5GSUA

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuA00
5CPJC 4YS3A 5GT3A 1P3GB 1M19B 3A6NA 3UT9D 3KXBA 3REIB 3X1VB 3AZMB 2NZDC 1EQZC 4X23D 1P3FC 5GXQA 1Q9CA 4UUZB 1P3OD 5B33A 3WKJD 3B6GC 1U35D 3AYWB 2NQBB 1P3KB 3REJC 5B0ZC 5JA4B 3AV1D 3AZGB 3AZHC 1M18C 5B24B 3AZFD 4J8UD 3X1SA 1P3PA 5DNNC 1ZLAD 3W96B 4DRAA 3WAAA 3W97A 3REKD 4QLCD 3MGSA 5CPIB 3WTPC 5AV6D 2AROC 1HQ3B 2NZDA 1P3ID 3RELC 4KGCD 1EQZA 3KWQB 1P3BA 1P3MA 5AY8C 3AZEC 4J8VD 3UT9C 2F8NK 4WU9A 3O62B 5CPKB 1P3AA 5AV5C 3TU4C 3KUYC 3REJA 4XUJA 4EO5B 3LZ1A 3AZJA 4H9SA 4Z66D 3VH5A 4J8WB 1U35C 3MVDB 2F8NB 4M6BA 1M18A 1S32A 3LZ0B 5B31B 3LELA 5DNMB 4NE6A 4WNNA 3UTBA 1M1AB 5B2IC 5BT1C 1ID3D 5B1LD 3AN2C 5B32B 2PYOC 2IO5B 3AZIB 1HTAA 4XZQC 2YFWB 4X23B 2AROA 1ZLAC 3X1TD 3WKJB 3AFAC 5B2JD 3AZEA 4WU8B 3AZKB 3AV1B 1R4VA 5AV9D 3KUYA 5AVBD 2JSSA 3W99B 4YS3D 3REKB 1TAFB 4QLCB 3W98C 5KDMA 4ZBJB 4CSRA 1BH8B 4Z5TC 2BYKA 4KGCB 5GXQD 1KX3B 4KUDB 3X1UC 1P3LA 3REHC 3C1BC 4J8XC 4ZUXD 4JJNA 3AFAA 5CP6C 3AV2B 4Z66B 3MGPD 1AOIC 3W97D 1ID3B 3MGSD 2L5AA 5CPJD 2FJ7A 3MGRC 5AVBC 1BH9A 3W98A 1H3OB 2NZDD 1EQZD 1P3BD 1P3MD 4Z5TA 3WTPE 1F1EA 5GT3C 3X1TB 1P3FD 1WWSA 3A6NC 3KXBC 3X1UA 4WU9D 3B6GD 3MNNA 4E44A 5B40A 3REJD 5B0ZD 5B33C 5AV9B 3AZNA 1M18D 3B6FA 5FUGB 4YS3B 5DNND 4H9PB 3NQJB 1AOIA 3AZLC 3WTPD 1P34B 1P3PC 3X1SC 3MGRA 2AROD 3WAAC 3RELD 5GT0A 3W97C 4E45A 5F99B 3MGSC 3UTAB 5AY8D 3AZED 4R8PA 3NQUB 4ZUXB 1P3BC 1P3MC 4CAYB 5AV5D 5AV8A 3TU4D 3KUYD 3MGPB 2CV5B 4WU9C 1P3AC 5C3IB 3WA9B 2HIOB 3C1CA 4XUJC 5B0YB 3LZ1C 3AZJC 4NE5A 4H9SC 5CPJB 5BT1D 5B2ID 3AN2D 2PYOD 1S32C 3LELC 4WZSB 3LJAA 3AZLA 4XZQD 4YM6A 1P3FB 5GSUA 3UTBC 5E5AA 3AZGC 3B6GB 5B1MA 3AFAD 1KX4A 4LD9C 5B0ZB 5JRGA 1F66A 3MGQB 3AZHB 1TZYB 1A7WA 5DNMD 1P3GA 1M19A 3R45B 3X1VA 3REIA 3AZMA 1HQ3C 5DNNB 4H9NB 4H9RB 4UUZA 3W98D 3WTPB 4H9OB 5CPKC 3AYWA 2NQBA 4Z5TD 5BNVB 1P3KA 3RELB 5BNXB 3X1UD 5AY8B 1N1JB 5JA4A 4J8WC 3UT9B 3AZGA 2F8NH 3REHD 5B40D 3C1BD 4J8XD 5B32G 5B24A 5AV5B 1P3LC 3TU4B 4LD9A 4WV4B 1P3OB 3AZND 3W96A 5CP6D 3B6FD 5B32C 2IO5C 1U35B 3VH6A 4JJNC 5BS7C 3AZIC 3VH6T 4DRBA 5CPIA 1AOID 1HQ3A 5B2IB 3AN2B 4AWLB 2PYOB 1B67A 3MGRD 4WU8C 3AZFB 4Z2MH 4XZQB 3AZKC 4J8UB 5GT0D 3O62A 5CPKA 4H9QB 5G49B 1ZLAB 1WWIA 5GT3D 2FJ7C 4R8PD 3A6ND 3KXBD 5AV6B 4J8WA 3W99C 3MVDA 5AV8D 2F8NA 1P3IB 3LZ0A 3V9RB 5B31A 5B33D 5DNMA 2BYMB 4J8VB 3MNNC 1M1AA 4G91C 4ZBJC 2HUEC 5B32A 5B40C 4KUDC 3AZIA 5BS7A 2YFWA 4X23A 3AZNC 1JFIB 3B6FC 5AVCC 3WKJA 3VH6W 3AZLD 1P3PD 3X1SD 5GSUD 4WU8A 3B0DB 3AZKA 3WAAD 5CHLB 3AV2C 5B1LB 5B1MD 3REHB 3C1BB 4J8XB 5JRGD 5GT0C 3W99A 5CP6B 4R8PC 4G92B 3REKA 1TAFA 4QLCA 3X1VD 5B2JB 1P3AD 5AV8C 1BH8A 4HGAC 4KGCA 4XUJD 1KX3A 4KUDA 5BO0B 2YFVB 3LZ1D 3AZJD 3MGRB 5AVBB 1P3KD 1S32D 5AVCA 3LELD 3C1CC 5GT3B 3UTBD 3A6NB 3KXBB 3AZGD 3AV2A 4Z66A 3LJAC 4YM6C 4LD9D 5GXQB 5GSUC 5E5AC 5B33B 1ID3A 5B1MC 1KX5C 1KX4C 1P34C 5JRGC 1H3OA 1HQ3D 1F66C 5F99C 4NFTA 3X1TA 1P3GC 1M19C 3X1VC 3REIC 3AZMC 1P3PB 3X1SB 5CPKD 3WAAB 3W97B 3MGSB 2CV5C 2RVQC 4KHAA 4J8WD 3AYWC 2NQBC 3MVDD 1P3KC 2NZDB 5FUGA 1EQZB 3LZ0D 5B31D 1P3BB 1P3MB 1P3LD 1M1AD 4H9PA 3NQJA 5B32D 4WU9B 1P3AB 5B24C 4JJND 3AZID 1KX5A 1P34A 3REJB 4XUJB 3W96C 3LZ1B 3AZJB 5F99A 3UTAA 1M18B 1S32B 5CPIC 3LELB 4WU8D 3NQUA 4ZUXA 3AZKD 4WNNB 3UTBB 3KWQC 3MGQC 4CAYA 1TZYC 3KSYA 2FJ7D 3MGPA 2CV5A 4LD9B 3O62C 2AROB 3W99D 3WA9A 2LY8A 2HIOA 3B0CT 2F8NG 4NE3A 5B0YA 4EO5C 3AZEB 5B31G 5CPJA 3MNND 3MVDC 3LZ0C 1KX3D 5B31C 4KUDD 5DNMC 1P3FA 3KUYB 1M1AC 1KU5A 5AVCD 3B6GA 4X23C 1P3OC 5B0ZA 5KDMB 3AV2D 3WKJC 4Z2MG 4CSRB 3KWQA 1B6WA 3VH5T 3MGQA 1TZYA 2BYKB 3AZHA 3R45A 1P3LB 3AV1C 5DNNA 4H9NA 4AWLC 4H9RA 4JJNB 3AZFC 3AFAB 3WTPA 4J8UC 4H9OA 3B0CW 5BNVA 3RELA 3REKC 5BNXA 4QLCC 5AY8A 1N1JA 5AV6C 3UT9A 1P3IC 3C1CD 4KGCC 1KX3C 5AV5A 2FJ7B 3TU4A 1BH9B 4J8VC 1P3OA 3W98B 1U35A 3LJAD 4Z5TB 4YM6D 5E5AD 3X1UB 4Z66C 3MNNB 3VH5W 3AV1A 5B2IA 4G91B 2HUEB 3AN2A 5B40B 1KX4D 1P34D 1KX5D 2PYOA 3AZFA 3B0DC 4XZQA 1F66D 4J8UA 5F99D 4H9QA 5G49A 3AZNB 3UTAD 5B1LC 1ID3C 1ZLAA 3B6FB 5AVCB 1P3GD 1M19D 3REID 3AZMD 5AV6A 1AOIB 3X1TC 1P3IA 4G92C 3V9RA 2CV5D 2RVQD 2BYMA 2CWEA 5B2JC 4J8VA 3AYWD 2NQBD 1BFMA 3WA9D 2HIOD 5GT0B 5B0YD 1ULYA 5AV9C 4R8PB 1JFIA 5B24D 5AV8B 4HGAB 4YS3C 3W96D 5B1LA 5CPID 3REHA 3B0BA 3C1BA 5GXQC 3C1CB 4J8XA 4KHAB 3KWQD 3MGQD 3UTAC 3AZHD 1TZYD 5CP6A 4ZUXC 3LJAB 3AZLB 4YM6B 5GSUB 5B2JA 3O62D 5E5AB 5B1MB 5BO0A 1KX5B 2YFVA 3MGPC 1KX4B 5AV9A 5C3IC 5AVBA 2F8ND 5JRGB 3WA9C 2HIOC 1F66B 5B0YC
