5GSUA

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuA00
3NQUB 4HGAB 5G49B 2PYOD 3W97B 4YM6B 4XZQC 3AZFB 3WKJA 1HQ3A 4H9SA 1P3LD 1P3KB 3AZGC 2JSSA 4WNNA 5B40C 5AVCD 5B24A 1EQZD 3MVDD 5GXQB 3MGSD 3B6GB 5FUGA 5B0YB 3UTBC 5B1MC 5B33A 3LZ0B 2CV5C 5JRGB 3AV1B 4KHAA 3NQJB 5B31B 2PYOB 1HTAA 4XUJD 3WKJC 2NZDA 5C3IC 3O62A 3B0CT 3NQUA 5G49A 3REKC 4YM6A 1P3LB 5BT1D 3AZJD 1P3ID 4NFTA 4NE3A 3C1BC 5DNND 1EQZB 3MVDB 3REIA 3MGSB 1P3KA 1P3MD 3AZLD 3REJD 4DRAA 1ZLAC 5GXQA 3B6GA 5B0YA 1R4VA 1P3BB 4XUJB 3LZ0A 5JRGA 3VH5T 3WTPD 3AZHD 3AV1A 1ID3D 3NQJA 5B31A 2PYOA 5B1LD 5B2IC 3AZJB 1P3IB 2HUEB 3REIC 5DNNB 3LJAC 4WU8C 5AY8C 1P3LA 1P3MB 4UUZB 1P3FD 3AZLB 3REJB 3AZIC 5B2JC 1EQZA 3MVDA 1U35C 3MGSA 3V9RB 1P3AC 3LZ0C 1BH9B 3MGRC 4J8UC 3VH6A 3WTPB 3AZHB 5DNMC 1P3BA 4XZQD 4XUJA 5B1LB 5BNVB 4Z2MG 2HIOB 1P34C 2CWEA 3AZGD 5E5AC 3AZJA 1P3IA 1P3FB 5B40D 5DNNA 4R8PC 2YFWB 1P3MA 4UUZA 5GT3C 3AZLA 5B32C 3REJA 3UTBD 5B1MD 3X1VB 2CV5D 2F8NH 4CSRB 1P3BC 3KSYA 3V9RA 1BH9A 1JFIB 2F8NK 1H3OB 3KWQC 3WKJD 4XZQB 2FJ7C 3WTPA 3AZHA 5CPJC 3REKD 2BYKB 3R45B 5B1LA 5BNVA 2HIOA 4Z5TC 5B40B 3C1BD 5BS7C 3WA9C 3UTBB 5B1MB 2CV5B 1ZLAD 1M1AA 2YFWA 3MGPC 3X1VA 4CSRA 5C3IB 1JFIA 3REKB 5AV8C 1H3OA 2HIOC 2LY8A 5B2ID 4H9OB 3REID 3C1BB 3LJAD 4WU8D 2BYKA 3R45A 5AY8D 1M1AC 2RVQC 4H9RB 5B40A 3AZID 5B2JD 1ZLAB 5AV9C 4KGCC 1U35D 3X1VC 1P3AD 3LZ0D 4WU9C 4H9NA 3MGRD 4J8UD 3X1SC 4CAYB 5B1MA 2CV5A 5GT0C 4ZUXC 5B0ZB 3AN2C 3AYWC 5DNMD 3X1UC 1AOIC 4ZBJB 5B2IB 4DRBA 2NQBC 3VH6W 1BH8B 3REIB 3REKA 4E45A 1P34D 3LJAB 4WU8B 5AY8B 5AVBC 5E5AD 4H9OA 4YS3C 3AZIB 3C1BA 5B2JB 4R8PD 1U35B 2IO5C 1P3AB 5GT3D 4G92C 5B32D 4H9RA 4QLCC 3MGRB 4J8UB 1ZLAA 3C1CC 1P3BD 5DNMB 3B0BA 3KWQD 4CAYA 2FJ7D 5CPJD 5B0ZA 1BFMA 4J8VC 5B31G 5GSUC 3AV2C 1P34B 5B2IA 5E5AB 1BH8A 4Z5TD 3LJAA 4WU8A 4R8PB 2F8NB 5AY8A 3REHC 