5GSUA

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuA00
1TAFA 4WNNA 5AV6A 5BO0A 5CHLB 5GT0A 3AZLA 2PYOC 1KX3D 1M19D 1EQZA 3A6NA 4G91B 4Z66B 3AZJD 5AVCA 5F99B 4R8PA 3W97B 1ZLAB 1S32A 2HIOD 3B6GC 3AZIC 4Z66A 3A6NB 3MGPC 5FUGA 5GT3A 4J8UD 3W96C 5AV5C 3MGQB 5AY8D 5B1LA 5E5AC 4KHAB 4WU9D 5B40D 3WKJB 5JRGB 3X1SA 5AVBC 1P3FB 4KUDA 3MGRD 3MGSB 3AZFD 4NE3A 1M19B 3C1CC 4H9RB 1M1AB 1ZLAA 4H9QA 4YS3D 4Z66D 3MGSA 5GXQA 5AV6C 5B1LB 5B31D 3X1TD 1ZLAD 3LZ0C 3LJAB 2HIOB 4JJNA 3WKJA 4DRBA 4R8PD 2RVQD 3KXBC 4H9QB 3AZFA 4KUDD 4EO5B 1HTAA 5B2JA 3A6ND 3REJC 1EQZD 4J8UB 3KUYB 3X1SD 1S32B 3LZ0A 1TZYA 4H9NA 3VH6W 4QLCB 3TU4A 5B33B 1F66C 3O62A 4Z2MG 2IO5B 2NZDD 5AV8B 3B0DC 1P3KB 1P3OB 3MVDA 4J8UA 5GT3D 5AVCB 5F99A 5DNNC 5B0YB 4H9OA 1KX3C 5CPIA 3AYWB 5B32B 1U35C 1P3PA 2NQBC 2CV5C 1AOIB 4YM6B 3LJAD 3W99B 5C3IC 2F8NH 4KGCB 5GT0D 3MNNC 3AZLD 1B67A 4ZBJB 3MGPD 1B6WA 5AV5D 4Z5TC 3LJAA 4JJNB 4CAYA 5AY8C 4J8WD 4H9PA 3MVDB 2HUEC 4WU8C 2NZDB 5CP6C 5B40C 5CPKD 3UT9C 1JFIB 5B24C 5JA4B 5B2ID 1KX5D 3WA9C 3RELD 1WWSA 5B1MB 4YS3C 3REKB 1AOIA 3TU4D 5F99C 3AZED 3W97D 2FJ7A 3LZ0D 4AWLC 3AZNC 3REIA 3WAAA 3W99D 3AYWA 3AZKA 3AZHB 3R45B 4KGCD 4J8VA 4LD9B 4XZQD 2BYMB 5AV5B 3X1SC 4JJND 3AV1C 3WTPE 5CPJB 1P3KA 1P3OA 5B31A 3X1TA 2PYOA 5GXQD 3X1UA 1F1EA 4J8XB 4G92C 2YFWA 3WKJC 1P3BB 1P3FD 1TAFB 1ID3A 3AZFB 3B6FA 2CWEA 1KX5B 4WU9A 3AZMA 3WTPD 1U35A 1P3PC 3AZGD 2NQBD 3C1BB 3TU4B 5B1LD 5B31B 1H3OB 3VH5W 3X1TB 2AROA 3LZ0B 4H9RA 1M1AA 2BYMA 3AZHD 3AZMC 3KXBB 3KWQA 3O62C 5GT0C 3AZLC 4LD9D 5B31G 1EQZB 4Z5TD 5CPJD 1S32D 3NQUA 4QLCD 5G49B 5AV9A 3AZJA 5B33D 4CSRA 1HQ3D 5B2JC 3LELB 5BT1C 1F66B 3LZ1B 2IO5C 3VH5A 3W98D 4H9SC 5AV8D 5CP6D 1M19A 3B0DB 3AV1A 1P3KC 4XUJB 1P3OC 1M18D 5FUGB 5GT3B 3KSYA 5DNNB 5B0YD 3V9RB 1BH9A 3KWQC 3AZGB 3C1CA 5DNMB 5B32D 4G91C 1U35B 2NQBB 2AROC 3C1BD 1AOIC 4YM6C 1P3AA 4KGCC 2L5AA 5B24A 3MGPB 3UTAA 4JJNC 1KX4B 4YM6A 4J8WB 4ZUXB 3WA9A 1P3GC 1P34A 5BNVA 3MVDC 3LELD 3LZ1D 3W98B 1P3MC 5CP6B 3AZKB 1P3LA 3REIB 3WAAB 3UT9B 5BNVB 4M6BA 3X1VD 5BS7A 5B2IB 4J8VC 3AN2A 4ZUXA 3WA9B 1KX4A 3UTBB 3RELB 1P3MA 5DNMA 5DNMD 3C1CB 3AFAC 3UTAB 3V9RA 5B1MD 3REKD 2CV5A 3AZEB 1ID3C 5B1LC 4H9NB 3REHB 5BNXB 4UUZA 2HIOC 3KUYA 3AZHC 5GSUA 3LZ1A 4LD9C 4XZQB 3AV2C 3REJB 4J8UC 2F8NG 3UT9A 1S32C 5CPIC 4QLCC 2F8NA 4CAYB 5GXQB 4HGAC 5B33C 4WU8A 2YFVA 5AVBA 4J8XD 1P3LC 5AV8C 1P3BD 2FJ7C 5E5AA 5B0YC 1P34C 3MNNA 3AZFC 5JRGA 1BFMA 3WTPB 3NQUB 3UTBD 4KHAA 1A7WA 1N1JB 3C1CD 5B32C 3REJA 3B6FB 3AZIA 5B0YA 5GSUB 5B31C 3X1TC 3AZJC 3NQJA 3REHD 3MGQA 3REHA 2RVQC 4NFTA 1KU5A 3KXBD 3B6GD 3AZID 5B0ZA 3O62B 3MNNB 1HQ3A 3REJD 1EQZC 5DNNA 1BH8A 4Z5TB 5B33A 3AZNA 3W96D 4XUJA 1TZYB 2F8NK 1P3GD 1HQ3B 5E5AD 1F66D 3LZ1C 4WU8B 1P3IA 2NZDC 5AV9B 4J8XA 4XUJD 4WU9C 1M18B 5GT3C 5AVBD 5DNND 3MGRC 2PYOB 4WZSB 5DNMC 1P3IC 3AFAD 3WTPA 1U35D 4UUZB 5B1MC 3REKC 3B6FD 3R45A 5JA4A 5GSUD 4Z66C 1ID3D 1P3FA 1ZLAC 4X23A 3NQJB 3UTBA 3B6GB 4R8PC 5B1MA 3REKA 3MNND 5B0ZC 3AN2B 4CSRB 4KUDC 3A6NC 1P3BA 4X23B 1KX4D 2LY8A 3MGQC 2BYKB 4J8WC 4ZUXD 4H9SA 3X1VA 4KGCA 4WU8D 4J8XC 4G92B 1P3LD 1P3MB 3AZKD 3REID 3WAAD 1P3BC 5JRGC 3UT9D 3VH6A 3LELA 2FJ7D 3X1UC 1R4VA 3X1VB 3AZEA 1P34D 5B2IC 3MGSC 1KX5C 3WA9D 5G49A 1P3PB 3UTBC 3RELC 1P3AB 3AFAB 3UTAD 1M1AC 3TU4C 3AZEC 1ID3B 2CV5D 3REHC 4DRAA 3LJAC 2YFWB 3B0CT 1BH8B 1WWIA 1Q9CA 3AN2D 4XZQC 4X23D 3KUYC 4J8WA 5CPIB 5GXQC 5AV5A 3MGPA 1ULYA 5B2JB 3AFAA 1P3LB 1N1JA 3W98A 2BYKA 4XUJC 5CPKC 5AVCC 5B24D 3B0CW 3WTPC 1P3PD 1KX3B 3KWQB 3AZGC 4Z5TA 1P3ID 3AYWC 1P3AD 1F66A 2AROB 5KDMA 3B6FC 5GSUC 3C1BA 1P3GA 5F99D 3AZHA 3W97C 3W96A 5B32A 3AZND 3W99C 3VH6T 5C3IB 2NZDA 3AZIB 3O62D 5B0ZD 3B6GA 3KXBA 4E45A 3W96B 1KX4C 3VH5T 3MGQD 3AV1D 1M18A 1TZYD 5AY8B 4ZUXC 5CP6A 1P3GB 5AV8A 1HQ3C 5E5AB 5B2JD 3W98C 5AV9D 3AZKC 4QLCA 2JSSA 4NE5A 1M18C 5B40B 3WAAC 3REIC 3WKJD 5JRGD 5CPJA 4E44A 5AVBB 4H9PB 3X1UD 1P3FC 4J8VB 5B24B 4LD9A 3MGSD 3MGRB 4YS3A 2PYOD 3KWQD 1M19C 1P3IB 3UTAC 4XZQA 1M1AD 2AROD 3MGRA 4YS3B 4Z2MH 4WNNB 5AV6B 2F8ND 2NQBA 3W99A 4AWLB 3AZNB 5B40A 3AZGA 4R8PB 3AZMD 3AN2C 5B0ZB 3AV2B 4KUDB 4EO5C 1JFIA 4X23C 3KUYD 3B0BA 3X1SB 5CPJC 3AV1B 5AY8A 1KX5A 4HGAB 5B2IA 5BT1D 1P3MD 2HIOA 1P3KD 1P3OD 2FJ7B 3X1UB 3X1VC 1P34B 5AVCD 4J8VD 5KDMB 3AYWD 1P3AC 5BNXA 1KX3A 3W97A 2YFVB 5BS7C 2CV5B 3C1BC 3AZJB 5AV6D 1AOID 2F8NB 4YM6D 3RELA 3AZMB 3AV2D 5BO0B 5GT0B 3AZLB 4WV4B 4ZBJC 5CPKA 1BH9B 5CPID 1TZYC 1H3OA 5B32G 3AV2A 3MVDD 3LELC 2HUEB 4NE6A 5AV9C 4WU9B 4H9OB 5CPKB