chains in the Genus database with same CATH superfamily
5CPJC 4YS3A 5GT3A 1P3GB 1M19B 3A6NA 3UT9D 3KXBA 3REIB 3X1VB 3AZMB 2NZDC 1EQZC 2ZY3A 2Y2MA 4X23D 1P3FC 3H0RC 2DF4C 5GXQA 1Q9CA 4UUZB 1P3OD 5B33A 2Y2OA 3WKJD 3B6GC 2Y2KA 3AYWB 1U35D 2NQBB 1P3KB 3REJC 5B0ZC 5JA4B 3AV1D 3AZGB 3AZHC 1M18C 5B24B 3AZFD 2J8PA 4J8UD 3X1SA 1P3PA 3H0MC 5DNNC 1ZLAD 3W96B 3IP4C 4DRAA 3WAAA 2F2AC 3W97A 3REKD 4QLCD 3MGSA 5CPIB 2XD5A 3WTPC 5AV6D 2FFFB 2AROC 1HQ3B 2NZDA 1P3ID 3RELC 4KGCD 1EQZA 3KWQB 1P3BA 1P3MA 5AY8C 3AZEC 2ZY4A 4J8VD 3UT9C 2F8NK 4WU9A 3O62B 5CPKB 1P3AA 5AV5C 3TU4C 3KUYC 3REJA 4XUJA 4EO5B 3LZ1A 3AZJA 4H9SA 4Z66D 3VH5A 4J8WB 1U35C 3MVDB 2F8NB 4M6BA 1M18A 1S32A 3LZ0B 5B31B 3LELA 5DNMB 4NE6A 4WNNA 3UTBA 1M1AB 5B2IC 5BT1C 1ID3D 5B1LD 3AN2C 5B32B 2PYOC 2IO5B 3AZIB 1HTAA 2Y2JA 4XZQC 2YFWB 4X23B 3EPLA 2AROA 1ZLAC 3X1TD 3WKJB 2RIQA 3AFAC 5B2JD 3AZEA 4WU8B 3AZKB 3AV1B 1R4VA 5AV9D 3KUYA 5AVBD 2JSSA 3W99B 4YS3D 3REKB 1TAFB 4QLCB 3W98C 5KDMA 4ZBJB 4CSRA 1BH8B 4Z5TC 2BYKA 4KGCB 5GXQD 1KX3B 4KUDB 3X1UC 1P3LA 3REHC 3C1BC 4J8XC 4ZUXD 4JJNA 3EG5B 3AFAA 2Y2HA 5CP6C 3AV2B 4Z66B 3MGPD 1AOIC 3W97D 1ID3B 3MGSD 2L5AA 5CPJD 2FJ7A 1T3UA 3MGRC 5AVBC 1BH9A 3W98A 1H3OB 2NZDD 1EQZD 1P3BD 1P3MD 4Z5TA 3WTPE 1F1EA 5GT3C 3X1TB 1P3FD 1WWSA 3A1KA 3A6NC 3KXBC 3X1UA 3EPJA 4WU9D 3B6GD 3MNNA 4E44A 5B40A 3REJD 5B0ZD 5B33C 5AV9B 3AZNA 1M18D 3B6FA 5FUGB 4YS3B 2ZY2A 5DNND 4H9PB 3NQJB 1AOIA 3AZLC 3WTPD 1P34B 1P3PC 3X1SC 3MGRA 2AROD 3WAAC 3RELD 5GT0A 3W97C 4E45A 5F99B 3MGSC 3UTAB 5AY8D 3AZED 4R8PA 3NQUB 4ZUXB 1P3BC 1P3MC 4CAYB 5AV5D 5AV8A 3TU4D 3KUYD 3MGPB 2CV5B 4WU9C 1P3AC 3FDDA 5C3IB 3WA9B 2HIOB 3C1CA 4XUJC 5B0YB 4UPKA 3LZ1C 3AZJC 4NE5A 4H9SC 5CPJB 5BT1D 5B2ID 3AN2D 2PYOD 1S32C 3LELC 4WZSB 3LJAA 3AZLA 4XZQD 4YM6A 1P3FB 5GSUA 3UTBC 2BG1A 5E5AA 3AZGC 3B6GB 5B1MA 3AFAD 1KX4A 4LD9C 5B0ZB 5JRGA 1F66A 3MGQB 3AZHB 1TZYB 1A7WA 5DNMD 1P3GA 1M19A 3R45B 3X1VA 3REIA 3AZMA 1HQ3C 3AL0C 5DNNB 4H9NB 4H9RB 4UUZA 3W98D 3WTPB 4H9OB 5CPKC 3AYWA 2NQBA 4Z5TD 5BNVB 1P3KA 3RELB 5BNXB 3X1UD 5AY8B 1N1JB 5JA4A 4J8WC 3UT9B 3AZGA 2F8NH 3REHD 5B40D 3C1BD 4J8XD 3P5JB 5B32G 2VQRA 5B24A 5AV5B 1P3LC 3TU4B 4LD9A 4WV4B 4WJ3C 1P3OB 3AZND 3W96A 5CP6D 3B6FD 5B32C 2IO5C 1U35B 3VH6A 4JJNC 5BS7C 3AZIC 3VH6T 4DRBA 5CPIA 1AOID 1HQ3A 5B2IB 3AN2B 4AWLB 2PYOB 1B67A 3MGRD 4WU8C 2Y2LA 4Z2MH 3AZFB 4XZQB 3AZKC 4J8UB 5GT0D 3O62A 5CPKA 4H9QB 5G49B 1ZLAB 1WWIA 5GT3D 2FJ7C 4R8PD 3A6ND 3KXBD 1W2EA 5AV6B 4J8WA 3W99C 3MVDA 5AV8D 4DQYB 2F8NA 1P3IB 3LZ0A 3V9RB 5B31A 5B33D 5DNMA 2BYMB 3A1IA 4J8VB 3MNNC 1M1AA 4G91C 4ZBJC 2HUEC 5B32A 5B40C 4KUDC 3AZIA 5BS7A 2YFWA 4X23A 3AZNC 1JFIB 3B6FC 5AVCC 3WKJA 3VH6W 3AZLD 1P3PD 3X1SD 5GSUD 4WU8A 3B0DB 3AZKA 3WAAD 5CHLB 3AV2C 5B1LB 5B1MD 3REHB 3C1BB 3F6TA 4J8XB 5JRGD 5GT0C 3W99A 5CP6B 4R8PC 4G92B 3REKA 1TAFA 4QLCA 3X1VD 5B2JB 1P3AD 5AV8C 1BH8A 4HGAC 4KGCA 4XUJD 1KX3A 4KUDA 5BO0B 2YFVB 3LZ1D 3AZJD 3MGRB 5AVBB 1P3KD 1S32D 5AVCA 3LELD 3C1CC 3KFUG 5GT3B 3UTBD 3A6NB 3KXBB 3AZGD 3AV2A 4Z66A 2G5HC 3LJAC 4YM6C 4LD9D 5GXQB 5GSUC 5E5AC 5B33B 2ZM5A 2ZY5A 1ID3A 5B1MC 1KX5C 1KX4C 1P34C 2JE5A 5JRGC 1H3OA 1HQ3D 1F66C 5F99C 4NFTA 3X1TA 1P3GC 1M19C 3X1VC 3REIC 3AZMC 1P3PB 3X1SB 5CPKD 3WAAB 3W97B 3MGSB 2CV5C 2RVQC 4KHAA 2Y2QA 4J8WD 3AYWC 2NQBC 3MVDD 1P3KC 2NZDB 5FUGA 1EQZB 3LZ0D 5B31D 1P3BB 1P3MB 1P3LD 1M1AD 4H9PA 3NQJA 5B32D 4WU9B 1P3AB 5B24C 4JJND 3AZID 1KX5A 1P34A 3REJB 4XUJB 3W96C 2XD1A 3LZ1B 3AZJB 5F99A 3UTAA 1M18B 1S32B 5CPIC 3EPHA 3LELB 4WU8D 3NQUA 4ZUXA 3AZKD 2JCHA 4WNNB 3UTBB 3KWQC 3MGQC 4CAYA 1TZYC 3KSYA 2FJ7D 1Z2CB 3MGPA 2CV5A 4LD9B 3O62C 2AROB 3W99D 3WA9A 2LY8A 2HIOA 2Y2PA 3B0CT 2F8NG 4NE3A 2W8SA 5B0YA 4EO5C 3AZEB 5B31G 5CPJA 3MNND 3MVDC 3LZ0C 1KX3D 5B31C 4KUDD 5DNMC 1P3FA 3KUYB 1M1AC 1KU5A 5AVCD 3B6GA 4X23C 3H0LC 1P3OC 5B0ZA 5KDMB 3AV2D 3WKJC 4Z2MG 4CSRB 2Y2IA 1B6WA 3VH5T 3KWQA 1TZYA 2BYKB 3MGQA 3AZHA 3R45A 1P3LB 3AV1C 5DNNA 4H9NA 4AWLC 4H9RA 4JJNB 3AZFC 3AFAB 3WTPA 4J8UC 4H9OA 3B0CW 5BNVA 3RELA 3REKC 5BNXA 4QLCC 5AY8A 1N1JA 5AV6C 3UT9A 1P3IC 3C1CD 4KGCC 1KX3C 5AV5A 2FJ7B 3TU4A 2Y2GA 1BH9B 4J8VC 1P3OA 3W98B 1U35A 3LJAD 4Z5TB 4YM6D 2Y2NA 5E5AD 3X1UB 4Z66C 3MNNB 3VH5W 3AV1A 5B2IA 4G91B 2HUEB 3AN2A 5B40B 1KX4D 1P34D 1KX5D 2PYOA 3AZFA 3B0DC 4XZQA 1F66D 4J8UA 5F99D 4H9QA 5G49A 3AZNB 3UTAD 5B1LC 1ID3C 1ZLAA 3B6FB 5AVCB 1P3GD 1M19D 3REID 3AZMD 5AV6A 1AOIB 3X1TC 1P3IA 4G92C 3V9RA 2CV5D 2RVQD 2BYMA 2CWEA 2UWXA 5B2JC 4J8VA 3AYWD 2NQBD 3WA9D 1BFMA 3EPKA 2HIOD 5GT0B 5B0YD 1ULYA 5AV9C 4R8PB 1JFIA 5B24D 5AV8B 4HGAB 4YS3C 3W96D 5B1LA 5CPID 2G5IC 3B0BA 3REHA 3C1BA 5GXQC 3C1CB 4J8XA 4KHAB 3KWQD 3MGQD 3UTAC 3AZHD 1TZYD 5CP6A 4ZUXC 3LJAB 3AZLB 4YM6B 5GSUB 5B2JA 3O62D 5E5AB 5B1MB 5BO0A 2DQNC 2YFVA 3MGPC 1KX4B 1KX5B 5AV9A 1PZRA 5AVBA 5C3IC 2F8ND 5JRGB 3WA9C 2HIOC 1F66B 5B0YC