5GT3B 3WA9D 5B32B 3AZNC 3AZIA 5B2JA 3WAAC 1U35A 1P3AA 3W96C 3MGPD 3MGRA 4J8UA 1P3OA 5B0ZC 3KWQB 5JA4B 1F66B 1M19C 2FJ7B 5CPJB 4J8WC 4ZBJC 5DNMA 4LD9C 5AV8D 2HIOD 5CP6C 4JJNC 4Z5TB 3B6FC 1P34A 5E5AA 1M1AD 3WA9B 1Q9CA 5AV9D 4R8PA 2F8NA 4KGCD 1P3OC 3X1VD 4WU9D 5GT3A 4NE5A 3X1SD 3MGPB 5B32A 3LELC 3UTAC 5GT0D 4ZUXD 1KX3C 3LZ1C 3AN2D 3AYWD 5AV8B 5AV6C 3X1UD 3KWQA 5JA4A 1F66A 1KX4C 2NQBD 2FJ7A 1A7WA 5CPJA 3RELC 1KU5A 5AVBD 1M1AB 4YS3D 4Z5TA 5CHLB 5BS7A 5AV9B 4KGCB 3MGQB 4WU9B 3X1SB 3WA9A 4QLCD 1TZYC 5GT0B 4ZUXB 3C1CD 3AN2B 3AYWB 1F66C 3MGPA 3X1UB 1AOIB 2NQBB 3WTPE 4J8VD 3VH6T 5AV8A 5GSUD 5F99A 3AV2D 4KUDC 5AVBB 3AZEC 4YS3B 3AZKC 4H9NB 3REHD 2IO5B 4G92B 4WV4B 4QLCB 3AZND 3X1TA 1P3GC 5AV9A 4KGCA 3C1CB 3WAAD 1P3PC 3MGQA 4WU9A 3W96D 3KUYC 3X1SA 3W99C 5B0ZD 5GT0A 4ZUXA 1M19D 4Z66C 5F99C 4J8WD 3MNNC 3AN2A 4J8VB 3AYWA 4X23C 4LD9D 1F1EA 5GSUB 3AV2B 3X1UA 1AOIA 2NQBA 5CP6D 4JJND 3B6FD 5AVBA 3REHB 3UT9C 3X1TC 4YS3A 3AZNB 5CPKC 3MGQC 1P3OD 3WAAB 4Z2MH 3W96B 1ID3C 1TAFB 3LELD 4QLCA 3UTAD 3B0DC 1S32C 1KX3D 1M19B 3LZ1D 3AFAC 3C1CA 1M18C 4J8WB 4LD9B 5AV6D 1KX4D 4J8XC 5CP6B 4JJNB 3RELD 4J8VA 3B6FB 5GSUA 3AV2A 4M6BA 1N1JB 2F8ND 5AV5B 4H9PA 1KX5C 1P3OB 3REHA 1TZYD 2L5AA 3LELB 3UTAB 3AZNA 2AROC 1KX3B 3LZ1B 3WAAA 3W96A 1F66D 1TAFA 5AV6B 5BNXB 1KX4B 1M19A 4J8WA 3RELB 5CPIC 4LD9A 4KUDD 3KXBC 1WWSA 3AZED 3AZMC 3VH5A 5CP6A 3A6NC 4JJNA 3W98C 3AZKD 3TU4C 3B6FA 2YFVB 1N1JA 5AV5A 1TZYB 1P3GD 1P3PD 2F8NG 1HQ3C 3KUYD 3W99D 4H9SC 3LELA 3UTAA 5B32G 4EO5C 3W97A 1KX3A 3LZ1A 4Z66D 5F99D 3AZFA 3MNND 4G91C 5B24C 4X23D 5AV6A 4KUDB 5BNXA 5AVCB 1KX4A 3AZEB 3RELA 5B33C 3AZKB 5AV5C 2RVQD 3UT9D 3X1TD 4AWLB 4NE6A 5CPKD 3MGQD 2YFVA 1P3GB 2NZDC 3O62C 1P3PB 4HGAC 3W97C 3KUYB 4YM6C 3W99B 3AZFC 1TZYA 1S32D 3AFAD 4Z66B 5BO0B 5F99B 3MNNB 1M18D 1AOID 4X23B 1P3KC 4J8XD 