chains in the Genus database with same CATH superfamily
1TAFA 4WNNA 5AV6A 5BO0A 5CHLB 5GT0A 3AZLA 2PYOC 2J8PA 1KX3D 1M19D 1EQZA 3A6NA 4G91B 4Z66B 3AZJD 5AVCA 5F99B 4R8PA 3W97B 1ZLAB 1S32A 2HIOD 3B6GC 3H0LC 3AZIC 4Z66A 3A6NB 3MGPC 5FUGA 5GT3A 4J8UD 3W96C 5AV5C 3MGQB 5AY8D 5B1LA 5E5AC 4KHAB 4WU9D 5B40D 3WKJB 5JRGB 3X1SA 5AVBC 3A1IA 2XD5A 1P3FB 2Y2QA 4KUDA 3MGRD 3MGSB 3AZFD 4NE3A 1M19B 3C1CC 4H9RB 1M1AB 1ZLAA 4H9QA 4YS3D 4Z66D 3MGSA 5GXQA 5AV6C 5B1LB 5B31D 3X1TD 1ZLAD 1W2EA 3LZ0C 3LJAB 2HIOB 4JJNA 3WKJA 4DRBA 4R8PD 2RVQD 3KXBC 4H9QB 3EPLA 3AZFA 2ZM5A 4KUDD 4EO5B 1HTAA 5B2JA 3A6ND 3REJC 1EQZD 4J8UB 3KUYB 3X1SD 1S32B 3LZ0A 1TZYA 2ZY5A 4H9NA 3VH6W 4QLCB 3TU4A 5B33B 2Y2JA 1F66C 3O62A 4Z2MG 2IO5B 2NZDD 5AV8B 3B0DC 1P3KB 1P3OB 3MVDA 4J8UA 2XD1A 5GT3D 5AVCB 5F99A 5DNNC 5B0YB 4H9OA 1KX3C 5CPIA 3AYWB 5B32B 1U35C 1P3PA 2NQBC 2CV5C 1AOIB 2ZY4A 4YM6B 3LJAD 3W99B 5C3IC 2F8NH 2FFFB 4KGCB 5GT0D 3MNNC 3AZLD 1B67A 4ZBJB 3MGPD 1B6WA 5AV5D 4Z5TC 3LJAA 4JJNB 4CAYA 5AY8C 4J8WD 2Y2IA 4H9PA 2RIQA 3MVDB 4WJ3C 2HUEC 4WU8C 2NZDB 5CP6C 5B40C 5CPKD 3UT9C 1JFIB 2Y2MA 5B24C 5JA4B 5B2ID 1KX5D 3WA9C 3RELD 2ZY2A 1WWSA 5B1MB 4YS3C 3REKB 1AOIA 3TU4D 5F99C 3AZED 3W97D 2FJ7A 3LZ0D 4AWLC 3AZNC 3REIA 3WAAA 3W99D 3AYWA 3AZKA 3AZHB 3R45B 3EPHA 4KGCD 4J8VA 4LD9B 4XZQD 2BYMB 5AV5B 3X1SC 4JJND 3AV1C 3WTPE 5CPJB 1P3KA 1P3OA 5B31A 3X1TA 2PYOA 5GXQD 2Y2PA 3X1UA 1F1EA 4J8XB 4G92C 2YFWA 3WKJC 1PZRA 1P3BB 1P3FD 1TAFB 1ID3A 3AZFB 3B6FA 2CWEA 1KX5B 4WU9A 3AZMA 3WTPD 1U35A 1P3PC 3AZGD 2F2AC 2VQRA 2NQBD 3C1BB 3TU4B 5B1LD 5B31B 1H3OB 3VH5W 3X1TB 2AROA 3LZ0B 4H9RA 1M1AA 3H0RC 2BYMA 3AZHD 3AZMC 3KXBB 3KWQA 3O62C 5GT0C 3AZLC 4LD9D 5B31G 1EQZB 4Z5TD 5CPJD 1S32D 1Z2CB 3NQUA 4QLCD 5G49B 5AV9A 3AZJA 5B33D 4CSRA 1HQ3D 5B2JC 3LELB 5BT1C 1F66B 3LZ1B 2IO5C 3VH5A 3W98D 4H9SC 5AV8D 5CP6D 1M19A 3B0DB 3AV1A 1P3KC 4XUJB 2DF4C 1P3OC 1M18D 5FUGB 5GT3B 3KSYA 5DNNB 5B0YD 3EG5B 3V9RB 1BH9A 3KWQC 3AZGB 2BG1A 3C1CA 5B32D 5DNMB 4G91C 1U35B 2NQBB 2AROC 4UPKA 3C1BD 1AOIC 4YM6C 1P3AA 4KGCC 2L5AA 5B24A 3MGPB 3UTAA 4JJNC 1KX4B 4YM6A 4J8WB 4ZUXB 3WA9A 1P3GC 1P34A 5BNVA 3MVDC 3LELD 3LZ1D 3W98B 1P3MC 5CP6B 3AZKB 1P3LA 3REIB 3WAAB 3UT9B 5BNVB 4M6BA 3X1VD 5BS7A 5B2IB 4J8VC 3AN2A 4ZUXA 3WA9B 1KX4A 3UTBB 3RELB 1P3MA 5DNMA 5DNMD 3EPJA 3C1CB 3AFAC 3UTAB 3V9RA 3H0MC 5B1MD 3REKD 2CV5A 3AZEB 1ID3C 5B1LC 4H9NB 3REHB 5BNXB 4UUZA 2HIOC 3KUYA 3AZHC 5GSUA 3LZ1A 4LD9C 3AL0C 4XZQB 3AV2C 3REJB 4J8UC 2F8NG 3UT9A 1S32C 5CPIC 4QLCC 2F8NA 4CAYB 5GXQB 4HGAC 5B33C 4WU8A 2YFVA 5AVBA 4J8XD 1P3LC 5AV8C 3A1KA 1P3BD 2FJ7C 5E5AA 5B0YC 1P34C 3MNNA 3AZFC 5JRGA 1BFMA 3WTPB 3NQUB 3UTBD 4KHAA 1A7WA 1N1JB 3C1CD 4DQYB 5B32C 3REJA 3B6FB 3AZIA 5B0YA 5GSUB 5B31C 3X1TC 3AZJC 3NQJA 3REHD 3MGQA 3P5JB 3REHA 2RVQC 4NFTA 1KU5A 2Y2GA 3IP4C 3KXBD 3AZID 5B0ZA 3B6GD 3O62B 3MNNB 1HQ3A 3REJD 1EQZC 5DNNA 1BH8A 4Z5TB 5B33A 3AZNA 3W96D 4XUJA 1TZYB 2DQNC 2F8NK 1P3GD 1HQ3B 5E5AD 1F66D 3LZ1C 4WU8B 1P3IA 2NZDC 5AV9B 4J8XA 4XUJD 4WU9C 1M18B 5GT3C 5AVBD 2Y2NA 5DNND 3MGRC 2PYOB 4WZSB 5DNMC 2ZY3A 1P3IC 3AFAD 3WTPA 1U35D 4UUZB 5B1MC 3REKC 3B6FD 2Y2HA 3R45A 5JA4A 5GSUD 4Z66C 1ID3D 1P3FA 1ZLAC 4X23A 3NQJB 3UTBA 3B6GB 3FDDA 4R8PC 5B1MA 3REKA 3MNND 5B0ZC 3AN2B 4CSRB 4KUDC 3A6NC 1P3BA 4X23B 1KX4D 2LY8A 3MGQC 2BYKB 4J8WC 4ZUXD 4H9SA 3X1VA 4KGCA 4WU8D 4J8XC 4G92B 1P3LD 2Y2OA 1P3MB 3AZKD 3REID 3WAAD 1P3BC 5JRGC 3UT9D 3VH6A 3LELA 2FJ7D 3X1UC 1R4VA 3X1VB 3AZEA 1P34D 5B2IC 3MGSC 1KX5C 3WA9D 5G49A 1P3PB 3UTBC 3RELC 1P3AB 3AFAB 3UTAD 1M1AC 2UWXA 3TU4C 3AZEC 1ID3B 2CV5D 3REHC 4DRAA 3LJAC 2YFWB 3B0CT 1BH8B 1WWIA 1Q9CA 3AN2D 4XZQC 4X23D 3KUYC 4J8WA 5CPIB 5GXQC 5AV5A 2Y2LA 3MGPA 1ULYA 5B2JB 3AFAA 1P3LB 1N1JA 2JCHA 3W98A 2BYKA 4XUJC 5CPKC 5AVCC 5B24D 3B0CW 3WTPC 1P3PD 1KX3B 3KWQB 3AZGC 4Z5TA 1P3ID 3AYWC 1P3AD 1F66A 2AROB 5KDMA 3B6FC 2Y2KA 5GSUC 3C1BA 1P3GA 5F99D 3AZHA 3W97C 3W96A 5B32A 3AZND 3W99C 3VH6T 5C3IB 2NZDA 3AZIB 3O62D 5B0ZD 3B6GA 3KXBA 4E45A 3W96B 1KX4C 3VH5T 3MGQD 3AV1D 1M18A 1TZYD 5AY8B 4ZUXC 5CP6A 1P3GB 5AV8A 1HQ3C 5E5AB 5B2JD 3W98C 5AV9D 3AZKC 4QLCA 2JSSA 4NE5A 1M18C 5B40B 3WAAC 3REIC 3WKJD 5JRGD 5CPJA 4E44A 5AVBB 4H9PB 3X1UD 1P3FC 4J8VB 5B24B 4LD9A 3MGSD 3MGRB 4YS3A 2PYOD 3KWQD 1M19C 1P3IB 3UTAC 4XZQA 1M1AD 2G5HC 2AROD 3MGRA 4YS3B 4Z2MH 4WNNB 5AV6B 2F8ND 2NQBA 3W99A 4AWLB 3AZNB 5B40A 3AZGA 4R8PB 3AZMD 3AN2C 5B0ZB 3AV2B 4KUDB 4EO5C 1JFIA 4X23C 3KUYD 3B0BA 3X1SB 5CPJC 3AV1B 5AY8A 1KX5A 2JE5A 4HGAB 5B2IA 5BT1D 1P3MD 2HIOA 1P3KD 1P3OD 2FJ7B 3X1UB 3X1VC 1P34B 5AVCD 4J8VD 2G5IC 5KDMB 3AYWD 1P3AC 1T3UA 5BNXA 1KX3A 3W97A 2YFVB 5BS7C 2CV5B 3C1BC 3AZJB 5AV6D 1AOID 2F8NB 4YM6D 3EPKA 3RELA 3AZMB 3KFUG 3AV2D 5BO0B 5GT0B 3AZLB 2W8SA 3F6TA 4WV4B 4ZBJC 5CPKA 1BH9B 5CPID 1TZYC 1H3OA 5B32G 3AV2A 3MVDD 3LELC 2HUEB 4NE6A 5AV9C 4WU9B 4H9OB 5CPKB