chains in the Genus database with same CATH topology
5CPJC 4YS3A 5GT3A 1P3GB 1M19B 3A6NA 3UT9D 3KXBA 3REIB 3X1VB 3AZMB 2NZDC 1EQZC 2ZY3A 2Y2MA 4X23D 1P3FC 3H0RC 2DF4C 5GXQA 1Q9CA 4UUZB 1P3OD 5B33A 2Y2OA 3WKJD 3B6GC 2Y2KA 3AYWB 1U35D 2NQBB 1P3KB 3REJC 5B0ZC 5JA4B 3AV1D 3AZGB 3AZHC 1M18C 5B24B 3AZFD 2J8PA 4J8UD 3X1SA 1P3PA 3H0MC 5DNNC 1ZLAD 3W96B 3IP4C 4DRAA 3WAAA 2F2AC 3W97A 3REKD 4QLCD 3MGSA 5CPIB 2XD5A 3WTPC 5AV6D 2FFFB 2AROC 1HQ3B 2NZDA 1P3ID 3RELC 4KGCD 1EQZA 3KWQB 1P3BA 1P3MA 5AY8C 3AZEC 2ZY4A 4J8VD 3UT9C 2F8NK 4WU9A 3O62B 5CPKB 1P3AA 5AV5C 3TU4C 3KUYC 3REJA 4XUJA 4EO5B 3LZ1A 3AZJA 4H9SA 4Z66D 3VH5A 4J8WB 1U35C 3MVDB 2F8NB 4M6BA 1M18A 1S32A 3LZ0B 5B31B 3LELA 5DNMB 4NE6A 4WNNA 3UTBA 1M1AB 5B2IC 5BT1C 1ID3D 5B1LD 3AN2C 5B32B 2PYOC 2IO5B 3AZIB 1HTAA 2Y2JA 4XZQC 2YFWB 4X23B 3EPLA 2AROA 1ZLAC 3X1TD 3WKJB 2RIQA 3AFAC 5B2JD 3AZEA 4WU8B 3AZKB 3AV1B 1R4VA 5AV9D 3KUYA 5AVBD 2JSSA 3W99B 4YS3D 3REKB 1TAFB 4QLCB 3W98C 5KDMA 4ZBJB 4CSRA 1BH8B 4Z5TC 2BYKA 4KGCB 5GXQD 1KX3B 4KUDB 3X1UC 1P3LA 3REHC 3C1BC 4J8XC 4ZUXD 4JJNA 3EG5B 3AFAA 2Y2HA 5CP6C 3AV2B 4Z66B 3MGPD 1AOIC 3W97D 1ID3B 3MGSD 2L5AA 5CPJD 2FJ7A 1T3UA 3MGRC 5AVBC 1BH9A 3W98A 1H3OB 2NZDD 1EQZD 1P3BD 1P3MD 4Z5TA 3WTPE 1F1EA 5GT3C 3X1TB 1P3FD 1WWSA 3A1KA 3A6NC 3KXBC 3X1UA 3EPJA 4WU9D 3B6GD 3MNNA 4E44A 5B40A 3REJD 5B0ZD 5B33C 5AV9B 3AZNA 1M18D 3B6FA 5FUGB 4YS3B 2ZY2A 5DNND 4H9PB 3NQJB 1AOIA 3AZLC 3WTPD 1P34B 1P3PC 3X1SC 3MGRA 2AROD 3WAAC 3RELD 5GT0A 3W97C 4E45A 5F99B 3MGSC 3UTAB 5AY8D 3AZED 4R8PA 3NQUB 4ZUXB 1P3BC 1P3MC 4CAYB 5AV5D 5AV8A 3TU4D 3KUYD 3MGPB 2CV5B 4WU9C 1P3AC 3FDDA 5C3IB 3WA9B 2HIOB 3C1CA 4XUJC 5B0YB 4UPKA 3LZ1C 3AZJC 4NE5A 4H9SC 5CPJB 5BT1D 5B2ID 3AN2D 2PYOD 1S32C 3LELC 4WZSB 3LJAA 3AZLA 4XZQD 4YM6A 1P3FB 5GSUA 3UTBC 2BG1A 5E5AA 3AZGC 3B6GB 5B1MA 3AFAD 1KX4A 4LD9C 5B0ZB 5JRGA 1F66A 3MGQB 3AZHB 1TZYB 1A7WA 5DNMD 1P3GA 1M19A 3R45B 3X1VA 3REIA 3AZMA 1HQ3C 3AL0C 5DNNB 4H9NB 4H9RB 4UUZA 3W98D 3WTPB 4H9OB 5CPKC 3AYWA 2NQBA 4Z5TD 5BNVB 1P3KA 3RELB 5BNXB 3X1UD 5AY8B 1N1JB 5JA4A 4J8WC 3UT9B 3AZGA 2F8NH 3REHD 5B40D 3C1BD 4J8XD 3P5JB 5B32G 2VQRA 5B24A 5AV5B 1P3LC 3TU4B 4LD9A 4WV4B 4WJ3C 1P3OB 3AZND 3W96A 5CP6D 3B6FD 5B32C 2IO5C 1U35B 3VH6A 4JJNC 5BS7C 3AZIC 3VH6T 4DRBA 5CPIA 1AOID 1HQ3A 5B2IB 3AN2B 4AWLB 2PYOB 1B67A 3MGRD 4WU8C 2Y2LA 4Z2MH 3AZFB 4XZQB 3AZKC 4J8UB 5GT0D 3O62A 5CPKA 4H9QB 5G49B 1ZLAB 1WWIA 5GT3D 2FJ7C 4R8PD 3A6ND 3KXBD 1W2EA 5AV6B 4J8WA 3W99C 3MVDA 5AV8D 4DQYB 2F8NA 1P3IB 3LZ0A 3V9RB 5B31A 5B33D 5DNMA 2BYMB 3A1IA 4J8VB 3MNNC 1M1AA 4G91C 4ZBJC 2HUEC 5B32A 5B40C 4KUDC 3AZIA 5BS7A 2YFWA 4X23A 3AZNC 1JFIB 3B6FC 5AVCC 3WKJA 3VH6W 3AZLD 1P3PD 3X1SD 5GSUD 4WU8A 3B0DB 3AZKA 3WAAD 5CHLB 3AV2C 5B1LB 5B1MD 3REHB 3C1BB 3F6TA 4J8XB 5JRGD 5GT0C 3W99A 5CP6B 4R8PC 4G92B 3REKA 1TAFA 4QLCA 3X1VD 5B2JB 1P3AD 5AV8C 1BH8A 4HGAC 4KGCA 4XUJD 1KX3A 4KUDA 5BO0B 2YFVB 3LZ1D 3AZJD 3MGRB 5AVBB 1P3KD 1S32D 5AVCA 3LELD 3C1CC 3KFUG 5GT3B 3UTBD 3A6NB 3KXBB 3AZGD 3AV2A 4Z66A 2G5HC 3LJAC 4YM6C 4LD9D 5GXQB 5GSUC 5E5AC 5B33B 2ZM5A 2ZY5A 1ID3A 5B1MC 1KX5C 1KX4C 1P34C 2JE5A 5JRGC 1H3OA 1HQ3D 1F66C 5F99C 4NFTA 3X1TA 1P3GC 1M19C 3X1VC 3REIC 3AZMC 1P3PB 3X1SB 5CPKD 3WAAB 3W97B 3MGSB 2CV5C 2RVQC 4KHAA 2Y2QA 4J8WD 3AYWC 2NQBC 3MVDD 1P3KC 2NZDB 5FUGA 1EQZB 3LZ0D 5B31D 1P3BB 1P3MB 1P3LD 1M1AD 4H9PA 3NQJA 5B32D 4WU9B 1P3AB 5B24C 4JJND 3AZID 1KX5A 1P34A 3REJB 4XUJB 3W96C 2XD1A 3LZ1B 3AZJB 5F99A 3UTAA 1M18B 1S32B 5CPIC 3EPHA 3LELB 4WU8D 3NQUA 4ZUXA 3AZKD 2JCHA 4WNNB 3UTBB 3KWQC 3MGQC 4CAYA 1TZYC 3KSYA 2FJ7D 1Z2CB 3MGPA 2CV5A 4LD9B 3O62C 2AROB 3W99D 3WA9A 2LY8A 2HIOA 2Y2PA 3B0CT 2F8NG 4NE3A 2W8SA 5B0YA 4EO5C 3AZEB 5B31G 5CPJA 3MNND 3MVDC 3LZ0C 1KX3D 5B31C 4KUDD 5DNMC 1P3FA 3KUYB 1M1AC 1KU5A 5AVCD 3B6GA 4X23C 3H0LC 1P3OC 5B0ZA 5KDMB 3AV2D 3WKJC 4Z2MG 4CSRB 2Y2IA 1B6WA 3VH5T 3KWQA 1TZYA 2BYKB 3MGQA 3AZHA 3R45A 1P3LB 3AV1C 