5GXQC 4E44A 5AVCA 3B6GC 5B0YC 3UT9B 3AZEA 3X1TB 4KUDA 3AZKA 5CPKB 5JRGC 1B67A 3AV1C 1KX5D 5B31C 2PYOC 1ID3B 2BYMB 3B0DB 1S32B 2AROD 1P3GA 3B0CW 3AFAB 1M18B 1P3PA 3KUYA 3W99A 1WWIA 1P3LC 4J8XB 4Z66A 5BO0A 3MNNA 5CPID 5AVCC 4X23A 1EQZC 3MVDC 3MGSC 3KXBD 3AZMD 3A6ND 3W98D 3TU4D 4AWLC 1KX5B 3UT9A 4XUJC 3VH5W 5CPKA 2AROB 1HQ3D 5KDMB 1ID3A 2BYMA 1S32A 5BT1C 3AZJC 1P3IC 3AFAA 1M18A 2HUEC 4H9QB 3AZGB 5B24D 5CPIB 5DNNC 1P3MC 3KXBB 4J8XA 4H9PB 3AZMB 3AZLC 3A6NB 3REJC 3W98B 5B33D 3TU4B 1P3FA 5AV5D 1ULYA 2NZDD 3WTPC 3AZHC 1B6WA 3O62D 1KX5A 3WKJB 1HQ3B 3W97D 4YM6D 3AZFD 5B1LC 2AROA 4WNNB 4EO5B 4XZQA 4WZSB 4G91B 5KDMA 5B24B 1P3KD 5FUGB 1P3FC 4H9QA 3AZGA 5B33B 5CPIA 5GXQD 4KHAB 3B6GD 3KXBA 5B0YD 3AZMA 3A6NA 3W98A 3TU4A 5JRGD 3UTBA 3AV1D 2NZDB 5B31D 3O62B
chains in the Genus database with same CATH superfamily
3NQUB 4HGAB 5G49B 2PYOD 3W97B 4YM6B 4XZQC 3EPKA 3AZFB 3WKJA 1HQ3A 4H9SA 1P3LD 1P3KB 3AZGC 2JSSA 4WNNA 5B40C 5AVCD 5B24A 1EQZD 3MVDD 5GXQB 3MGSD 3B6GB 5FUGA 5B0YB 3UTBC 5B1MC 5B33A 3LZ0B 2CV5C 2XD5A 3H0RC 3IP4C 5JRGB 3AV1B 4KHAA 3NQJB 5B31B 2PYOB 2Y2HA 1HTAA 4XUJD 3WKJC 1W2EA 2NZDA 5C3IC 2Y2OA 3O62A 3B0CT 3NQUA 5G49A 3REKC 4YM6A 1P3LB 5BT1D 3AZJD 2DF4C 1P3ID 2UWXA 4NFTA 4NE3A 3A1KA 5DNND 3C1BC 1EQZB 3MVDB 3REIA 3MGSB 1P3KA 1P3MD 2Y2QA 3AZLD 3REJD 4DRAA 1ZLAC 5GXQA 3B6GA 5B0YA 1R4VA 1P3BB 4XUJB 3LZ0A 5JRGA 3VH5T 3WTPD 3AZHD 3AV1A 1ID3D 3NQJA 5B31A 2Y2MA 2PYOA 5B1LD 3H0LC 5B2IC 3AZJB 1P3IB 2HUEB 3REIC 5DNNB 3LJAC 4WU8C 5AY8C 1P3LA 1P3MB 4UUZB 1P3FD 3AZLB 3REJB 3AZIC 2RIQA 5B2JC 1EQZA 3MVDA 2Y2JA 1U35C 3MGSA 3V9RB 1P3AC 3LZ0C 1BH9B 3MGRC 4J8UC 3VH6A 3WTPB 2Y2GA 3EPJA 3AZHB 5DNMC 1T3UA 1P3BA 4XZQD 4XUJA 5B1LB 5BNVB 4Z2MG 2HIOB 1P34C 2CWEA 2ZY3A 5E5AC 3AZGD 3AZJA 1P3IA 1P3FB 5B40D 2ZY2A 5DNNA 4R8PC 2YFWB 2Y2IA 3FDDA 1P3MA 4UUZA 