  3WKJ D;  1P34 B;  3WAA D;  3LZ0 C;  3AZN B;  2Y2N A;  3REH B;  3W99 C;  4XZQ B;  3LJA D;  4J8U A;  1P3I A;  3B6G B;  3LEL C;  3AFA C;  4G91 B;  3MGQ C;  5CPJ B;  2ZY2 A;  5F99 C;  1N1J B;  4WU9 B;  2CV5 A;  5AVB A;  4J8V D;  3REJ C;  4H9P A;  3KUY B;  3KWQ D;  5GSU D;  3AZL D;  5G49 A;  5FUG B;  5GXQ D;  4KGC C;  5BS7 A;  4R8P D;  1P3B B;  2ZM5 A;  5AV9 C;  1M18 D;  4KUD D;  3UT9 C;  3AZH B;  1F66 B;  4CSR A;  2LY8 A;  2YFV A;  3WA9 C;  3AZE C;  4J8X B;  5CPI D;  1M19 B;  5B24 D;  1P3K C;  1P3L D;  5B1M A;  3AZJ C;  1P3P C;  2NZD A;  3AL0 C;  3FDD A;  5AV6 D;  2HIO C;  2XD1 A;  1KX5 A;  5B0Z C;  3WTP D;  5AY8 A;  4M6B A;  5B2J D;  5BO0 B;  3LZ1 A;  1R4V A;  2NQB B;  3AZK B;  4X23 D;  1KX4 D;  1U35 B;  5B0Y D;  2FJ7 B;  4E45 A;  4YM6 A;  5DNN D;  5GT3 D;  3AZM D;  3WKJ C;  2JCH A;  3A6N A;  5B33 D;  1BFM A;  3KXB D;  3WAA C;  3AZF A;  5CPK D;  5BNX B;  4ZUX A;  3MVD A;  3MNN A;  1P3A B;  4ZBJ C;  5JA4 A;  1ID3 D;  3X1V D;  4HGA C;  3C1C D;  1KX3 A;  2BG1 A;  4YS3 B;  3AZI C;  1P3I B; 
#chains in the Genus database with same CATH homology
 3W98 D;  3VH6 A;  3AV2 A;  2G5H C;  3UTB D;  4J8V C;  4H9O A;  3AV1 A;  2BYM A;  2PYO A;  3KWQ C;  4EO5 C;  5GSU C;  2ARO A;  1P34 D;  2W8S A;  4H9S C;  3REL A;  3AZN D;  5GXQ C;  3MGR D;  4H9Q A;  4R8P C;  5AV8 B;  1BH9 A;  4H9N A;  2CV5 B;  5AVB B;  3B6G D;  3MGP C;  3AYW A;  4H9P B;  1AOI A;  1M1A A;  3REK B;  3W96 D;  5G49 B;  5CPI C;  5B24 C;  2F2A C;  1P3L C;  2BYK A;  5B32 C;  3IP4 C;  5AV5 B;  3AFA D;  3MGQ D;  3C1B A;  4G92 C;  3X1U A;  4CSR B;  3H0L C;  4UUZ B;  5AV6 C;  2YFV B;  3TU4 A;  2DF4 C;  3O62 A;  3B6F B;  2Y2M A;  4WJ3 C;  3KUY D;  2HUE C;  5B1M B;  4X23 C;  2NZD B;  4QLC B;  1KX4 C;  5B0Y C;  4KHA A;  1KX5 B;  2J8P A;  3UTA B;  3AZH D;  3LZ0 A;  5AY8 B;  5DNN C;  1A7W A;  3LZ1 B;  3W99 A;  4KGC D;  1TAF A;  3EPH A;  1P3F D;  3LEL A;  3KXB C;  3UT9 D;  4YM6 B;  3AZE D;  5F99 A;  1P3O B;  4LD9 A;  1P3K D;  5GT0 D;  3VH6 T;  3REI D;  1ID3 C;  3X1V C;  3EPL A;  3EPJ A;  3X1T C;  