5DNNA 4H9NA 4AWLC 4H9RA 4JJNB 3AZFC 3AFAB 3WTPA 4J8UC 4H9OA 3B0CW 5BNVA 3RELA 3REKC 5BNXA 4QLCC 5AY8A 1N1JA 5AV6C 3UT9A 1P3IC 3C1CD 4KGCC 1KX3C 5AV5A 2FJ7B 3TU4A 2Y2GA 1BH9B 4J8VC 1P3OA 3W98B 1U35A 3LJAD 4Z5TB 4YM6D 2Y2NA 5E5AD 3X1UB 4Z66C 3MNNB 3VH5W 3AV1A 5B2IA 4G91B 2HUEB 3AN2A 5B40B 1KX4D 1P34D 1KX5D 2PYOA 3AZFA 3B0DC 4XZQA 1F66D 4J8UA 5F99D 4H9QA 5G49A 3AZNB 3UTAD 5B1LC 1ID3C 1ZLAA 3B6FB 5AVCB 1P3GD 1M19D 3REID 3AZMD 5AV6A 1AOIB 3X1TC 1P3IA 4G92C 3V9RA 2CV5D 2RVQD 2BYMA 2CWEA 2UWXA 5B2JC 4J8VA 3AYWD 2NQBD 3WA9D 1BFMA 3EPKA 2HIOD 5GT0B 5B0YD 1ULYA 5AV9C 4R8PB 1JFIA 5B24D 5AV8B 4HGAB 4YS3C 3W96D 5B1LA 5CPID 2G5IC 3B0BA 3REHA 3C1BA 5GXQC 3C1CB 4J8XA 4KHAB 3KWQD 3MGQD 3UTAC 3AZHD 1TZYD 5CP6A 4ZUXC 3LJAB 3AZLB 4YM6B 5GSUB 5B2JA 3O62D 5E5AB 5B1MB 5BO0A 2DQNC 2YFVA 3MGPC 1KX4B 1KX5B 5AV9A 1PZRA 5AVBA 5C3IC 2F8ND 5JRGB 3WA9C 2HIOC 1F66B 5B0YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ C;  4YS3 A;  5GT3 A;  1P3G B;  1M19 B;  3A6N A;  3UT9 D;  3KXB A;  3REI B;  3X1V B;  3AZM B;  2NZD C;  1EQZ C;  4X23 D;  1P3F C;  5GXQ A;  1Q9C A;  4UUZ B;  1P3O D;  5B33 A;  3WKJ D;  3B6G C;  1U35 D;  3AYW B;  2NQB B;  1P3K B;  3REJ C;  5B0Z C;  5JA4 B;  3AV1 D;  3AZG B;  3AZH C;  1M18 C;  5B24 B;  3AZF D;  4J8U D;  3X1S A;  1P3P A;  5DNN C;  1ZLA D;  3W96 B;  4DRA A;  3WAA A;  3W97 A;  3REK D;  4QLC D;  3MGS A;  5CPI B;  3WTP C;  5AV6 D;  2ARO C;  1HQ3 B;  2NZD A;  1P3I D;  3REL C;  4KGC D;  1EQZ A;  3KWQ B;  1P3B A;  1P3M A;  5AY8 C;  3AZE C;  4J8V D;  3UT9 C;  2F8N K;  4WU9 A;  3O62 B;  5CPK B;  1P3A A;  5AV5 C;  3TU4 C;  3KUY C;  3REJ A;  4XUJ A;  4EO5 B;  3LZ1 A;  3AZJ A;  4H9S A;  4Z66 D;  3VH5 A;  4J8W B;  1U35 C;  3MVD B;  2F8N B;  4M6B A;  1M18 A;  1S32 A;  3LZ0 B;  5B31 B;  3LEL A;  5DNM B;  4NE6 A;  4WNN A;  3UTB A;  1M1A B;  5B2I C;  5BT1 C;  1ID3 D;  5B1L D;  3AN2 C;  5B32 B;  2PYO C;  2IO5 B;  3AZI B;  1HTA A;  4XZQ C;  2YFW B;  4X23 B;  2ARO A;  1ZLA C;  3X1T D;  3WKJ B;  3AFA C;  5B2J D;  3AZE A;  4WU8 B;  3AZK B;  3AV1 B;  1R4V A;  5AV9 D;  3KUY A;  5AVB D;  2JSS A;  3W99 B;  4YS3 D;  3REK B;  1TAF B;  4QLC B;  3W98 C;  5KDM A;  4ZBJ B;  4CSR A;  1BH8 B;  4Z5T C;  2BYK A;  4KGC B;  5GXQ D;  1KX3 B;  4KUD B;  3X1U C;  1P3L A;  3REH C;  3C1B C;  4J8X C;  4ZUX D;  4JJN A;  3AFA A;  5CP6 C;  3AV2 B;  4Z66 B;  3MGP D;  1AOI C;  3W97 D;  1ID3 B;  3MGS D;  2L5A A;  5CPJ D;  2FJ7 A;  3MGR C;  5AVB C;  1BH9 A;  3W98 A;  1H3O B;  2NZD D;  1EQZ D;  1P3B D;  1P3M D;  4Z5T A;  3WTP E;  1F1E A;  5GT3 C;  3X1T B;  1P3F D;  1WWS A;  3A6N C;  3KXB C;  3X1U A;  4WU9 D;  3B6G D;  3MNN A;  4E44 A;  5B40 A;  3REJ D;  5B0Z D;  5B33 C;  5AV9 B;  3AZN A;  1M18 D;  3B6F A;  5FUG B;  4YS3 B;  5DNN D;  4H9P B;  3NQJ B;  1AOI A;  3AZL C;  3WTP D;  1P34 B;  1P3P C;  3X1S C;  3MGR A;  2ARO D;  3WAA C;  3REL D;  5GT0 A;  3W97 C;  4E45 A;  5F99 B;  3MGS C;  3UTA B;  5AY8 D;  3AZE D;  4R8P A;  3NQU B;  4ZUX B;  1P3B C;  1P3M C;  4CAY B;  5AV5 D;  5AV8 A;  3TU4 D;  3KUY D;  3MGP B;  2CV5 B;  4WU9 C;  1P3A C;  5C3I B;  3WA9 B;  2HIO B;  3C1C A;  4XUJ C;  5B0Y B;  3LZ1 C;  3AZJ C;  4NE5 A;  4H9S C;  5CPJ B;  5BT1 D;  5B2I D;  3AN2 D;  2PYO D;  1S32 C;  3LEL C;  4WZS B;  3LJA A;  3AZL A;  4XZQ D;  4YM6 A;  1P3F B;  5GSU A;  3UTB C;  5E5A A;  3AZG C;  3B6G B;  5B1M A;  3AFA D;  1KX4 A;  4LD9 C;  5B0Z B;  5JRG A;  1F66 A;  3MGQ B;  3AZH B;  1TZY B;  1A7W A;  5DNM D;  1P3G A;  1M19 A;  3R45 B;  3X1V A;  3REI A;  3AZM A;  1HQ3 C;  5DNN B;  4H9N B;  4H9R B;  4UUZ A;  3W98 D;  3WTP B;  4H9O B;  5CPK C;  3AYW A;  2NQB A;  4Z5T D;  5BNV B;  1P3K A;  3REL B;  5BNX B;  3X1U D;  5AY8 B;  1N1J B;  5JA4 A;  4J8W C;  3UT9 B;  3AZG A;  2F8N H;  3REH D;  5B40 D;  3C1B D;  4J8X D;  5B32 G;  5B24 A;  5AV5 B;  1P3L C;  3TU4 B;  4LD9 A;  4WV4 B;  1P3O B;  3AZN D;  3W96 A;  5CP6 D;  3B6F D;  5B32 C;  2IO5 C;  1U35 B;  3VH6 A;  4JJN C;  5BS7 C;  3AZI C;  3VH6 T;  4DRB A;  5CPI A;  1AOI D;  1HQ3 A;  5B2I B;  3AN2 B;  4AWL B;  2PYO B;  1B67 A;  3MGR D;  4WU8 C;  3AZF B;  4Z2M H;  4XZQ B;  3AZK C;  4J8U B;  5GT0 D;  3O62 A;  5CPK A;  4H9Q B;  5G49 B;  1ZLA B;  1WWI A;  5GT3 D;  2FJ7 C;  4R8P D;  3A6N D;  3KXB D;  5AV6 B;  4J8W A;  3W99 C;  3MVD A;  5AV8 D;  2F8N A;  1P3I B;  3LZ0 A;  3V9R B;  5B31 A;  5B33 D;  5DNM A;  2BYM B;  4J8V B;  3MNN