5GT3C 3AZLA 5B32C 3REJA 3UTBD 2Y2PA 5B1MD 3X1VB 2CV5D 2F8NH 4CSRB 1P3BC 3KSYA 3V9RA 1BH9A 1JFIB 2F8NK 1H3OB 3KWQC 3WKJD 4XZQB 2FJ7C 3WTPA 3AZHA 5CPJC 3REKD 2BYKB 3R45B 5B1LA 5BNVA 2HIOA 4Z5TC 5B40B 3C1BD 5BS7C 3WA9C 3UTBB 5B1MB 2CV5B 1ZLAD 1M1AA 2YFWA 3MGPC 3X1VA 4CSRA 2VQRA 5C3IB 1JFIA 3REKB 5AV8C 1H3OA 2HIOC 2LY8A 5B2ID 4H9OB 3REID 3C1BB 3LJAD 4WU8D 2BYKA 3R45A 5AY8D 1M1AC 3AL0C 2RVQC 4H9RB 5B40A 3AZID 5B2JD 1ZLAB 5AV9C 4KGCC 2G5IC 1U35D 3X1VC 1P3AD 3LZ0D 4WU9C 4H9NA 3MGRD 4J8UD 3X1SC 4CAYB 5B1MA 2CV5A 5GT0C 4ZUXC 5B0ZB 3AN2C 3AYWC 5DNMD 3X1UC 1AOIC 4ZBJB 5B2IB 4DRBA 2NQBC 2FFFB 3VH6W 1BH8B 3REIB 3REKA 4E45A 1P34D 3LJAB 4WU8B 3P5JB 3F6TA 5AVBC 5E5AD 4H9OA 5AY8B 4YS3C 3AZIB 2Y2LA 3C1BA 5B2JB 4R8PD 1U35B 2IO5C 1P3AB 5GT3D 4G92C 5B32D 4H9RA 4QLCC 3MGRB 4J8UB 1ZLAA 4WJ3C 3C1CC 1P3BD 5DNMB 3B0BA 3KWQD 4CAYA 2FJ7D 5CPJD 5B0ZA 1BFMA 4J8VC 5B31G 5GSUC 3AV2C 1P34B 5B2IA 5E5AB 1BH8A 4Z5TD 3LJAA 4WU8A 4R8PB 2F8NB 5AY8A 3REHC 3KFUG 5GT3B 3WA9D 5B32B 3AZNC 3AZIA 5B2JA 3WAAC 1U35A 1P3AA 3W96C 3MGPD 3MGRA 4J8UA 1P3OA 5B0ZC 3KWQB 5JA4B 1F66B 1M19C 2FJ7B 5CPJB 4J8WC 4ZBJC 5DNMA 4LD9C 5AV8D 1Z2CB 2HIOD 5CP6C 4JJNC 4Z5TB 3B6FC 1P34A 5E5AA 1M1AD 3WA9B 1PZRA 1Q9CA 5AV9D 4R8PA 2F8NA 4KGCD 1P3OC 3X1VD 4WU9D 5GT3A 4NE5A 3X1SD 3MGPB 5B32A 3LELC 3UTAC 5GT0D 4ZUXD 1KX3C 3LZ1C 3AN2D 3AYWD 5AV8B 5AV6C 3X1UD 3KWQA 5JA4A 1F66A 1KX4C 2NQBD 2FJ7A 1A7WA 5CPJA 3RELC 1KU5A 5AVBD 3H0MC 1M1AB 4YS3D 4Z5TA 5CHLB 5BS7A 5AV9B 4KGCB 3MGQB 4WU9B 2ZY4A 3X1SB 3WA9A 4QLCD 1TZYC 5GT0B 4ZUXB 3C1CD 3AN2B 3AYWB 1F66C 3MGPA 3X1UB 1AOIB 2NQBB 3WTPE 4J8VD 3VH6T 5AV8A 5GSUD 5F99A 3AV2D 4KUDC 5AVBB 3AZEC 4YS3B 3AZKC 4H9NB 3REHD 2IO5B 4G92B 4WV4B 4QLCB 3AZND 3X1TA 1P3GC 5AV9A 4KGCA 3C1CB 3WAAD 1P3PC 3MGQA 4WU9A 3W96D 3KUYC 3X1SA 3W99C 5B0ZD 5GT0A 4ZUXA 1M19D 4Z66C 5F99C 