3AZK D;  3AZF B;  4WU8 C;  5B0Z D;  3REJ A;  1U35 D;  2ZY3 A;  1P3M C;  3W97 C;  3W98 C;  3MNN B;  2XD5 A;  5E5A A;  5JA4 B;  2RVQ D;  4WZS B;  3UTB C;  1T3U A;  5AV9 A;  4XUJ B;  1P34 C;  5AVC D;  2F8N B;  3WA9 A;  3AZN C;  3VH5 A;  4XZQ C;  3AV2 B;  1P3A D;  3B6G C;  2PYO B;  3AV1 B;  3AZJ A;  2BYM B;  2Y2P A;  1P3P A;  4G91 C;  5CHL B;  2ARO B;  3W96 C;  5CPJ C;  2HIO A;  3REL B;  2YFW A;  4YS3 D;  4WU9 C;  1BH9 B;  3AYW B;  1AOI B;  1M1A B;  4CAY A;  3AZI D;  3R45 A;  3KUY C;  2BYK B;  5B31 G;  3WKJ A;  3X1U B;  3VH6 W;  3TU4 B;  5AV8 D;  3B0D B;  3O62 B;  3AZH C;  3WAA A;  4Z66 D;  3H0R C;  3REK D;  1W2E A;  3LJA A;  4UPK A;  1P3F C;  5B40 B;  3MGP D;  5AV5 D;  2Y2Q A;  3LZ0 B;  2G5I C;  2Y2G A;  5GT0 C;  3REI C;  3B6F D;  1TAF B;  1P3G B;  3B0B A;  5B32 D;  3X1S D;  3AZG B;  3LEL B;  2NQB C;  3AN2 B;  1TZY B;  3AZK C;  4J8V A;  4QLC D;  1U35 C;  4LD9 B;  1HQ3 D;  2FJ7 C;  3KWQ A;  5GSU A;  3VH5 T;  4J8W B;  3MGS A;  3UTA D;  2RVQ C;  3AZL A;  5AY8 D;  5GXQ A;  3NQJ A;  2ZY5 A;  4WNN A;  4R8P A;  3LZ1 D;  4KUD A;  4Z2M G;  3EPK A;  1M18 A;  5CP6 D;  5AVC C;  5E5A B;  5CPI A;  5B24 A;  1P3O D;  1P3L A;  5JRG B;  1P3A C;  1EQZ A;  5AV9 B;  5BT1 D;  5DNM B;  5BNV A;  5AV6 A;  3WA9 B;  4YS3 C;  3WTP A;  5B2J A;  1P3I C;  1S32 A;  4Z5T A;  1Z2C B;  3X1T D;  3AZJ B;  5KDM A;  4X23 A;  4JJN D;  1KX4 A;  2IO5 C;  5B0Y A;  4WU8 D;  2F8N H;  2HIO B;  3W97 D;  4J8U B;  1P3M D;  2YFW B;  4XUJ D;  5DNN A;  5GT3 A;  1F1E A;  4AWL B;  3AZM A;  5B33 A;  5AV8 C;  2CV5 C;  5AVB C;  3KXB A;  3R45 B;  4Z66 C;  5CPK A;  3REK C;  4NE6 A;  3WTP E;  3REH D;  4XZQ D;  5B1L A;  3WKJ B;  1ID3 A;  2FFF B;  5BS7 C;  3X1V A;  5AV5 C;  3C1C A;  5CPJ D;  1ZLA A;  5B2I A;  3LJA B;  3B6F C;  5B31 A;  4WU9 D;  4DQY B;  3X1S C;  4ZBJ B;  3V9R A;  3UTB A;  4QLC C;  1HQ3 C;  3TU4 D;  2Y2O A;  1P34 A;  3UTA C;  3AZN A;  5AY8 C;  3MGR A;  3P5J B;  3NQU A;  3LZ1 C;  3B6G A;  5CP6 C;  1P3B D;  4J8V B;  5B40 D;  1F66 D;  3F6T A;  5GSU B;  3W96 A;  3AZL B;  3MGS B;  