C;  1M1A A;  4G91 C;  4ZBJ C;  2HUE C;  5B32 A;  5B40 C;  4KUD C;  3AZI A;  5BS7 A;  2YFW A;  4X23 A;  3AZN C;  1JFI B;  3B6F C;  5AVC C;  3WKJ A;  3VH6 W;  3AZL D;  1P3P D;  3X1S D;  5GSU D;  4WU8 A;  3B0D B;  3AZK A;  3WAA D;  5CHL B;  3AV2 C;  5B1L B;  5B1M D;  3REH B;  3C1B B;  4J8X B;  5JRG D;  5GT0 C;  3W99 A;  5CP6 B;  4R8P C;  4G92 B;  3REK A;  1TAF A;  4QLC A;  3X1V D;  5B2J B;  1P3A D;  5AV8 C;  1BH8 A;  4HGA C;  4KGC A;  4XUJ D;  1KX3 A;  4KUD A;  5BO0 B;  2YFV B;  3LZ1 D;  3AZJ D;  3MGR B;  5AVB B;  1P3K D;  1S32 D;  5AVC A;  3LEL D;  3C1C C;  5GT3 B;  3UTB D;  3A6N B;  3KXB B;  3AZG D;  3AV2 A;  4Z66 A;  3LJA C;  4YM6 C;  4LD9 D;  5GXQ B;  5GSU C;  5E5A C;  5B33 B;  1ID3 A;  5B1M C;  1KX5 C;  1KX4 C;  1P34 C;  5JRG C;  1H3O A;  1HQ3 D;  1F66 C;  5F99 C;  4NFT A;  3X1T A;  1P3G C;  1M19 C;  3X1V C;  3REI C;  3AZM C;  1P3P B;  3X1S B;  5CPK D;  3WAA B;  3W97 B;  3MGS B;  2CV5 C;  2RVQ C;  4KHA A;  4J8W D;  3AYW C;  2NQB C;  3MVD D;  1P3K C;  2NZD B;  5FUG A;  1EQZ B;  3LZ0 D;  5B31 D;  1P3B B;  1P3M B;  1P3L D;  1M1A D;  4H9P A;  3NQJ A;  5B32 D;  4WU9 B;  1P3A B;  5B24 C;  4JJN D;  3AZI D;  1KX5 A;  1P34 A;  3REJ B;  4XUJ B;  3W96 C;  3LZ1 B;  3AZJ B;  5F99 A;  3UTA A;  1M18 B;  1S32 B;  5CPI C;  3LEL B;  4WU8 D;  3NQU A;  4ZUX A;  3AZK D;  4WNN B;  3UTB B;  3KWQ C;  3MGQ C;  4CAY A;  1TZY C;  3KSY A;  2FJ7 D;  3MGP A;  2CV5 A;  4LD9 B;  3O62 C;  2ARO B;  3W99 D;  3WA9 A;  2LY8 A;  2HIO A;  3B0C T;  2F8N G;  4NE3 A;  5B0Y A;  4EO5 C;  3AZE B;  5B31 G;  5CPJ A;  3MNN D;  3MVD C;  3LZ0 C;  1KX3 D;  5B31 C;  4KUD D;  5DNM C;  1P3F A;  3KUY B;  1M1A C;  1KU5 A;  5AVC D;  3B6G A;  4X23 C;  1P3O C;  5B0Z A;  5KDM B;  3AV2 D;  3WKJ C;  4Z2M G;  4CSR B;  3KWQ A;  1B6W A;  3VH5 T;  3MGQ A;  1TZY A;  2BYK B;  3AZH A;  3R45 A;  1P3L B;  3AV1 C;  5DNN A;  4H9N A;  4AWL C;  4H9R A;  4JJN B;  3AZF C;  3AFA B;  3WTP A;  4J8U C;  4H9O A;  3B0C W;  5BNV A;  3REL A;  3REK C;  5BNX A;  4QLC C;  5AY8 A;  1N1J A;  5AV6 C;  3UT9 A;  1P3I C;  3C1C D;  4KGC C;  1KX3 C;  5AV5 A;  2FJ7 B;  3TU4 A;  1BH9 B;  4J8V C;  1P3O A;  3W98 B;  1U35 A;  3LJA D;  4Z5T B;  4YM6 D;  5E5A D;  3X1U B;  4Z66 C;  3MNN B;  3VH5 W;  3AV1 A;  5B2I A;  4G91 B;  2HUE B;  3AN2 A;  5B40 B;  1KX4 D;  1P34 D;  1KX5 D;  2PYO A;  3AZF A;  3B0D C;  4XZQ A;  1F66 D;  4J8U A;  5F99 D;  4H9Q A;  5G49 A;  3AZN B;  3UTA D;  5B1L C;  1ID3 C;  1ZLA A;  3B6F B;  5AVC B;  1P3G D;  1M19 D;  3REI D;  3AZM D;  5AV6 A;  1AOI B;  3X1T C;  1P3I A;  4G92 C;  3V9R A;  2CV5 D;  2RVQ D;  2BYM A;  2CWE A;  5B2J C;  4J8V A;  3AYW D;  2NQB D;  1BFM A;  3WA9 D;  2HIO D;  5GT0 B;  5B0Y D;  1ULY A;  5AV9 C;  4R8P B;  1JFI A;  5B24 D;  5AV8 B;  4HGA B;  4YS3 C;  3W96 D;  5B1L A;  5CPI D;  3REH A;  3B0B A;  3C1B A;  5GXQ C;  3C1C B;  4J8X A;  4KHA B;  3KWQ D;  3MGQ D;  3UTA C;  3AZH D;  1TZY D;  5CP6 A;  4ZUX C;  3LJA B;  3AZL B;  4YM6 B;  5GSU B;  5B2J A;  3O62 D;  5E5A B;  5B1M B;  5BO0 A;  1KX5 B;  2YFV A;  3MGP C;  1KX4 B;  5AV9 A;  5C3I C;  5AVB A;  2F8N D;  5JRG B;  3WA9 C;  2HIO C;  1F66 B;  5B0Y C; 
#chains in the Genus database with same CATH topology
 5CPJ C;  4YS3 A;  5GT3 A;  1P3G B;  1M19 B;  3A6N A;  3UT9 D;  3KXB A;  3REI B;  3X1V B;  3AZM B;  2NZD C;  1EQZ C;  2ZY3 A;  2Y2M A;  4X23 D;  1P3F C;  3H0R C;  2DF4 C;  5GXQ A;  1Q9C A;  4UUZ B;  1P3O D;  5B33 A;  2Y2O A;  3WKJ D;  3B6G C;  2Y2K A;  3AYW B;  1U35 D;  2NQB B;  1P3K B;  3REJ C;  5B0Z C;  5JA4 B;  3AV1 D;  3AZG B;  3AZH C;  1M18 C;  5B24 B;  3AZF D;  2J8P A;  4J8U D;  3X1S A;  1P3P A;  3H0M C;  5DNN C;  1ZLA D;  3W96 B;  3IP4 C;  4DRA A;  3WAA A;  2F2A C;  3W97 A;  3REK D;  4QLC D;  3MGS A;  5CPI B;  2XD5 A;  3WTP C;  5AV6 D;  2FFF B;  2ARO C;  1HQ3 B;  2NZD A;  1P3I D;  3REL C;  4KGC D;  1EQZ A;  3KWQ B;  1P3B A;  1P3M A;  5AY8 C;  3AZE C;  2ZY4 A;  4J8V D;  3UT9 C;  2F8N K;  4WU9 A;  3O62 B;  5CPK B;  1P3A A;  5AV5 C;  3TU4 C;  3KUY C;  3REJ A;  4XUJ A;  4EO5 B;  3LZ1 A;  3AZJ A;  4H9S A;  4Z66 D;  3VH5 A;  4J8W B;  1U35 C;  3MVD B;  2F8N B;  4M6B A;  1M18 A;  1S32 A;  3LZ0 B;  5B31 B;  3LEL A;  5DNM B;  4NE6 A;  4WNN A;  3UTB A;  1M1A B;  5B2I C;  5BT1 C;  1ID3 D;  5B1L D;  3AN2 C;  5B32 B;  2PYO C;  2IO5 B;  3AZI B;  1HTA A;  2Y2J A;  4XZQ C;  2YFW B;  4X23 B;  3EPL A;  2ARO A;  