4J8WD 3MNNC 3AN2A 4J8VB 3AYWA 4X23C 4LD9D 1F1EA 5GSUB 3AV2B 3X1UA 1AOIA 2NQBA 5CP6D 4JJND 3B6FD 4UPKA 5AVBA 3REHB 3UT9C 3X1TC 4YS3A 3AZNB 5CPKC 3MGQC 1P3OD 3WAAB 4Z2MH 2W8SA 3W96B 1ID3C 1TAFB 3LELD 4QLCA 3UTAD 3B0DC 1S32C 1KX3D 1M19B 3LZ1D 2XD1A 3AFAC 3C1CA 1M18C 4J8WB 4LD9B 5AV6D 1KX4D 4J8XC 5CP6B 4JJNB 3RELD 4J8VA 3B6FB 5GSUA 3AV2A 4M6BA 1N1JB 2F8ND 5AV5B 4H9PA 1KX5C 1P3OB 3REHA 1TZYD 2L5AA 3LELB 3UTAB 3AZNA 2AROC 1KX3B 3LZ1B 3WAAA 3W96A 1F66D 1TAFA 3EPHA 5AV6B 5BNXB 1KX4B 1M19A 4J8WA 3RELB 5CPIC 4LD9A 4KUDD 3KXBC 1WWSA 3AZED 3AZMC 3VH5A 5CP6A 3A6NC 4JJNA 3W98C 3AZKD 3TU4C 3B6FA 2YFVB 1N1JA 5AV5A 1TZYB 1P3GD 1P3PD 2F8NG 1HQ3C 3KUYD 3W99D 4H9SC 3LELA 3UTAA 2ZM5A 5B32G 4EO5C 3W97A 1KX3A 3LZ1A 4Z66D 5F99D 3AZFA 3MNND 4G91C 5B24C 4X23D 2JE5A 5AV6A 4KUDB 5BNXA 5AVCB 1KX4A 3AZEB 3RELA 5B33C 3AZKB 5AV5C 2RVQD 3UT9D 3X1TD 4AWLB 2JCHA 4NE6A 5CPKD 3MGQD 2YFVA 1P3GB 2NZDC 3O62C 1P3PB 4HGAC 3W97C 3KUYB 2Y2KA 4YM6C 3AZFC 3W99B 1TZYA 1S32D 2G5HC 3AFAD 4Z66B 5BO0B 5F99B 3MNNB 1M18D 1AOID 4X23B 1P3KC 4J8XD 5GXQC 4E44A 5AVCA 3B6GC 5B0YC 3UT9B 3AZEA 3X1TB 2F2AC 4KUDA 3AZKA 5CPKB 5JRGC 1B67A 3AV1C 1KX5D 5B31C 2PYOC 1ID3B 2BYMB 3B0DB 1S32B 2AROD 1P3GA 3B0CW 3AFAB 1M18B 1P3PA 3KUYA 3W99A 1WWIA 1P3LC 4J8XB 3EPLA 4Z66A 5BO0A 3MNNA 5CPID 5AVCC 4X23A 1EQZC 3MVDC 3MGSC 3KXBD 3AZMD 3A6ND 3W98D 3TU4D 4AWLC 1KX5B 3UT9A 3A1IA 4XUJC 2J8PA 3VH5W 5CPKA 2AROB 3EG5B 1HQ3D 5KDMB 1ID3A 2BYMA 1S32A 5BT1C 3AZJC 1P3IC 3AFAA 1M18A 2HUEC 4H9QB 3AZGB 5B24D 5CPIB 2Y2NA 5DNNC 2DQNC 1P3MC 3KXBB 4J8XA 4H9PB 3AZMB 3AZLC 3A6NB 3REJC 3W98B 5B33D 3TU4B 1P3FA 5AV5D 4DQYB 1ULYA 2NZDD 3WTPC 3AZHC 1B6WA 3O62D 1KX5A 3WKJB 2BG1A 1HQ3B 3W97D 4YM6D 3AZFD 5B1LC 2AROA 4WNNB 4EO5B 4XZQA 4WZSB 2ZY5A 4G91B 5KDMA 5B24B 1P3KD 5FUGB 1P3FC 4H9QA 3AZGA 5B33B 5CPIA 5GXQD 4KHAB 3B6GD 3KXBA 5B0YD 3AZMA 3A6NA 3W98A 3TU4A 5JRGD 3UTBA 3AV1D 2NZDB 5B31D 3O62B