chains in the Genus database with same CATH topology
1TAFA 4WNNA 5AV6A 5BO0A 5CHLB 5GT0A 3AZLA 2PYOC 2J8PA 1KX3D 1M19D 1EQZA 3A6NA 4G91B 4Z66B 3AZJD 5AVCA 5F99B 4R8PA 3W97B 1ZLAB 1S32A 2HIOD 3B6GC 3H0LC 3AZIC 4Z66A 3A6NB 3MGPC 5FUGA 5GT3A 4J8UD 3W96C 5AV5C 3MGQB 5AY8D 5B1LA 5E5AC 4KHAB 4WU9D 5B40D 3WKJB 5JRGB 3X1SA 5AVBC 3A1IA 2XD5A 1P3FB 2Y2QA 4KUDA 3MGRD 3MGSB 3AZFD 4NE3A 1M19B 3C1CC 4H9RB 1M1AB 1ZLAA 4H9QA 4YS3D 4Z66D 3MGSA 5GXQA 5AV6C 5B1LB 5B31D 3X1TD 1ZLAD 1W2EA 3LZ0C 3LJAB 2HIOB 4JJNA 3WKJA 4DRBA 4R8PD 2RVQD 3KXBC 4H9QB 3EPLA 3AZFA 2ZM5A 4KUDD 4EO5B 1HTAA 5B2JA 3A6ND 3REJC 1EQZD 4J8UB 3KUYB 3X1SD 1S32B 3LZ0A 1TZYA 2ZY5A 4H9NA 3VH6W 4QLCB 3TU4A 5B33B 2Y2JA 1F66C 3O62A 4Z2MG 2IO5B 2NZDD 5AV8B 3B0DC 1P3KB 1P3OB 3MVDA 4J8UA 2XD1A 5GT3D 5AVCB 5F99A 5DNNC 5B0YB 4H9OA 1KX3C 5CPIA 3AYWB 5B32B 1U35C 1P3PA 2NQBC 2CV5C 1AOIB 2ZY4A 4YM6B 3LJAD 3W99B 5C3IC 2F8NH 2FFFB 4KGCB 5GT0D 3MNNC 3AZLD 1B67A 4ZBJB 3MGPD 1B6WA 5AV5D 4Z5TC 3LJAA 4JJNB 4CAYA 5AY8C 4J8WD 2Y2IA 4H9PA 2RIQA 3MVDB 4WJ3C 2HUEC 4WU8C 2NZDB 5CP6C 5B40C 5CPKD 3UT9C 1JFIB 2Y2MA 5B24C 5JA4B 5B2ID 1KX5D 3WA9C 3RELD 2ZY2A 1WWSA 5B1MB 4YS3C 3REKB 1AOIA 3TU4D 5F99C 3AZED 3W97D 2FJ7A 3LZ0D 4AWLC 3AZNC 3REIA 3WAAA 3W99D 3AYWA 3AZKA 3AZHB 3R45B 3EPHA 4KGCD 4J8VA 4LD9B 4XZQD 2BYMB 5AV5B 3X1SC 4JJND 3AV1C 3WTPE 5CPJB 1P3KA 1P3OA 5B31A 3X1TA 2PYOA 5GXQD 2Y2PA 3X1UA 1F1EA 4J8XB 4G92C 2YFWA 3WKJC 1PZRA 1P3BB 1P3FD 1TAFB 1ID3A 3AZFB 3B6FA 2CWEA 1KX5B 4WU9A 3AZMA 3WTPD 1U35A 1P3PC 3AZGD 2F2AC 2VQRA 2NQBD 3C1BB 3TU4B 5B1LD 5B31B 1H3OB 3VH5W 3X1TB 2AROA 3LZ0B 4H9RA 1M1AA 3H0RC 2BYMA 3AZHD 3AZMC 3KXBB 3KWQA 3O62C 5GT0C 3AZLC 4LD9D 5B31G 1EQZB 4Z5TD 5CPJD 1S32D 1Z2CB 3NQUA 4QLCD 5G49B 5AV9A 3AZJA 5B33D 4CSRA 1HQ3D 5B2JC 3LELB 5BT1C 1F66B 3LZ1B 2IO5C 3VH5A 3W98D 4H9SC 5AV8D 5CP6D 1M19A 3B0DB 3AV1A 1P3KC 4XUJB 2DF4C 1P3OC 1M18D 5FUGB 5GT3B 3KSYA 5DNNB 5B0YD 3EG5B 3V9RB 1BH9A 3KWQC 3AZGB 2BG1A 3C1CA 5B32D 5DNMB 4G91C 1U35B 2NQBB 2AROC 4UPKA 3C1BD 1AOIC 4YM6C 1P3AA 4KGCC 2L5AA 5B24A 3MGPB 3UTAA 4JJNC 1KX4B 4YM6A 4J8WB 4ZUXB 3WA9A 1P3GC 1P34A 5BNVA 3MVDC 3LELD 3LZ1D 3W98B 1P3MC 5CP6B 3AZKB 1P3LA 3REIB 3WAAB 3UT9B 5BNVB 4M6BA 3X1VD 5BS7A 5B2IB 4J8VC 3AN2A 4ZUXA 3WA9B 1KX4A 3UTBB 3RELB 1P3MA 5DNMA 5DNMD 3EPJA 3C1CB 3AFAC 3UTAB 3V9RA 3H0MC 5B1MD 3REKD 2CV5A 3AZEB 1ID3C 5B1LC 4H9NB 3REHB 5BNXB 4UUZA 2HIOC 3KUYA 3AZHC 5GSUA 3LZ1A 4LD9C 3AL0C 4XZQB 3AV2C 3REJB 4J8UC 2F8NG 3UT9A 1S32C 5CPIC 4QLCC 2F8NA 4CAYB 5GXQB 4HGAC 5B33C 4WU8A 2YFVA 5AVBA 4J8XD 1P3LC 5AV8C 3A1KA 1P3BD 2FJ7C 5E5AA 5B0YC 1P34C 3MNNA 3AZFC 5JRGA 1BFMA 3WTPB 3NQUB 3UTBD 4KHAA 1A7WA 1N1JB 3C1CD 4DQYB 5B32C 3REJA 3B6FB 3AZIA 5B0YA 5GSUB 5B31C 3X1TC 3AZJC 3NQJA 3REHD 3MGQA 3P5JB 3REHA 2RVQC 4NFTA 1KU5A 2Y2GA 3IP4C 3KXBD 3AZID 5B0ZA 3B6GD 3O62B 3MNNB 1HQ3A 3REJD 1EQZC 5DNNA 1BH8A 4Z5TB 5B33A 3AZNA 3W96D 4XUJA 1TZYB 2DQNC 2F8NK 1P3GD 1HQ3B 5E5AD 1F66D 3LZ1C 4WU8B 1P3IA 2NZDC 5AV9B 4J8XA 4XUJD 4WU9C 1M18B 5GT3C 5AVBD 2Y2NA 5DNND 3MGRC 2PYOB 4WZSB 5DNMC 2ZY3A 1P3IC 3AFAD 3WTPA 1U35D 4UUZB 5B1MC 3REKC 3B6FD 2Y2HA 3R45A 5JA4A 5GSUD 4Z66C 1ID3D 1P3FA 1ZLAC 4X23A 3NQJB 3UTBA 3B6GB 3FDDA 4R8PC 5B1MA 3REKA 3MNND 5B0ZC 3AN2B 4CSRB 4KUDC 3A6NC 1P3BA 4X23B 1KX4D 2LY8A 3MGQC 2BYKB 4J8WC 4ZUXD 4H9SA 3X1VA 4KGCA 4WU8D 4J8XC 4G92B 1P3LD 2Y2OA 1P3MB 3AZKD 3REID 3WAAD 1P3BC 5JRGC 3UT9D 3VH6A 3LELA 2FJ7D 3X1UC 1R4VA 3X1VB 3AZEA 1P34D 5B2IC 3MGSC 1KX5C 3WA9D 5G49A 1P3PB 3UTBC 3RELC 1P3AB 3AFAB 3UTAD 1M1AC 2UWXA 3TU4C 3AZEC 1ID3B 2CV5D 3REHC 4DRAA 3LJAC 2YFWB 3B0CT 1BH8B 1WWIA 1Q9CA 3AN2D 4XZQC 4X23D 3KUYC 4J8WA 5CPIB 5GXQC 5AV5A 2Y2LA 3MGPA 1ULYA 5B2JB 3AFAA 1P3LB 1N1JA 2JCHA 3W98A 2BYKA 4XUJC 5CPKC 5AVCC 5B24D 3B0CW 3WTPC 1P3PD 1KX3B 3KWQB 3AZGC 4Z5TA 1P3ID 3AYWC 1P3AD 1F66A 2AROB 5KDMA 3B6FC 2Y2KA 5GSUC 3C1BA 1P3GA 5F99D 3AZHA 3W97C 3W96A 5B32A 3AZND 3W99C 3VH6T 