1ZLA C;  3X1T D;  3WKJ B;  2RIQ A;  3AFA C;  5B2J D;  3AZE A;  4WU8 B;  3AZK B;  3AV1 B;  1R4V A;  5AV9 D;  3KUY A;  5AVB D;  2JSS A;  3W99 B;  4YS3 D;  3REK B;  1TAF B;  4QLC B;  3W98 C;  5KDM A;  4ZBJ B;  4CSR A;  1BH8 B;  4Z5T C;  2BYK A;  4KGC B;  5GXQ D;  1KX3 B;  4KUD B;  3X1U C;  1P3L A;  3REH C;  3C1B C;  4J8X C;  4ZUX D;  4JJN A;  3EG5 B;  3AFA A;  2Y2H A;  5CP6 C;  3AV2 B;  4Z66 B;  3MGP D;  1AOI C;  3W97 D;  1ID3 B;  3MGS D;  2L5A A;  5CPJ D;  2FJ7 A;  1T3U A;  3MGR C;  5AVB C;  1BH9 A;  3W98 A;  1H3O B;  2NZD D;  1EQZ D;  1P3B D;  1P3M D;  4Z5T A;  3WTP E;  1F1E A;  5GT3 C;  3X1T B;  1P3F D;  1WWS A;  3A1K A;  3A6N C;  3KXB C;  3X1U A;  3EPJ A;  4WU9 D;  3B6G D;  3MNN A;  4E44 A;  5B40 A;  3REJ D;  5B0Z D;  5B33 C;  5AV9 B;  3AZN A;  1M18 D;  3B6F A;  5FUG B;  4YS3 B;  2ZY2 A;  5DNN D;  4H9P B;  3NQJ B;  1AOI A;  3AZL C;  3WTP D;  1P34 B;  1P3P C;  3X1S C;  3MGR A;  2ARO D;  3WAA C;  3REL D;  5GT0 A;  3W97 C;  4E45 A;  5F99 B;  3MGS C;  3UTA B;  5AY8 D;  3AZE D;  4R8P A;  3NQU B;  4ZUX B;  1P3B C;  1P3M C;  4CAY B;  5AV5 D;  5AV8 A;  3TU4 D;  3KUY D;  3MGP B;  2CV5 B;  4WU9 C;  1P3A C;  3FDD A;  5C3I B;  3WA9 B;  2HIO B;  3C1C A;  4XUJ C;  5B0Y B;  4UPK A;  3LZ1 C;  3AZJ C;  4NE5 A;  4H9S C;  5CPJ B;  5BT1 D;  5B2I D;  3AN2 D;  2PYO D;  1S32 C;  3LEL C;  4WZS B;  3LJA A;  3AZL A;  4XZQ D;  4YM6 A;  1P3F B;  5GSU A;  3UTB C;  2BG1 A;  5E5A A;  3AZG C;  3B6G B;  5B1M A;  3AFA D;  1KX4 A;  4LD9 C;  5B0Z B;  5JRG A;  1F66 A;  3MGQ B;  3AZH B;  1TZY B;  1A7W A;  5DNM D;  1P3G A;  1M19 A;  3R45 B;  3X1V A;  3REI A;  3AZM A;  1HQ3 C;  3AL0 C;  5DNN B;  4H9N B;  4H9R B;  4UUZ A;  3W98 D;  3WTP B;  4H9O B;  5CPK C;  3AYW A;  2NQB A;  4Z5T D;  5BNV B;  1P3K A;  3REL B;  5BNX B;  3X1U D;  5AY8 B;  1N1J B;  5JA4 A;  4J8W C;  3UT9 B;  3AZG A;  2F8N H;  3REH D;  5B40 D;  3C1B D;  4J8X D;  3P5J B;  5B32 G;  2VQR A;  5B24 A;  5AV5 B;  1P3L C;  3TU4 B;  4LD9 A;  4WV4 B;  4WJ3 C;  1P3O B;  3AZN D;  3W96 A;  5CP6 D;  3B6F D;  5B32 C;  2IO5 C;  1U35 B;  3VH6 A;  4JJN C;  5BS7 C;  3AZI C;  3VH6 T;  4DRB A;  5CPI A;  1AOI D;  1HQ3 A;  5B2I B;  3AN2 B;  4AWL B;  2PYO B;  1B67 A;  3MGR D;  4WU8 C;  2Y2L A;  4Z2M H;  3AZF B;  4XZQ B;  3AZK C;  4J8U B;  5GT0 D;  3O62 A;  5CPK A;  4H9Q B;  5G49 B;  1ZLA B;  1WWI A;  5GT3 D;  2FJ7 C;  4R8P D;  3A6N D;  3KXB D;  1W2E A;  5AV6 B;  4J8W A;  3W99 C;  3MVD A;  5AV8 D;  4DQY B;  2F8N A;  1P3I B;  3LZ0 A;  3V9R B;  5B31 A;  5B33 D;  5DNM A;  2BYM B;  3A1I A;  4J8V B;  3MNN C;  1M1A A;  4G91 C;  4ZBJ C;  2HUE C;  5B32 A;  5B40 C;  4KUD C;  3AZI A;  5BS7 A;  2YFW A;  4X23 A;  3AZN C;  1JFI B;  3B6F C;  5AVC C;  3WKJ A;  3VH6 W;  3AZL D;  1P3P D;  3X1S D;  5GSU D;  4WU8 A;  3B0D B;  3AZK A;  3WAA D;  5CHL B;  3AV2 C;  5B1L B;  5B1M D;  3REH B;  3C1B B;  3F6T A;  4J8X B;  5JRG D;  5GT0 C;  3W99 A;  5CP6 B;  4R8P C;  4G92 B;  3REK A;  1TAF A;  4QLC A;  3X1V D;  5B2J B;  1P3A D;  5AV8 C;  1BH8 A;  4HGA C;  4KGC A;  4XUJ D;  1KX3 A;  4KUD A;  5BO0 B;  2YFV B;  3LZ1 D;  3AZJ D;  3MGR B;  5AVB B;  1P3K D;  1S32 D;  5AVC A;  3LEL D;  3C1C C;  3KFU G;  5GT3 B;  3UTB D;  3A6N B;  3KXB B;  3AZG D;  3AV2 A;  4Z66 A;  2G5H C;  3LJA C;  4YM6 C;  4LD9 D;  5GXQ B;  5GSU C;  5E5A C;  5B33 B;  2ZM5 A;  2ZY5 A;  1ID3 A;  5B1M C;  1KX5 C;  1KX4 C;  1P34 C;  2JE5 A;  5JRG C;  1H3O A;  1HQ3 D;  1F66 C;  5F99 C;  4NFT A;  3X1T A;  1P3G C;  1M19 C;  3X1V C;  3REI C;  3AZM C;  1P3P B;  3X1S B;  5CPK D;  3WAA B;  3W97 B;  3MGS B;  2CV5 C;  2RVQ C;  4KHA A;  2Y2Q A;  4J8W D;  3AYW C;  2NQB C;  3MVD D;  1P3K C;  2NZD B;  5FUG A;  1EQZ B;  3LZ0 D;  5B31 D;  1P3B B;  1P3M B;  1P3L D;  1M1A D;  4H9P A;  3NQJ A;  5B32 D;  4WU9 B;  1P3A B;  5B24 C;  4JJN D;  3AZI D;  1KX5 A;  1P34 A;  3REJ B;  4XUJ B;  3W96 C;  2XD1 A;  3LZ1 B;  3AZJ B;  5F99 A;  3UTA A;  1M18 B;  1S32 B;  5CPI C;  3EPH A;  3LEL B;  4WU8 D;  3NQU A;  4ZUX A;  3AZK D;  2JCH A;  4WNN B;  3UTB B;  3KWQ C;  3MGQ C;  4CAY A;  1TZY C;  3KSY A;  2FJ7 D;  1Z2C B;  3MGP A;  2CV5 A;  4LD9 B;  3O62 C;  2ARO B;  3W99 D;  3WA9 A;  2LY8 A;  2HIO A;  2Y2P A;  3B0C T;  2F8N G;  4NE3 A;  2W8S A;  5B0Y A;  4EO5 C;  3AZE B;  5B31 G;  5CPJ A;  3MNN D;  3MVD C;  3LZ0 C;  1KX3 D;  5B31 C;  4KUD D;  5DNM C;  1P3F A;  3KUY B;  1M1A C;  1KU5 A;  5AVC