1P3O C;  1N1J A;  4J8X D;  3KSY A;  1M19 D;  4WNN B;  4KUD B;  1M18 B;  5BT1 C;  3AZG D;  3AFA A;  3MGQ A;  1P3G D;  3B0C T;  4NE5 A;  3AN2 D;  1TZY D;  3AZF C;  4H9R A;  5B24 B;  1KU5 A;  3KUY A;  1JFI A;  3A6N B;  4NFT A;  4NE3 A;  4J8W D;  1EQZ B;  2NQB D;  5B32 G;  2F8N A;  5BNV B;  4JJN C;  5AV6 B;  4ZUX B;  3MVD B;  4XUJ C;  2FJ7 D;  2Y2K A;  3WTP B;  5B2J B;  1S32 B;  4Z5T B;  5E5A D;  4KGC A;  1KX3 B;  5JRG D;  1P3F A;  3UT9 A;  2PYO C;  3AV1 C;  5DNM D;  3AZE A;  5GT3 B;  3REH C;  1P3K A;  3REL C;  1H3O A;  2Y2J A;  5GT0 A;  3REI A;  3AZM B;  5B33 B;  4H9O B;  3KXB B;  5BO0 A;  3AZK A;  3AYW C;  5CPK B;  5B0Z A;  1M1A C;  4H9Q B;  1U35 A;  2Y2I A;  4J8U D;  1P3I D;  4H9N B;  5B1L B;  1ID3 B;  3C1C B;  3X1U C;  3TU4 C;  1ZLA B;  5B2I B;  5AVC A;  5B31 B;  1BH8 A;  3B0C W;  3O62 C;  3C1B B;  3V9R B;  1P3A A;  5C3I B;  2CV5 D;  1P3B C;  5AVB D;  5B40 C;  1F66 C;  3A1I A;  1WWI A;  4J8X C;  3MGR B;  4YS3 A;  1M19 C;  3NQU B;  2JSS A;  1P3G C;  3AZG C;  4KHA B;  3AN2 C;  1TZY C;  3W96 B;  1WWS A;  3AZI A;  3W99 B;  4LD9 C;  5B1M D;  4J8W C;  3AFA B;  3MGQ B;  2NZD D;  2VQR A;  5F99 B;  5AV8 A;  4H9R B;  1KX5 D;  4Z66 A;  4H9S A;  1JFI B;  3REK A;  5E5A C;  3MGS D;  5JRG C;  3MGP A;  3REJ B;  5DNM C;  5AV5 A;  4YM6 D;  4UUZ A;  3B6F A;  4KGC B;  2L5A A;  3X1S A;  5B32 A;  1P3F B;  3A6N D;  3UT9 B;  1EQZ D;  3AZE B;  4QLC A;  3AZF D;  1HQ3 A;  4ZUX D;  4J8U C;  1P3K B;  1H3O B;  5GT0 B;  3MNN D;  3MVD D;  3REI B;  3UTA A;  1P3P B;  4E44 A;  1S32 D;  4Z5T D;  4AWL C;  5CP6 A;  1KX3 D;  5B0Z B;  2F8N D;  2UWX A;  1P3O A;  3AV2 D;  4CAY B;  3AV1 D;  2PYO D;  5AVC B;  1BH8 B;  2ARO D;  3REL D;  3LJA C;  3VH5 W;  4DRA A;  1ZLA D;  5B1L D;  2F8N K;  3X1T A;  3WAA B;  3KFU G;  3AYW D;  4JJN A;  1AOI D;  1HTA A;  4WU8 A;  1M1A D;  3W97 A;  1P3M A;  3W98 A;  4XUJ A;  5B2I D;  2DQN C;  5B1M C;  1PZR A;  5B31 D;  3A1K A;  4HGA B;  3C1B D;  2NZD C;  3X1U D;  2IO5 B;  1KX5 C;  3AZI B;  3O62 D;  3REH A;  3MGS C;  3AZL C;  4XZQ A;  2CWE A;  4KUD