5C3IB 2NZDA 3AZIB 3O62D 5B0ZD 3B6GA 3KXBA 4E45A 3W96B 1KX4C 3VH5T 3MGQD 3AV1D 1M18A 1TZYD 5AY8B 4ZUXC 5CP6A 1P3GB 5AV8A 1HQ3C 5E5AB 5B2JD 3W98C 5AV9D 3AZKC 4QLCA 2JSSA 4NE5A 1M18C 5B40B 3WAAC 3REIC 3WKJD 5JRGD 5CPJA 4E44A 5AVBB 4H9PB 3X1UD 1P3FC 4J8VB 5B24B 4LD9A 3MGSD 3MGRB 4YS3A 2PYOD 3KWQD 1M19C 1P3IB 3UTAC 4XZQA 1M1AD 2G5HC 2AROD 3MGRA 4YS3B 4Z2MH 4WNNB 5AV6B 2F8ND 2NQBA 3W99A 4AWLB 3AZNB 5B40A 3AZGA 4R8PB 3AZMD 3AN2C 5B0ZB 3AV2B 4KUDB 4EO5C 1JFIA 4X23C 3KUYD 3B0BA 3X1SB 5CPJC 3AV1B 5AY8A 1KX5A 2JE5A 4HGAB 5B2IA 5BT1D 1P3MD 2HIOA 1P3KD 1P3OD 2FJ7B 3X1UB 3X1VC 1P34B 5AVCD 4J8VD 2G5IC 5KDMB 3AYWD 1P3AC 1T3UA 5BNXA 1KX3A 3W97A 2YFVB 5BS7C 2CV5B 3C1BC 3AZJB 5AV6D 1AOID 2F8NB 4YM6D 3EPKA 3RELA 3AZMB 3KFUG 3AV2D 5BO0B 5GT0B 3AZLB 2W8SA 3F6TA 4WV4B 4ZBJC 5CPKA 1BH9B 5CPID 1TZYC 1H3OA 5B32G 3AV2A 3MVDD 3LELC 2HUEB 4NE6A 5AV9C 4WU9B 4H9OB 5CPKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAF A;  4WNN A;  5AV6 A;  5BO0 A;  5CHL B;  5GT0 A;  3AZL A;  2PYO C;  1KX3 D;  1M19 D;  1EQZ A;  3A6N A;  4G91 B;  4Z66 B;  3AZJ D;  5AVC A;  5F99 B;  4R8P A;  3W97 B;  1ZLA B;  1S32 A;  2HIO D;  3B6G C;  3AZI C;  4Z66 A;  3A6N B;  3MGP C;  5FUG A;  5GT3 A;  4J8U D;  3W96 C;  5AV5 C;  3MGQ B;  5AY8 D;  5B1L A;  5E5A C;  4KHA B;  4WU9 D;  5B40 D;  3WKJ B;  5JRG B;  3X1S A;  5AVB C;  1P3F B;  4KUD A;  3MGR D;  3MGS B;  3AZF D;  4NE3 A;  1M19 B;  3C1C C;  4H9R B;  1M1A B;  1ZLA A;  4H9Q A;  4YS3 D;  4Z66 D;  3MGS A;  5GXQ A;  5AV6 C;  5B1L B;  5B31 D;  3X1T D;  1ZLA D;  3LZ0 C;  3LJA B;  2HIO B;  4JJN A;  3WKJ A;  4DRB A;  4R8P D;  2RVQ D;  3KXB C;  4H9Q B;  3AZF A;  4KUD D;  4EO5 B;  1HTA A;  5B2J A;  3A6N D;  3REJ C;  1EQZ D;  4J8U B;  3KUY B;  3X1S D;  1S32 B;  3LZ0 A;  1TZY A;  4H9N A;  3VH6 W;  4QLC B;  3TU4 A;  5B33 B;  1F66 C;  3O62 A;  4Z2M G;  2IO5 B;  2NZD D;  5AV8 B;  3B0D C;  1P3K B;  1P3O B;  3MVD A;  4J8U A;  5GT3 D;  5AVC B;  5F99 A;  5DNN C;  5B0Y B;  4H9O A;  1KX3 C;  5CPI A;  3AYW B;  5B32 B;  1U35 C;  1P3P A;  2NQB C;  2CV5 C;  1AOI B;  4YM6 B;  3LJA D;  3W99 B;  5C3I C;  2F8N H;  4KGC B;  5GT0 D;  3MNN C;  3AZL D;  1B67 A;  4ZBJ B;  3MGP D;  1B6W A;  5AV5 D;  4Z5T C;  3LJA A;  4JJN B;  4CAY A;  5AY8 C;  4J8W D;  4H9P A;  3MVD B;  2HUE C;  4WU8 C;  2NZD B;  5CP6 C;  5B40 C;  5CPK D;  3UT9 C;  1JFI B;  5B24 C;  5JA4 B;  5B2I D;  1KX5 D;  3WA9 C;  3REL D;  1WWS A;  5B1M B;  4YS3 C;  3REK B;  1AOI A;  3TU4 D;  5F99 C;  3AZE D;  3W97 D;  2FJ7 A;  3LZ0 D;  4AWL C;  3AZN C;  3REI A;  3WAA A;  3W99 D;  3AYW A;  3AZK A;  3AZH B;  3R45 B;  4KGC D;  4J8V A;  4LD9 B;  4XZQ D;  2BYM B;  5AV5 B;  3X1S C;  4JJN D;  3AV1 C;  3WTP E;  5CPJ B;  1P3K A;  1P3O A;  5B31 A;  3X1T A;  2PYO A;  5GXQ D;  3X1U A;  1F1E A;  4J8X B;  4G92 C;  2YFW A;  3WKJ C;  1P3B B;  1P3F D;  1TAF B;  1ID3 A;  3AZF B;  3B6F A;  2CWE A;  1KX5 B;  4WU9 A;  3AZM A;  3WTP D;  1U35 A;  1P3P C;  3AZG D;  2NQB D;  3C1B B;  3TU4 B;  5B1L D;  5B31 B;  1H3O B;  3VH5 W;  3X1T B;  2ARO A;  3LZ0 B;  4H9R A;  1M1A A;  2BYM A;  3AZH D;  3AZM C;  3KXB B;  3KWQ A;  3O62 C;  5GT0 C;  3AZL C;  4LD9 D;  5B31 G;  1EQZ B;  4Z5T D;  5CPJ D;  1S32 D;  3NQU A;  4QLC D;  5G49 B;  5AV9 A;  3AZJ A;  5B33 D;  4CSR A;  1HQ3 D;  5B2J C;  3LEL B;  5BT1 C;  1F66 B;  3LZ1 B;  2IO5 C;  3VH5 A;  3W98 D;  4H9S C;  5AV8 D;  5CP6 D;  1M19 A;  3B0D B;  3AV1 A;  1P3K C;  4XUJ B;  1P3O C;  1M18 D;  5FUG B;  5GT3 B;  3KSY A;  5DNN B;  5B0Y D;  3V9R B;  1BH9 A;  3KWQ C;  3AZG B;  3C1C A;  5DNM B;  5B32 D;  4G91 C;  1U35 B;  2NQB B;  2ARO C;  3C1B D;  1AOI C;  4YM6 C;  1P3A A;  4KGC C;  2L5A A;  5B24 A;  3MGP B;  3UTA A;  4JJN C;  1KX4 B;  4YM6 A;  4J8W B;  4ZUX B;  3WA9 A;  1P3G C;  1P34 A;  5BNV A;  3MVD C;  3LEL D;  3LZ1 D;  3W98 B;  1P3M C;  5CP6 B;  3AZK B;  1P3L A;  3REI B;  3WAA B;  3UT9 B;  5BNV B;  4M6B A;  3X1V D;  5BS7 A;  5B2I B;  4J8V C;  3AN2 A;  4ZUX A;  3WA9 B;  1KX4 A;  3UTB B;  3REL B;  1P3M A;  5DNM A;  5DNM D;  3C1C B;  3AFA C;  3UTA B;  3V9R A;  5B1M D;  3REK D;  2CV5 A;  3AZE B;  1ID3 C;  5B1L C;  4H9N B;  3REH B;  5BNX B;  4UUZ A;  2HIO C;  3KUY A;  3AZH C;  5GSU A;  3LZ1 A;  4LD9 C;  4XZQ B;  3AV2 C;  3REJ B;  4J8U C;  2F8N G;  3UT9 A;  1S32 C;  5CPI C;  4QLC C;  2F8N A;  4CAY B;  5GXQ B;  4HGA C;  5B33 C;  4WU8 A;  2YFV A;  5AVB A;  4J8X D;  1P3L