D;  3B6G A;  4X23 C;  3H0L C;  1P3O C;  5B0Z A;  5KDM B;  3AV2 D;  3WKJ C;  4Z2M G;  4CSR B;  2Y2I A;  1B6W A;  3VH5 T;  3KWQ A;  1TZY A;  2BYK B;  3MGQ A;  3AZH A;  3R45 A;  1P3L B;  3AV1 C;  5DNN A;  4H9N A;  4AWL C;  4H9R A;  4JJN B;  3AZF C;  3AFA B;  3WTP A;  4J8U C;  4H9O A;  3B0C W;  5BNV A;  3REL A;  3REK C;  5BNX A;  4QLC C;  5AY8 A;  1N1J A;  5AV6 C;  3UT9 A;  1P3I C;  3C1C D;  4KGC C;  1KX3 C;  5AV5 A;  2FJ7 B;  3TU4 A;  2Y2G A;  1BH9 B;  4J8V C;  1P3O A;  3W98 B;  1U35 A;  3LJA D;  4Z5T B;  4YM6 D;  2Y2N A;  5E5A D;  3X1U B;  4Z66 C;  3MNN B;  3VH5 W;  3AV1 A;  5B2I A;  4G91 B;  2HUE B;  3AN2 A;  5B40 B;  1KX4 D;  1P34 D;  1KX5 D;  2PYO A;  3AZF A;  3B0D C;  4XZQ A;  1F66 D;  4J8U A;  5F99 D;  4H9Q A;  5G49 A;  3AZN B;  3UTA D;  5B1L C;  1ID3 C;  1ZLA A;  3B6F B;  5AVC B;  1P3G D;  1M19 D;  3REI D;  3AZM D;  5AV6 A;  1AOI B;  3X1T C;  1P3I A;  4G92 C;  3V9R A;  2CV5 D;  2RVQ D;  2BYM A;  2CWE A;  2UWX A;  5B2J C;  4J8V A;  3AYW D;  2NQB D;  3WA9 D;  1BFM A;  3EPK A;  2HIO D;  5GT0 B;  5B0Y D;  1ULY A;  5AV9 C;  4R8P B;  1JFI A;  5B24 D;  5AV8 B;  4HGA B;  4YS3 C;  3W96 D;  5B1L A;  5CPI D;  2G5I C;  3B0B A;  3REH A;  3C1B A;  5GXQ C;  3C1C B;  4J8X A;  4KHA B;  3KWQ D;  3MGQ D;  3UTA C;  3AZH D;  1TZY D;  5CP6 A;  4ZUX C;  3LJA B;  3AZL B;  4YM6 B;  5GSU B;  5B2J A;  3O62 D;  5E5A B;  5B1M B;  5BO0 A;  2DQN C;  2YFV A;  3MGP C;  1KX4 B;  1KX5 B;  5AV9 A;  1PZR A;  5AVB A;  5C3I C;  2F8N D;  5JRG B;  3WA9 C;  2HIO C;  1F66 B;  5B0Y C; 
#chains in the Genus database with same CATH homology
 5CPJ C;  4YS3 A;  5GT3 A;  1P3G B;  1M19 B;  3A6N A;  3UT9 D;  3KXB A;  3REI B;  3X1V B;  3AZM B;  2NZD C;  1EQZ C;  2ZY3 A;  2Y2M A;  4X23 D;  1P3F C;  3H0R C;  2DF4 C;  5GXQ A;  1Q9C A;  4UUZ B;  1P3O D;  5B33 A;  2Y2O A;  3WKJ D;  3B6G C;  2Y2K A;  3AYW B;  1U35 D;  2NQB B;  1P3K B;  3REJ C;  5B0Z C;  5JA4 B;  3AV1 D;  3AZG B;  3AZH C;  1M18 C;  5B24 B;  3AZF D;  2J8P A;  4J8U D;  3X1S A;  1P3P A;  3H0M C;  5DNN C;  1ZLA D;  3W96 B;  3IP4 C;  4DRA A;  3WAA A;  2F2A C;  3W97 A;  3REK D;  4QLC D;  3MGS A;  5CPI B;  2XD5 A;  3WTP C;  5AV6 D;  2FFF B;  2ARO C;  1HQ3 B;  2NZD A;  1P3I D;  3REL C;  4KGC D;  1EQZ A;  3KWQ B;  1P3B A;  1P3M A;  5AY8 C;  3AZE C;  2ZY4 A;  4J8V D;  3UT9 C;  2F8N K;  4WU9 A;  3O62 B;  5CPK B;  1P3A A;  5AV5 C;  3TU4 C;  3KUY C;  3REJ A;  4XUJ A;  4EO5 B;  3LZ1 A;  3AZJ A;  4H9S A;  4Z66 D;  3VH5 A;  4J8W B;  1U35 C;  3MVD B;  2F8N B;  4M6B A;  1M18 A;  1S32 A;  3LZ0 B;  5B31 B;  3LEL A;  5DNM B;  4NE6 A;  4WNN A;  3UTB A;  1M1A B;  5B2I C;  5BT1 C;  1ID3 D;  5B1L D;  3AN2 C;  5B32 B;  2PYO C;  2IO5 B;  3AZI B;  1HTA A;  2Y2J A;  4XZQ C;  2YFW B;  4X23 B;  3EPL A;  2ARO A;  1ZLA C;  3X1T D;  3WKJ B;  2RIQ A;  3AFA C;  5B2J D;  3AZE A;  4WU8 B;  3AZK B;  3AV1 B;  1R4V A;  5AV9 D;  3KUY A;  5AVB D;  2JSS A;  3W99 B;  4YS3 D;  3REK B;  1TAF B;  4QLC B;  3W98 C;  5KDM A;  4ZBJ B;  4CSR A;  1BH8 B;  4Z5T C;  2BYK A;  4KGC B;  5GXQ D;  1KX3 B;  4KUD B;  3X1U C;  1P3L A;  3REH C;  3C1B C;  4J8X C;  4ZUX D;  4JJN A;  3EG5 B;  3AFA A;  2Y2H A;  5CP6 C;  3AV2 B;  4Z66 B;  3MGP D;  1AOI C;  3W97 D;  1ID3 B;  3MGS D;  2L5A A;  5CPJ D;  2FJ7 A;  1T3U A;  3MGR C;  5AVB C;  1BH9 A;  3W98 A;  1H3O B;  2NZD D;  1EQZ D;  1P3B D;  1P3M D;  4Z5T A;  3WTP E;  1F1E A;  5GT3 C;  3X1T B;  1P3F D;  1WWS A;  3A1K A;  3A6N C;  3KXB C;  3X1U A;  3EPJ A;  4WU9 D;  3B6G D;  3MNN A;  4E44 A;  5B40 A;  3REJ D;  5B0Z D;  5B33 C;  5AV9 B;  3AZN A;  1M18 D;  3B6F A;  5FUG B;  4YS3 B;  2ZY2 A;  5DNN D;  4H9P B;  3NQJ B;  1AOI A;  3AZL C;  3WTP D;  1P34 B;  1P3P C;  3X1S C;  3MGR A;  2ARO D;  3WAA C;  3REL D;  5GT0 A;  3W97 C;  4E45 A;  5F99 B;  3MGS C;  3UTA B;  5AY8 D;  3AZE D;  4R8P A;  3NQU B;  4ZUX B;  1P3B C;  1P3M C;  4CAY B;  5AV5 D;  5AV8 A;  3TU4 D;  3KUY D;  3MGP B;  2CV5 B;  4WU9 C;  1P3A C;  3FDD A;  5C3I B;  3WA9 B;  2HIO B;  3C1C A;  4XUJ C;  5B0Y B;  4UPK A;  3LZ1 C;  3AZJ C;  4NE5 A;  4H9S C;  5CPJ B;  5BT1 D;  5B2I D;  3AN2 D;  2PYO D;  1S32 C;  3LEL C;  4WZS B;  3LJA A;  3AZL A;  4XZQ D;  4YM6 A;  1P3F B;  5GSU A;  3UTB C;  2BG1 A;  5E5A A;  3AZG C;  3B6G B;  5B1M A;  3AFA D;  1KX4 A;  4LD9 C;  5B0Z B;  5JRG A;  1F66 A;  3MGQ B;  3AZH B;  1TZY B;  1A7W A;  5DNM D;  1P3G A;  1M19 A;  