C;  1M18 C;  3KWQ B;  1B6W A;  4EO5 B;  4YM6 C;  4Z66 B;  2Y2L A;  3LZ0 D;  5CPJ A;  2ZY4 A;  5GXQ B;  3NQJ B;  4DRB A;  3W99 D;  4R8P B;  4WU9 A;  3A6N C;  3MGP B;  1EQZ C;  3LEL D;  5CPI B;  5F99 D;  4ZUX C;  1P3L B;  3EG5 B;  3MVD C;  4LD9 D;  4WV4 B;  1ULY A;  3MNN C;  3WTP C;  5B32 B;  4Z2M H;  3X1S B;  5B2J C;  5FUG A;  1S32 C;  4Z5T C;  4G92 B;  1P3B A;  1KX3 C;  5B40 A;  3AZH A;  1HQ3 B;  3REJ D;  1F66 A;  2HUE B;  2Y2H A;  4J8X A;  5GT3 C;  1M19 A;  5KDM B;  4X23 B;  3AV2 C;  3AZM C;  1KX4 B;  5B0Y B;  1P3G A;  1B67 A;  5CP6 B;  5B33 C;  5AV9 D;  3AZG A;  2ARO C;  3AN2 A;  1TZY A;  5DNN B;  3WA9 D;  5CPK C;  5B1L C;  4J8W A;  2NQB A;  3AZJ D;  1P3P D;  1AOI C;  3C1C C;  3H0M C;  2JE5 A;  2FJ7 A;  2HIO D;  1ZLA C;  5B2I C;  5B31 C;  3X1V B;  3X1T B;  3C1B C;  2RIQ A;  5JRG A;  4JJN B;  5C3I C;  4WU8 B;  3B0D C;  1P3M B;  3W97 B;  5DNM A;  3W98 B;  5BNX A;  1Q9C A;  2F8N G;  3MGR C;  3UTB B;  3WKJ D;  1P34 B;  3WAA D;  3LZ0 C;  3AZN B;  2Y2N A;  3REH B;  3W99 C;  4XZQ B;  3LJA D;  4J8U A;  1P3I A;  3B6G B;  3LEL C;  3AFA C;  4G91 B;  3MGQ C;  5CPJ B;  2ZY2 A;  5F99 C;  1N1J B;  4WU9 B;  2CV5 A;  5AVB A;  4J8V D;  3REJ C;  4H9P A;  3KUY B;  3KWQ D;  5GSU D;  3AZL D;  5G49 A;  5FUG B;  5GXQ D;  4KGC C;  5BS7 A;  4R8P D;  1P3B B;  2ZM5 A;  5AV9 C;  1M18 D;  4KUD D;  3UT9 C;  3AZH B;  1F66 B;  4CSR A;  2LY8 A;  2YFV A;  3WA9 C;  3AZE C;  4J8X B;  5CPI D;  1M19 B;  5B24 D;  1P3K C;  1P3L D;  5B1M A;  3AZJ C;  1P3P C;  2NZD A;  3AL0 C;  3FDD A;  5AV6 D;  2HIO C;  2XD1 A;  1KX5 A;  5B0Z C;  3WTP D;  5AY8 A;  4M6B A;  5B2J D;  5BO0 B;  3LZ1 A;  1R4V A;  2NQB B;  3AZK B;  4X23 D;  1KX4 D;  1U35 B;  5B0Y D;  2FJ7 B;  4E45 A;  4YM6 A;  5DNN D;  5GT3 D;  3AZM D;  3WKJ C;  2JCH A;  3A6N A;  5B33 D;  1BFM A;  3KXB D;  3WAA C;  3AZF A;  5CPK D;  5BNX B;  4ZUX A;  3MVD A;  3MNN A;  1P3A B;  4ZBJ C;  5JA4 A;  1ID3 D;  3X1V D;  4HGA C;  3C1C D;  1KX3 A;  2BG1 A;  4YS3 B;  3AZI C;  1P3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...