C;  5AV8 C;  1P3B D;  2FJ7 C;  5E5A A;  5B0Y C;  1P34 C;  3MNN A;  3AZF C;  5JRG A;  1BFM A;  3WTP B;  3NQU B;  3UTB D;  4KHA A;  1A7W A;  1N1J B;  3C1C D;  5B32 C;  3REJ A;  3B6F B;  3AZI A;  5B0Y A;  5GSU B;  5B31 C;  3X1T C;  3AZJ C;  3NQJ A;  3REH D;  3MGQ A;  3REH A;  2RVQ C;  4NFT A;  1KU5 A;  3KXB D;  3B6G D;  3AZI D;  5B0Z A;  3O62 B;  3MNN B;  1HQ3 A;  3REJ D;  1EQZ C;  5DNN A;  1BH8 A;  4Z5T B;  5B33 A;  3AZN A;  3W96 D;  4XUJ A;  1TZY B;  2F8N K;  1P3G D;  1HQ3 B;  5E5A D;  1F66 D;  3LZ1 C;  4WU8 B;  1P3I A;  2NZD C;  5AV9 B;  4J8X A;  4XUJ D;  4WU9 C;  1M18 B;  5GT3 C;  5AVB D;  5DNN D;  3MGR C;  2PYO B;  4WZS B;  5DNM C;  1P3I C;  3AFA D;  3WTP A;  1U35 D;  4UUZ B;  5B1M C;  3REK C;  3B6F D;  3R45 A;  5JA4 A;  5GSU D;  4Z66 C;  1ID3 D;  1P3F A;  1ZLA C;  4X23 A;  3NQJ B;  3UTB A;  3B6G B;  4R8P C;  5B1M A;  3REK A;  3MNN D;  5B0Z C;  3AN2 B;  4CSR B;  4KUD C;  3A6N C;  1P3B A;  4X23 B;  1KX4 D;  2LY8 A;  3MGQ C;  2BYK B;  4J8W C;  4ZUX D;  4H9S A;  3X1V A;  4KGC A;  4WU8 D;  4J8X C;  4G92 B;  1P3L D;  1P3M B;  3AZK D;  3REI D;  3WAA D;  1P3B C;  5JRG C;  3UT9 D;  3VH6 A;  3LEL A;  2FJ7 D;  3X1U C;  1R4V A;  3X1V B;  3AZE A;  1P34 D;  5B2I C;  3MGS C;  1KX5 C;  3WA9 D;  5G49 A;  1P3P B;  3UTB C;  3REL C;  1P3A B;  3AFA B;  3UTA D;  1M1A C;  3TU4 C;  3AZE C;  1ID3 B;  2CV5 D;  3REH C;  4DRA A;  3LJA C;  2YFW B;  3B0C T;  1BH8 B;  1WWI A;  1Q9C A;  3AN2 D;  4XZQ C;  4X23 D;  3KUY C;  4J8W A;  5CPI B;  5GXQ C;  5AV5 A;  3MGP A;  1ULY A;  5B2J B;  3AFA A;  1P3L B;  1N1J A;  3W98 A;  2BYK A;  4XUJ C;  5CPK C;  5AVC C;  5B24 D;  3B0C W;  3WTP C;  1P3P D;  1KX3 B;  3KWQ B;  3AZG C;  4Z5T A;  1P3I D;  3AYW C;  1P3A D;  1F66 A;  2ARO B;  5KDM A;  3B6F C;  5GSU C;  3C1B A;  1P3G A;  5F99 D;  3AZH A;  3W97 C;  3W96 A;  5B32 A;  3AZN D;  3W99 C;  3VH6 T;  5C3I B;  2NZD A;  3AZI B;  3O62 D;  5B0Z D;  3B6G A;  3KXB A;  4E45 A;  3W96 B;  1KX4 C;  3VH5 T;  3MGQ D;  3AV1 D;  1M18 A;  1TZY D;  5AY8 B;  4ZUX C;  5CP6 A;  1P3G B;  5AV8 A;  1HQ3 C;  5E5A B;  5B2J D;  3W98 C;  5AV9 D;  3AZK C;  4QLC A;  2JSS A;  4NE5 A;  1M18 C;  5B40 B;  3WAA C;  3REI C;  3WKJ D;  5JRG D;  5CPJ A;  4E44 A;  5AVB B;  4H9P B;  3X1U D;  1P3F C;  4J8V B;  5B24 B;  4LD9 A;  3MGS D;  3MGR B;  4YS3 A;  2PYO D;  3KWQ D;  1M19 C;  1P3I B;  3UTA C;  4XZQ A;  1M1A D;  2ARO D;  3MGR A;  4YS3 B;  4Z2M H;  4WNN B;  5AV6 B;  2F8N D;  2NQB A;  3W99 A;  4AWL B;  3AZN B;  5B40 A;  3AZG A;  4R8P B;  3AZM D;  3AN2 C;  5B0Z B;  3AV2 B;  4KUD B;  4EO5 C;  1JFI A;  4X23 C;  3KUY D;  3B0B A;  3X1S B;  5CPJ C;  3AV1 B;  5AY8 A;  1KX5 A;  4HGA B;  5B2I A;  5BT1 D;  1P3M D;  2HIO A;  1P3K D;  1P3O D;  2FJ7 B;  3X1U B;  3X1V C;  1P34 B;  5AVC D;  4J8V D;  5KDM B;  3AYW D;  1P3A C;  5BNX A;  1KX3 A;  3W97 A;  2YFV B;  5BS7 C;  2CV5 B;  3C1B C;  3AZJ B;  5AV6 D;  1AOI D;  2F8N B;  4YM6 D;  3REL A;  3AZM B;  3AV2 D;  5BO0 B;  5GT0 B;  3AZL B;  4WV4 B;  4ZBJ C;  5CPK A;  1BH9 B;  5CPI D;  1TZY C;  1H3O A;  5B32 G;  3AV2 A;  3MVD D;  3LEL C;  2HUE B;  4NE6 A;  5AV9 C;  4WU9 B;  4H9O B;  5CPK B; 
#chains in the Genus database with same CATH topology
 1TAF A;  4WNN A;  5AV6 A;  5BO0 A;  5CHL B;  5GT0 A;  3AZL A;  2PYO C;  2J8P A;  1KX3 D;  1M19 D;  1EQZ A;  3A6N A;  4G91 B;  4Z66 B;  3AZJ D;  5AVC A;  5F99 B;  4R8P A;  3W97 B;  1ZLA B;  1S32 A;  2HIO D;  3B6G C;  3H0L C;  3AZI C;  4Z66 A;  3A6N B;  3MGP C;  5FUG A;  5GT3 A;  4J8U D;  3W96 C;  5AV5 C;  3MGQ B;  5AY8 D;  5B1L A;  5E5A C;  4KHA B;  4WU9 D;  5B40 D;  3WKJ B;  5JRG B;  3X1S A;  5AVB C;  3A1I A;  2XD5 A;  1P3F B;  2Y2Q A;  4KUD A;  3MGR D;  3MGS B;  3AZF D;  4NE3 A;  1M19 B;  3C1C C;  4H9R B;  1M1A B;  1ZLA A;  4H9Q A;  4YS3 D;  4Z66 D;  3MGS A;  5GXQ A;  5AV6 C;  5B1L B;  5B31 D;  3X1T D;  1ZLA D;  1W2E A;  3LZ0 C;  3LJA B;  2HIO B;  4JJN A;  3WKJ A;  4DRB A;  4R8P D;  2RVQ D;  3KXB C;  4H9Q B;  3EPL A;  3AZF A;  2ZM5 A;  4KUD D;  4EO5 B;  1HTA A;  5B2J A;  3A6N D;  3REJ C;  1EQZ D;  4J8U B;  3KUY B;  3X1S D;  1S32 B;  3LZ0 A;  1TZY A;  2ZY5 A;  4H9N A;  3VH6 W;  4QLC B;  3TU4 A;  5B33 B;  2Y2J A;  1F66 C;  3O62 A;  4Z2M G;  2IO5 B;  2NZD D;  5AV8 B;  3B0D C;  1P3K B;  1P3O B;  3MVD A;  4J8U A;  2XD1 A;  5GT3 D;  5AVC B;  5F99 A;  5DNN C;  5B0Y B;  4H9O A;  1KX3 C;  5CPI A;  3AYW B;  