3R45 B;  3X1V A;  3REI A;  3AZM A;  1HQ3 C;  3AL0 C;  5DNN B;  4H9N B;  4H9R B;  4UUZ A;  3W98 D;  3WTP B;  4H9O B;  5CPK C;  3AYW A;  2NQB A;  4Z5T D;  5BNV B;  1P3K A;  3REL B;  5BNX B;  3X1U D;  5AY8 B;  1N1J B;  5JA4 A;  4J8W C;  3UT9 B;  3AZG A;  2F8N H;  3REH D;  5B40 D;  3C1B D;  4J8X D;  3P5J B;  5B32 G;  2VQR A;  5B24 A;  5AV5 B;  1P3L C;  3TU4 B;  4LD9 A;  4WV4 B;  4WJ3 C;  1P3O B;  3AZN D;  3W96 A;  5CP6 D;  3B6F D;  5B32 C;  2IO5 C;  1U35 B;  3VH6 A;  4JJN C;  5BS7 C;  3AZI C;  3VH6 T;  4DRB A;  5CPI A;  1AOI D;  1HQ3 A;  5B2I B;  3AN2 B;  4AWL B;  2PYO B;  1B67 A;  3MGR D;  4WU8 C;  2Y2L A;  4Z2M H;  3AZF B;  4XZQ B;  3AZK C;  4J8U B;  5GT0 D;  3O62 A;  5CPK A;  4H9Q B;  5G49 B;  1ZLA B;  1WWI A;  5GT3 D;  2FJ7 C;  4R8P D;  3A6N D;  3KXB D;  1W2E A;  5AV6 B;  4J8W A;  3W99 C;  3MVD A;  5AV8 D;  4DQY B;  2F8N A;  1P3I B;  3LZ0 A;  3V9R B;  5B31 A;  5B33 D;  5DNM A;  2BYM B;  3A1I A;  4J8V B;  3MNN C;  1M1A A;  4G91 C;  4ZBJ C;  2HUE C;  5B32 A;  5B40 C;  4KUD C;  3AZI A;  5BS7 A;  2YFW A;  4X23 A;  3AZN C;  1JFI B;  3B6F C;  5AVC C;  3WKJ A;  3VH6 W;  3AZL D;  1P3P D;  3X1S D;  5GSU D;  4WU8 A;  3B0D B;  3AZK A;  3WAA D;  5CHL B;  3AV2 C;  5B1L B;  5B1M D;  3REH B;  3C1B B;  3F6T A;  4J8X B;  5JRG D;  5GT0 C;  3W99 A;  5CP6 B;  4R8P C;  4G92 B;  3REK A;  1TAF A;  4QLC A;  3X1V D;  5B2J B;  1P3A D;  5AV8 C;  1BH8 A;  4HGA C;  4KGC A;  4XUJ D;  1KX3 A;  4KUD A;  5BO0 B;  2YFV B;  3LZ1 D;  3AZJ D;  3MGR B;  5AVB B;  1P3K D;  1S32 D;  5AVC A;  3LEL D;  3C1C C;  3KFU G;  5GT3 B;  3UTB D;  3A6N B;  3KXB B;  3AZG D;  3AV2 A;  4Z66 A;  2G5H C;  3LJA C;  4YM6 C;  4LD9 D;  5GXQ B;  5GSU C;  5E5A C;  5B33 B;  2ZM5 A;  2ZY5 A;  1ID3 A;  5B1M C;  1KX5 C;  1KX4 C;  1P34 C;  2JE5 A;  5JRG C;  1H3O A;  1HQ3 D;  1F66 C;  5F99 C;  4NFT A;  3X1T A;  1P3G C;  1M19 C;  3X1V C;  3REI C;  3AZM C;  1P3P B;  3X1S B;  5CPK D;  3WAA B;  3W97 B;  3MGS B;  2CV5 C;  2RVQ C;  4KHA A;  2Y2Q A;  4J8W D;  3AYW C;  2NQB C;  3MVD D;  1P3K C;  2NZD B;  5FUG A;  1EQZ B;  3LZ0 D;  5B31 D;  1P3B B;  1P3M B;  1P3L D;  1M1A D;  4H9P A;  3NQJ A;  5B32 D;  4WU9 B;  1P3A B;  5B24 C;  4JJN D;  3AZI D;  1KX5 A;  1P34 A;  3REJ B;  4XUJ B;  3W96 C;  2XD1 A;  3LZ1 B;  3AZJ B;  5F99 A;  3UTA A;  1M18 B;  1S32 B;  5CPI C;  3EPH A;  3LEL B;  4WU8 D;  3NQU A;  4ZUX A;  3AZK D;  2JCH A;  4WNN B;  3UTB B;  3KWQ C;  3MGQ C;  4CAY A;  1TZY C;  3KSY A;  2FJ7 D;  1Z2C B;  3MGP A;  2CV5 A;  4LD9 B;  3O62 C;  2ARO B;  3W99 D;  3WA9 A;  2LY8 A;  2HIO A;  2Y2P A;  3B0C T;  2F8N G;  4NE3 A;  2W8S A;  5B0Y A;  4EO5 C;  3AZE B;  5B31 G;  5CPJ A;  3MNN D;  3MVD C;  3LZ0 C;  1KX3 D;  5B31 C;  4KUD D;  5DNM C;  1P3F A;  3KUY B;  1M1A C;  1KU5 A;  5AVC D;  3B6G A;  4X23 C;  3H0L C;  1P3O C;  5B0Z A;  5KDM B;  3AV2 D;  3WKJ C;  4Z2M G;  4CSR B;  2Y2I A;  1B6W A;  3VH5 T;  3KWQ A;  1TZY A;  2BYK B;  3MGQ A;  3AZH A;  3R45 A;  1P3L B;  3AV1 C;  5DNN A;  4H9N A;  4AWL C;  4H9R A;  4JJN B;  3AZF C;  3AFA B;  3WTP A;  4J8U C;  4H9O A;  3B0C W;  5BNV A;  3REL A;  3REK C;  5BNX A;  4QLC C;  5AY8 A;  1N1J A;  5AV6 C;  3UT9 A;  1P3I C;  3C1C D;  4KGC C;  1KX3 C;  5AV5 A;  2FJ7 B;  3TU4 A;  2Y2G A;  1BH9 B;  4J8V C;  1P3O A;  3W98 B;  1U35 A;  3LJA D;  4Z5T B;  4YM6 D;  2Y2N A;  5E5A D;  3X1U B;  4Z66 C;  3MNN B;  3VH5 W;  3AV1 A;  5B2I A;  4G91 B;  2HUE B;  3AN2 A;  5B40 B;  1KX4 D;  1P34 D;  1KX5 D;  2PYO A;  3AZF A;  3B0D C;  4XZQ A;  1F66 D;  4J8U A;  5F99 D;  4H9Q A;  5G49 A;  3AZN B;  3UTA D;  5B1L C;  1ID3 C;  1ZLA A;  3B6F B;  5AVC B;  1P3G D;  1M19 D;  3REI D;  3AZM D;  5AV6 A;  1AOI B;  3X1T C;  1P3I A;  4G92 C;  3V9R A;  2CV5 D;  2RVQ D;  2BYM A;  2CWE A;  2UWX A;  5B2J C;  4J8V A;  3AYW D;  2NQB D;  3WA9 D;  1BFM A;  3EPK A;  2HIO D;  5GT0 B;  5B0Y D;  1ULY A;  5AV9 C;  4R8P B;  1JFI A;  5B24 D;  5AV8 B;  4HGA B;  4YS3 C;  3W96 D;  5B1L A;  5CPI D;  2G5I C;  3B0B A;  3REH A;  3C1B A;  5GXQ C;  3C1C B;  4J8X A;  4KHA B;  3KWQ D;  3MGQ D;  3UTA C;  3AZH D;  1TZY D;  5CP6 A;  4ZUX C;  3LJA B;  3AZL B;  4YM6 B;  5GSU B;  5B2J A;  3O62 D;  5E5A B;  5B1M B;  5BO0 A;  2DQN C;  2YFV A;  3MGP C;  1KX4 B;  1KX5 B;  5AV9 A;  1PZR A;  5AVB A;  5C3I C;  2F8N D;  5JRG B;  3WA9 C;  2HIO C;  1F66 B;  5B0Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...