chains in the Genus database with same CATH topology
3NQUB 4HGAB 5G49B 2PYOD 3W97B 4YM6B 4XZQC 3EPKA 3AZFB 3WKJA 1HQ3A 4H9SA 1P3LD 1P3KB 3AZGC 2JSSA 4WNNA 5B40C 5AVCD 5B24A 1EQZD 3MVDD 5GXQB 3MGSD 3B6GB 5FUGA 5B0YB 3UTBC 5B1MC 5B33A 3LZ0B 2CV5C 2XD5A 3H0RC 3IP4C 5JRGB 3AV1B 4KHAA 3NQJB 5B31B 2PYOB 2Y2HA 1HTAA 4XUJD 3WKJC 1W2EA 2NZDA 5C3IC 2Y2OA 3O62A 3B0CT 3NQUA 5G49A 3REKC 4YM6A 1P3LB 5BT1D 3AZJD 2DF4C 1P3ID 2UWXA 4NFTA 4NE3A 3A1KA 5DNND 3C1BC 1EQZB 3MVDB 3REIA 3MGSB 1P3KA 1P3MD 2Y2QA 3AZLD 3REJD 4DRAA 1ZLAC 5GXQA 3B6GA 5B0YA 1R4VA 1P3BB 4XUJB 3LZ0A 5JRGA 3VH5T 3WTPD 3AZHD 3AV1A 1ID3D 3NQJA 5B31A 2Y2MA 2PYOA 5B1LD 3H0LC 5B2IC 3AZJB 1P3IB 2HUEB 3REIC 5DNNB 3LJAC 4WU8C 5AY8C 1P3LA 1P3MB 4UUZB 1P3FD 3AZLB 3REJB 3AZIC 2RIQA 5B2JC 1EQZA 3MVDA 2Y2JA 1U35C 3MGSA 3V9RB 1P3AC 3LZ0C 1BH9B 3MGRC 4J8UC 3VH6A 3WTPB 2Y2GA 3EPJA 3AZHB 5DNMC 1T3UA 1P3BA 4XZQD 4XUJA 5B1LB 5BNVB 4Z2MG 2HIOB 1P34C 2CWEA 2ZY3A 5E5AC 3AZGD 3AZJA 1P3IA 1P3FB 5B40D 2ZY2A 5DNNA 4R8PC 2YFWB 2Y2IA 3FDDA 1P3MA 4UUZA 5GT3C 3AZLA 5B32C 3REJA 3UTBD 2Y2PA 5B1MD 3X1VB 2CV5D 2F8NH 4CSRB 1P3BC 3KSYA 3V9RA 1BH9A 1JFIB 2F8NK 1H3OB 3KWQC 3WKJD 4XZQB 2FJ7C 3WTPA 3AZHA 5CPJC 3REKD 2BYKB 3R45B 5B1LA 5BNVA 2HIOA 4Z5TC 5B40B 3C1BD 5BS7C 3WA9C 3UTBB 5B1MB 2CV5B 1ZLAD 1M1AA 2YFWA 3MGPC 3X1VA 4CSRA 2VQRA 5C3IB 1JFIA 3REKB 5AV8C 1H3OA 2HIOC 2LY8A 5B2ID 4H9OB 3REID 3C1BB 3LJAD 4WU8D 2BYKA 3R45A 5AY8D 1M1AC 3AL0C 2RVQC 4H9RB 5B40A 3AZID 5B2JD 1ZLAB 5AV9C 4KGCC 2G5IC 1U35D 3X1VC 1P3AD 3LZ0D 4WU9C 4H9NA 3MGRD 4J8UD 3X1SC 4CAYB 5B1MA 2CV5A 5GT0C 4ZUXC 5B0ZB 3AN2C 3AYWC 5DNMD 3X1UC 1AOIC 4ZBJB 5B2IB 4DRBA 2NQBC 2FFFB 3VH6W 1BH8B 3REIB 3REKA 4E45A 1P34D 3LJAB 4WU8B 3P5JB 3F6TA 5AVBC 5E5AD 4H9OA 5AY8B 4YS3C 3AZIB 2Y2LA 3C1BA 5B2JB 4R8PD 1U35B 2IO5C 1P3AB 5GT3D 4G92C 5B32D 4H9RA 4QLCC 3MGRB 4J8UB 1ZLAA 4WJ3C 3C1CC 1P3BD 5DNMB 3B0BA 3KWQD 4CAYA 2FJ7D 5CPJD 5B0ZA 1BFMA 4J8VC 5B31G 5GSUC 3AV2C 1P34B 5B2IA 5E5AB 1BH8A 4Z5TD 3LJAA 4WU8A 4R8PB 2F8NB 5AY8A 3REHC 3KFUG 5GT3B 3WA9D 5B32B 3AZNC 3AZIA 5B2JA 3WAAC 1U35A 1P3AA 3W96C 3MGPD 3MGRA 4J8UA 1P3OA 5B0ZC 3KWQB 5JA4B 1F66B 1M19C 2FJ7B 5CPJB 4J8WC 4ZBJC 5DNMA 4LD9C 5AV8D 1Z2CB 2HIOD 5CP6C 4JJNC 4Z5TB 3B6FC 1P34A 5E5AA 1M1AD 3WA9B 1PZRA 1Q9CA 5AV9D 4R8PA 2F8NA 4KGCD 1P3OC 3X1VD 4WU9D 5GT3A 4NE5A 3X1SD 3MGPB 5B32A 3LELC 3UTAC 5GT0D 4ZUXD 1KX3C 3LZ1C 3AN2D 3AYWD 5AV8B 5AV6C 3X1UD 3KWQA 5JA4A 1F66A 1KX4C 2NQBD 2FJ7A 1A7WA 5CPJA 3RELC 1KU5A 5AVBD 3H0MC 1M1AB 4YS3D 4Z5TA 5CHLB 5BS7A 5AV9B 4KGCB 3MGQB 4WU9B 2ZY4A 3X1SB 3WA9A 4QLCD 1TZYC 5GT0B 4ZUXB 3C1CD 3AN2B 3AYWB 1F66C 3MGPA 3X1UB 1AOIB 2NQBB 3WTPE 4J8VD 3VH6T 5AV8A 5GSUD 5F99A 3AV2D 4KUDC 5AVBB 3AZEC 4YS3B 3AZKC 4H9NB 3REHD 2IO5B 4G92B 4WV4B 4QLCB 3AZND 3X1TA 1P3GC 5AV9A 4KGCA 3C1CB 3WAAD 1P3PC 3MGQA 4WU9A 3W96D 3KUYC 3X1SA 3W99C 5B0ZD 5GT0A 4ZUXA 1M19D 4Z66C 5F99C 4J8WD 3MNNC 3AN2A 4J8VB 3AYWA 4X23C 4LD9D 1F1EA 5GSUB 3AV2B 3X1UA 1AOIA 2NQBA 5CP6D 4JJND 3B6FD 4UPKA 5AVBA 3REHB 3UT9C 3X1TC 4YS3A 3AZNB 5CPKC 3MGQC 1P3OD 3WAAB 4Z2MH 2W8SA 3W96B 1ID3C 1TAFB 3LELD 4QLCA 3UTAD 3B0DC 1S32C 1KX3D 1M19B 3LZ1D 2XD1A 3AFAC 3C1CA 1M18C 4J8WB 4LD9B 5AV6D 1KX4D 4J8XC 5CP6B 4JJNB 3RELD 4J8VA 3B6FB 5GSUA 3AV2A 4M6BA 1N1JB 2F8ND 5AV5B 4H9PA 1KX5C 1P3OB 3REHA 1TZYD 2L5AA 3LELB 3UTAB 3AZNA 2AROC 1KX3B 3LZ1B 3WAAA 3W96A 1F66D 1TAFA 3EPHA 5AV6B 5BNXB 1KX4B 1M19A 4J8WA 3RELB 5CPIC 4LD9A 4KUDD 3KXBC 1WWSA 3AZED 3AZMC 3VH5A 5CP6A 3A6NC 4JJNA 3W98C 3AZKD 3TU4C 3B6FA 2YFVB 1N1JA 5AV5A 1TZYB 1P3GD 1P3PD 2F8NG 1HQ3C 3KUYD 3W99D 4H9SC 3LELA 3UTAA 2ZM5A 