5B32 B;  1U35 C;  1P3P A;  2NQB C;  2CV5 C;  1AOI B;  2ZY4 A;  4YM6 B;  3LJA D;  3W99 B;  5C3I C;  2F8N H;  2FFF B;  4KGC B;  5GT0 D;  3MNN C;  3AZL D;  1B67 A;  4ZBJ B;  3MGP D;  1B6W A;  5AV5 D;  4Z5T C;  3LJA A;  4JJN B;  4CAY A;  5AY8 C;  4J8W D;  2Y2I A;  4H9P A;  2RIQ A;  3MVD B;  4WJ3 C;  2HUE C;  4WU8 C;  2NZD B;  5CP6 C;  5B40 C;  5CPK D;  3UT9 C;  1JFI B;  2Y2M A;  5B24 C;  5JA4 B;  5B2I D;  1KX5 D;  3WA9 C;  3REL D;  2ZY2 A;  1WWS A;  5B1M B;  4YS3 C;  3REK B;  1AOI A;  3TU4 D;  5F99 C;  3AZE D;  3W97 D;  2FJ7 A;  3LZ0 D;  4AWL C;  3AZN C;  3REI A;  3WAA A;  3W99 D;  3AYW A;  3AZK A;  3AZH B;  3R45 B;  3EPH A;  4KGC D;  4J8V A;  4LD9 B;  4XZQ D;  2BYM B;  5AV5 B;  3X1S C;  4JJN D;  3AV1 C;  3WTP E;  5CPJ B;  1P3K A;  1P3O A;  5B31 A;  3X1T A;  2PYO A;  5GXQ D;  2Y2P A;  3X1U A;  1F1E A;  4J8X B;  4G92 C;  2YFW A;  3WKJ C;  1PZR A;  1P3B B;  1P3F D;  1TAF B;  1ID3 A;  3AZF B;  3B6F A;  2CWE A;  1KX5 B;  4WU9 A;  3AZM A;  3WTP D;  1U35 A;  1P3P C;  3AZG D;  2F2A C;  2VQR A;  2NQB D;  3C1B B;  3TU4 B;  5B1L D;  5B31 B;  1H3O B;  3VH5 W;  3X1T B;  2ARO A;  3LZ0 B;  4H9R A;  1M1A A;  3H0R C;  2BYM A;  3AZH D;  3AZM C;  3KXB B;  3KWQ A;  3O62 C;  5GT0 C;  3AZL C;  4LD9 D;  5B31 G;  1EQZ B;  4Z5T D;  5CPJ D;  1S32 D;  1Z2C B;  3NQU A;  4QLC D;  5G49 B;  5AV9 A;  3AZJ A;  5B33 D;  4CSR A;  1HQ3 D;  5B2J C;  3LEL B;  5BT1 C;  1F66 B;  3LZ1 B;  2IO5 C;  3VH5 A;  3W98 D;  4H9S C;  5AV8 D;  5CP6 D;  1M19 A;  3B0D B;  3AV1 A;  1P3K C;  4XUJ B;  2DF4 C;  1P3O C;  1M18 D;  5FUG B;  5GT3 B;  3KSY A;  5DNN B;  5B0Y D;  3EG5 B;  3V9R B;  1BH9 A;  3KWQ C;  3AZG B;  2BG1 A;  3C1C A;  5B32 D;  5DNM B;  4G91 C;  1U35 B;  2NQB B;  2ARO C;  4UPK A;  3C1B D;  1AOI C;  4YM6 C;  1P3A A;  4KGC C;  2L5A A;  5B24 A;  3MGP B;  3UTA A;  4JJN C;  1KX4 B;  4YM6 A;  4J8W B;  4ZUX B;  3WA9 A;  1P3G C;  1P34 A;  5BNV A;  3MVD C;  3LEL D;  3LZ1 D;  3W98 B;  1P3M C;  5CP6 B;  3AZK B;  1P3L A;  3REI B;  3WAA B;  3UT9 B;  5BNV B;  4M6B A;  3X1V D;  5BS7 A;  5B2I B;  4J8V C;  3AN2 A;  4ZUX A;  3WA9 B;  1KX4 A;  3UTB B;  3REL B;  1P3M A;  5DNM A;  5DNM D;  3EPJ A;  3C1C B;  3AFA C;  3UTA B;  3V9R A;  3H0M C;  5B1M D;  3REK D;  2CV5 A;  3AZE B;  1ID3 C;  5B1L C;  4H9N B;  3REH B;  5BNX B;  4UUZ A;  2HIO C;  3KUY A;  3AZH C;  5GSU A;  3LZ1 A;  4LD9 C;  3AL0 C;  4XZQ B;  3AV2 C;  3REJ B;  4J8U C;  2F8N G;  3UT9 A;  1S32 C;  5CPI C;  4QLC C;  2F8N A;  4CAY B;  5GXQ B;  4HGA C;  5B33 C;  4WU8 A;  2YFV A;  5AVB A;  4J8X D;  1P3L C;  5AV8 C;  3A1K A;  1P3B D;  2FJ7 C;  5E5A A;  5B0Y C;  1P34 C;  3MNN A;  3AZF C;  5JRG A;  1BFM A;  3WTP B;  3NQU B;  3UTB D;  4KHA A;  1A7W A;  1N1J B;  3C1C D;  4DQY B;  5B32 C;  3REJ A;  3B6F B;  3AZI A;  5B0Y A;  5GSU B;  5B31 C;  3X1T C;  3AZJ C;  3NQJ A;  3REH D;  3MGQ A;  3P5J B;  3REH A;  2RVQ C;  4NFT A;  1KU5 A;  2Y2G A;  3IP4 C;  3KXB D;  3AZI D;  5B0Z A;  3B6G D;  3O62 B;  3MNN B;  1HQ3 A;  3REJ D;  1EQZ C;  5DNN A;  1BH8 A;  4Z5T B;  5B33 A;  3AZN A;  3W96 D;  4XUJ A;  1TZY B;  2DQN C;  2F8N K;  1P3G D;  1HQ3 B;  5E5A D;  1F66 D;  3LZ1 C;  4WU8 B;  1P3I A;  2NZD C;  5AV9 B;  4J8X A;  4XUJ D;  4WU9 C;  1M18 B;  5GT3 C;  5AVB D;  2Y2N A;  5DNN D;  3MGR C;  2PYO B;  4WZS B;  5DNM C;  2ZY3 A;  1P3I C;  3AFA D;  3WTP A;  1U35 D;  4UUZ B;  5B1M C;  3REK C;  3B6F D;  2Y2H A;  3R45 A;  5JA4 A;  5GSU D;  4Z66 C;  1ID3 D;  1P3F A;  1ZLA C;  4X23 A;  3NQJ B;  3UTB A;  3B6G B;  3FDD A;  4R8P C;  5B1M A;  3REK A;  3MNN D;  5B0Z C;  3AN2 B;  4CSR B;  4KUD C;  3A6N C;  1P3B A;  4X23 B;  1KX4 D;  2LY8 A;  3MGQ C;  2BYK B;  4J8W C;  4ZUX D;  4H9S A;  3X1V A;  4KGC A;  4WU8 D;  4J8X C;  4G92 B;  1P3L D;  2Y2O A;  1P3M B;  3AZK D;  3REI D;  3WAA D;  1P3B C;  5JRG C;  3UT9 D;  3VH6 A;  3LEL A;  2FJ7 D;  3X1U C;  1R4V A;  3X1V B;  3AZE A;  1P34 D;  5B2I C;  3MGS C;  1KX5 C;  3WA9 D;  5G49 A;  1P3P B;  3UTB C;  3REL C;  1P3A B;  3AFA B;  3UTA D;  1M1A C;  2UWX A;  3TU4 C;  3AZE C;  1ID3 B;  2CV5 D;  3REH C;  4DRA A;  3LJA C;  2YFW B;  3B0C T;  1BH8 B;  1WWI A;  1Q9C A;  3AN2 D;  4XZQ C;  4X23 D;  3KUY C;  4J8W A;  5CPI B;  5GXQ C;  5AV5 A;  2Y2L A;  3MGP A;  1ULY A;  5B2J B;  3AFA A;  1P3L B;  1N1J A;  2JCH A;  3W98 A;  2BYK A;  4XUJ C;  5CPK C;  5AVC C;  5B24 D;  3B0C W;  3WTP C;  1P3P D;  1KX3 B;  3KWQ B;  3AZG C;  4Z5T A;  1P3I D;  3AYW C;  1P3A D;  1F66 A;  2ARO B;  5KDM A;  3B6F C;  2Y2K A;  5GSU C;  3C1B A;  1P3G A;  5F99 D;  3AZH A;  3W97 C;  3W96 A;  5B32 A;  3AZN D;  3W99 C;  3VH6 T;  5C3I B;  2NZD A;  3AZI B;  3O62 D;  5B0Z D;  3B6G A;  3KXB A;  4E45 A;  3W96 B;  1KX4 C;  3VH5 T;  3MGQ D;  3AV1 D;  1M18 A;  1TZY D;  5AY8 B;  4ZUX C;  5CP6 A;  1P3G B;  5AV8 A;  1HQ3 C;  5E5A B;  5B2J D;  3W98 C;  5AV9 D;  3AZK C;  4QLC A;  2JSS A;  4NE5 A;  1M18 C;  5B40 B;  3WAA C;  3REI C;  3WKJ D;  5JRG D;  5CPJ A;  4E44 A;  5AVB B;  4H9P B;  3X1U D;  1P3F C;  4J8V B;  5B24 B;  4LD9 A;  3MGS D;  3MGR B;  4YS3 A;  2PYO D;  3KWQ D;  1M19 C;  1P3I B;  3UTA C;  4XZQ A;  1M1A D;  2G5H C;  2ARO D;  3MGR A;  4YS3 B;  4Z2M H;  4WNN B;  5AV6 B;  2F8N D;  2NQB A;  3W99 A;  4AWL B;  3AZN B;  5B40 A;  3AZG A;  4R8P B;  3AZM D;  3AN2 C;  5B0Z B;  3AV2 B;  4KUD B;  4EO5 C;  1JFI A;  4X23 C;  3KUY D;  3B0B A;  3X1S B;  5CPJ C;  3AV1 B;  5AY8 A;  1KX5 A;  2JE5 A;  4HGA B;  5B2I A;  5BT1 D;  1P3M D;  2HIO A;  1P3K D;  1P3O D;  2FJ7 B;  3X1U B;  3X1V C;  1P34 B;  5AVC D;  4J8V D;  2G5I C;  5KDM B;  3AYW D;  1P3A C;  1T3U A;  5BNX A;  1KX3 A;  3W97 A;  2YFV B;  5BS7 C;  2CV5 B;  3C1B C;  3AZJ B;  5AV6 D;  1AOI D;  2F8N B;  4YM6 D;  3EPK A;  3REL A;  3AZM B;  3KFU G;  3AV2 D;  5BO0 B;  5GT0 B;  3AZL B;  2W8S A;  3F6T A;  4WV4 B;  4ZBJ C;  5CPK A;  1BH9 B;  5CPI D;  1TZY C;  1H3O A;  5B32 G;  3AV2 A;  3MVD D;  3LEL C;  2HUE B;  4NE6 A;  5AV9 C;  4WU9 B;  4H9O B;  5CPK B; 
#chains in the Genus database with same CATH homology
 1TAF A;  4WNN A;  5AV6 A;  5BO0 A;  5CHL B;  5GT0 A;  3AZL A;  2PYO C;  2J8P A;  1KX3 D;  1M19 D;  1EQZ A;  3A6N A;  4G91 B;  4Z66 B;  3AZJ D;  5AVC A;  5F99 B;  4R8P A;  3W97 B;  1ZLA B;  1S32 A;  2HIO D;  3B6G C;  3H0L C;  3AZI C;  4Z66 A;  3A6N B;  3MGP C;  5FUG A;  5GT3 A;  4J8U D;  3W96 C;  5AV5 C;  3MGQ B;  5AY8 D;  5B1L A;  5E5A C;  4KHA B;  4WU9 D;  5B40 D;  3WKJ B;  5JRG B;  3X1S A;  5AVB C;  3A1I A;  2XD5 A;  1P3F B;  2Y2Q A;  4KUD A;  3MGR D;  3MGS B;  3AZF D;  4NE3 A;  1M19 B;  3C1C C;  4H9R B;  1M1A B;  1ZLA A;  4H9Q A;  4YS3 D;  4Z66 D;  3MGS A;  5GXQ A;  5AV6 C;  5B1L B;  5B31 D;  3X1T D;  1ZLA D;  1W2E A;  3LZ0 C;  3LJA B;  2HIO B;  4JJN A;  3WKJ A;  4DRB A;  4R8P D;  2RVQ D;  3KXB C;  4H9Q B;  3EPL A;  3AZF A;  2ZM5 A;  4KUD D;  4EO5 B;  1HTA A;  5B2J A;  3A6N D;  3REJ C;  1EQZ D;  4J8U B;  3KUY B;  3X1S D;  1S32 B;  3LZ0 A;  1TZY A;  2ZY5 A;  4H9N A;  3VH6 W;  4QLC B;  3TU4 A;  5B33 B;  2Y2J A;  1F66 C;  3O62 A;  4Z2M G;  2IO5 B;  2NZD D;  5AV8 B;  3B0D C;  1P3K B;  1P3O B;  3MVD A;  4J8U A;  2XD1 A;  5GT3 D;  5AVC B;  5F99 A;  5DNN C;  5B0Y B;  4H9O A;  1KX3 C;  5CPI A;  3AYW B;  5B32 B;  1U35 C;  1P3P A;  2NQB C;  2CV5 C;  1AOI B;  2ZY4 A;  4YM6 B;  3LJA D;  3W99 B;  5C3I C;  2F8N H;  2FFF B;  4KGC B;  5GT0 D;  3MNN C;  3AZL D;  1B67 A;  4ZBJ B;  3MGP D;  1B6W A;  5AV5 D;  4Z5T C;  3LJA A;  4JJN B;  4CAY A;  5AY8 C;  4J8W D;  2Y2I A;  4H9P A;  2RIQ A;  3MVD B;  4WJ3 C;  2HUE C;  4WU8 C;  2NZD B;  5CP6 C;  5B40 C;  5CPK D;  3UT9 C;  1JFI B;  2Y2M A;  5B24 C;  5JA4 B;  5B2I D;  1KX5 D;  3WA9 C;  3REL D;  2ZY2 A;  1WWS A;  5B1M B;  4YS3 C;  3REK B;  1AOI A;  3TU4 D;  5F99 C;  3AZE D;  3W97 D;  2FJ7 A;  3LZ0 D;  4AWL C;  3AZN C;  3REI A;  3WAA A;  3W99 D;  3AYW A;  3AZK A;  3AZH B;  3R45 B;  3EPH A;  4KGC D;  4J8V A;  4LD9 B;  4XZQ D;  2BYM B;  5AV5 B;  3X1S C;  4JJN D;  3AV1 C;  3WTP E;  5CPJ B;  1P3K A;  1P3O A;  5B31 A;  3X1T A;  2PYO A;  5GXQ D;  2Y2P A;  3X1U A;  1F1E A;  4J8X B;  4G92 C;  2YFW A;  3WKJ C;  1PZR A;  1P3B B;  1P3F D;  1TAF B;  1ID3 A;  3AZF B;  3B6F A;  2CWE A;  1KX5 B;  4WU9 A;  3AZM A;  3WTP D;  1U35 A;  1P3P C;  3AZG D;  2F2A C;  2VQR A;  2NQB D;  3C1B B;  3TU4 B;  5B1L D;  5B31 B;  1H3O B;  3VH5 W;  3X1T B;  2ARO A;  3LZ0 B;  4H9R A;  1M1A A;  3H0R C;  2BYM A;  3AZH D;  3AZM C;  3KXB B;  3KWQ A;  3O62 C;  5GT0 C;  3AZL C;  4LD9 D;  5B31 G;  1EQZ B;  4Z5T D;  5CPJ D;  1S32 D;  1Z2C B;  3NQU A;  4QLC D;  5G49 B;  5AV9 A;  3AZJ A;  5B33 D;  4CSR A;  1HQ3 D;  5B2J C;  3LEL B;  5BT1 C;  1F66 B;  3LZ1 B;  2IO5 C;  3VH5 A;  3W98 D;  4H9S C;  5AV8 D;  5CP6 D;  1M19 A;  3B0D B;  3AV1 A;  1P3K C;  4XUJ B;  2DF4 C;  1P3O C;  1M18 D;  5FUG B;  5GT3 B;  3KSY A;  5DNN B;  5B0Y D;  3EG5 B;  3V9R B;  1BH9 A;  3KWQ C;  3AZG B;  2BG1 A;  3C1C A;  5B32 D;  5DNM B;  4G91 C;  1U35 B;  2NQB B;  2ARO C;  4UPK A;  3C1B D;  1AOI C;  4YM6 C;  1P3A A;  4KGC C;  2L5A A;  5B24 A;  3MGP B;  3UTA A;  4JJN C;  1KX4 B;  4YM6 A;  4J8W B;  4ZUX B;  3WA9 A;  1P3G C;  1P34 A;  5BNV A;  3MVD C;  3LEL D;  3LZ1 D;  3W98 B;  1P3M C;  5CP6 B;  3AZK B;  1P3L A;  3REI B;  3WAA B;  3UT9 B;  5BNV B;  4M6B A;  3X1V D;  5BS7 A;  5B2I B;  4J8V C;  3AN2 A;  4ZUX A;  3WA9 B;  1KX4 A;  3UTB B;  3REL B;  1P3M A;  5DNM A;  5DNM D;  3EPJ A;  3C1C B;  3AFA C;  3UTA B;  3V9R A;  3H0M C;  5B1M D;  3REK D;  2CV5 A;  3AZE B;  1ID3 C;  5B1L C;  4H9N B;  3REH B;  5BNX B;  4UUZ A;  2HIO C;  3KUY A;  3AZH C;  5GSU A;  3LZ1 A;  4LD9 C;  3AL0 C;  4XZQ B;  3AV2 C;  3REJ B;  4J8U C;  2F8N G;  3UT9 A;  1S32 C;  5CPI C;  4QLC C;  2F8N A;  4CAY B;  5GXQ B;  4HGA C;  5B33 C;  4WU8 A;  2YFV A;  5AVB A;  4J8X D;  1P3L C;  5AV8 C;  3A1K A;  1P3B D;  2FJ7 C;  5E5A A;  5B0Y C;  1P34 C;  3MNN A;  3AZF C;  5JRG A;  1BFM A;  3WTP B;  3NQU B;  3UTB D;  4KHA A;  1A7W A;  1N1J B;  3C1C D;  4DQY B;  5B32 C;  3REJ A;  3B6F B;  3AZI A;  5B0Y A;  5GSU B;  5B31 C;  3X1T C;  3AZJ C;  3NQJ A;  3REH D;  3MGQ A;  3P5J B;  3REH A;  2RVQ C;  4NFT A;  1KU5 A;  2Y2G A;  3IP4 C;  3KXB D;  3AZI D;  5B0Z A;  3B6G D;  3O62 B;  3MNN B;  1HQ3 A;  3REJ D;  1EQZ C;  5DNN A;  1BH8 A;  4Z5T B;  5B33 A;  3AZN A;  3W96 D;  4XUJ A;  1TZY B;  2DQN C;  2F8N K;  1P3G D;  1HQ3 B;  5E5A D;  1F66 D;  3LZ1 C;  4WU8 B;  1P3I A;  2NZD C;  5AV9 B;  4J8X A;  4XUJ D;  4WU9 C;  1M18 B;  5GT3 C;  5AVB D;  2Y2N A;  5DNN D;  3MGR C;  2PYO B;  4WZS B;  5DNM C;  2ZY3 A;  1P3I C;  3AFA D;  3WTP A;  1U35 D;  4UUZ B;  5B1M C;  3REK C;  3B6F D;  2Y2H A;  3R45 A;  5JA4 A;  5GSU D;  4Z66 C;  1ID3 D;  1P3F A;  1ZLA C;  4X23 A;  3NQJ B;  3UTB A;  3B6G B;  3FDD A;  4R8P C;  5B1M A;  3REK A;  3MNN D;  5B0Z C;  3AN2 B;  4CSR B;  4KUD C;  3A6N C;  1P3B A;  4X23 B;  1KX4 D;  2LY8 A;  3MGQ C;  2BYK B;  4J8W C;  4ZUX D;  4H9S A;  3X1V A;  4KGC A;  4WU8 D;  4J8X C;  4G92 B;  1P3L D;  2Y2O A;  1P3M B;  3AZK D;  3REI D;  3WAA D;  1P3B C;  5JRG C;  3UT9 D;  3VH6 A;  3LEL A;  2FJ7 D;  3X1U C;  1R4V A;  3X1V B;  3AZE A;  1P34 D;  5B2I C;  3MGS C;  1KX5 C;  3WA9 D;  5G49 A;  1P3P B;  3UTB C;  3REL C;  1P3A B;  3AFA B;  3UTA D;  1M1A C;  2UWX A;  3TU4 C;  3AZE C;  1ID3 B;  2CV5 D;  3REH C;  4DRA A;  3LJA C;  2YFW B;  3B0C T;  1BH8 B;  1WWI A;  1Q9C A;  3AN2 D;  4XZQ C;  4X23 D;  3KUY C;  4J8W A;  5CPI B;  5GXQ C;  5AV5 A;  2Y2L A;  3MGP A;  1ULY A;  5B2J B;  3AFA A;  1P3L B;  1N1J A;  2JCH A;  3W98 A;  2BYK A;  4XUJ C;  5CPK C;  5AVC C;  5B24 D;  3B0C W;  3WTP C;  1P3P D;  1KX3 B;  3KWQ B;  3AZG C;  4Z5T A;  1P3I D;  3AYW C;  1P3A D;  1F66 A;  2ARO B;  5KDM A;  3B6F C;  2Y2K A;  5GSU C;  3C1B A;  1P3G A;  5F99 D;  3AZH A;  3W97 C;  3W96 A;  5B32 A;  3AZN D;  3W99 C;  3VH6 T;  5C3I B;  2NZD A;  3AZI B;  3O62 D;  5B0Z D;  3B6G A;  3KXB A;  4E45 A;  3W96 B;  1KX4 C;  3VH5 T;  3MGQ D;  3AV1 D;  1M18 A;  1TZY D;  5AY8 B;  4ZUX C;  5CP6 A;  1P3G B;  5AV8 A;  1HQ3 C;  5E5A B;  5B2J D;  3W98 C;  5AV9 D;  3AZK C;  4QLC A;  2JSS A;  4NE5 A;  1M18 C;  5B40 B;  3WAA C;  3REI C;  3WKJ D;  5JRG D;  5CPJ A;  4E44 A;  5AVB B;  4H9P B;  3X1U D;  1P3F C;  4J8V B;  5B24 B;  4LD9 A;  3MGS D;  3MGR B;  4YS3 A;  2PYO D;  3KWQ D;  1M19 C;  1P3I B;  3UTA C;  4XZQ A;  1M1A D;  2G5H C;  2ARO D;  3MGR A;  4YS3 B;  4Z2M H;  4WNN B;  5AV6 B;  2F8N D;  2NQB A;  3W99 A;  4AWL B;  3AZN B;  5B40 A;  3AZG A;  4R8P B;  3AZM D;  3AN2 C;  5B0Z B;  3AV2 B;  4KUD B;  4EO5 C;  1JFI A;  4X23 C;  3KUY D;  3B0B A;  3X1S B;  5CPJ C;  3AV1 B;  5AY8 A;  1KX5 A;  2JE5 A;  4HGA B;  5B2I A;  5BT1 D;  1P3M D;  2HIO A;  1P3K D;  1P3O D;  2FJ7 B;  3X1U B;  3X1V C;  1P34 B;  5AVC D;  4J8V D;  2G5I C;  5KDM B;  3AYW D;  1P3A C;  1T3U A;  5BNX A;  1KX3 A;  3W97 A;  2YFV B;  5BS7 C;  2CV5 B;  3C1B C;  3AZJ B;  5AV6 D;  1AOI D;  2F8N B;  4YM6 D;  3EPK A;  3REL A;  3AZM B;  3KFU G;  3AV2 D;  5BO0 B;  5GT0 B;  3AZL B;  2W8S A;  3F6T A;  4WV4 B;  4ZBJ C;  5CPK A;  1BH9 B;  5CPI D;  1TZY C;  1H3O A;  5B32 G;  3AV2 A;  3MVD D;  3LEL C;  2HUE B;  4NE6 A;  5AV9 C;  4WU9 B;  4H9O B;  5CPK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...