5B32G 4EO5C 3W97A 1KX3A 3LZ1A 4Z66D 5F99D 3AZFA 3MNND 4G91C 5B24C 4X23D 2JE5A 5AV6A 4KUDB 5BNXA 5AVCB 1KX4A 3AZEB 3RELA 5B33C 3AZKB 5AV5C 2RVQD 3UT9D 3X1TD 4AWLB 2JCHA 4NE6A 5CPKD 3MGQD 2YFVA 1P3GB 2NZDC 3O62C 1P3PB 4HGAC 3W97C 3KUYB 2Y2KA 4YM6C 3AZFC 3W99B 1TZYA 1S32D 2G5HC 3AFAD 4Z66B 5BO0B 5F99B 3MNNB 1M18D 1AOID 4X23B 1P3KC 4J8XD 5GXQC 4E44A 5AVCA 3B6GC 5B0YC 3UT9B 3AZEA 3X1TB 2F2AC 4KUDA 3AZKA 5CPKB 5JRGC 1B67A 3AV1C 1KX5D 5B31C 2PYOC 1ID3B 2BYMB 3B0DB 1S32B 2AROD 1P3GA 3B0CW 3AFAB 1M18B 1P3PA 3KUYA 3W99A 1WWIA 1P3LC 4J8XB 3EPLA 4Z66A 5BO0A 3MNNA 5CPID 5AVCC 4X23A 1EQZC 3MVDC 3MGSC 3KXBD 3AZMD 3A6ND 3W98D 3TU4D 4AWLC 1KX5B 3UT9A 3A1IA 4XUJC 2J8PA 3VH5W 5CPKA 2AROB 3EG5B 1HQ3D 5KDMB 1ID3A 2BYMA 1S32A 5BT1C 3AZJC 1P3IC 3AFAA 1M18A 2HUEC 4H9QB 3AZGB 5B24D 5CPIB 2Y2NA 5DNNC 2DQNC 1P3MC 3KXBB 4J8XA 4H9PB 3AZMB 3AZLC 3A6NB 3REJC 3W98B 5B33D 3TU4B 1P3FA 5AV5D 4DQYB 1ULYA 2NZDD 3WTPC 3AZHC 1B6WA 3O62D 1KX5A 3WKJB 2BG1A 1HQ3B 3W97D 4YM6D 3AZFD 5B1LC 2AROA 4WNNB 4EO5B 4XZQA 4WZSB 2ZY5A 4G91B 5KDMA 5B24B 1P3KD 5FUGB 1P3FC 4H9QA 3AZGA 5B33B 5CPIA 5GXQD 4KHAB 3B6GD 3KXBA 5B0YD 3AZMA 3A6NA 3W98A 3TU4A 5JRGD 3UTBA 3AV1D 2NZDB 5B31D 3O62B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU B;  4HGA B;  5G49 B;  2PYO D;  3W97 B;  4YM6 B;  4XZQ C;  3AZF B;  3WKJ A;  1HQ3 A;  4H9S A;  1P3L D;  1P3K B;  3AZG C;  2JSS A;  4WNN A;  5B40 C;  5AVC D;  5B24 A;  1EQZ D;  3MVD D;  5GXQ B;  3MGS D;  3B6G B;  5FUG A;  5B0Y B;  3UTB C;  5B1M C;  5B33 A;  3LZ0 B;  2CV5 C;  5JRG B;  3AV1 B;  4KHA A;  3NQJ B;  5B31 B;  2PYO B;  1HTA A;  4XUJ D;  3WKJ C;  2NZD A;  5C3I C;  3O62 A;  3B0C T;  3NQU A;  5G49 A;  3REK C;  4YM6 A;  1P3L B;  5BT1 D;  3AZJ D;  1P3I D;  4NFT A;  4NE3 A;  3C1B C;  5DNN D;  1EQZ B;  3MVD B;  3REI A;  3MGS B;  1P3K A;  1P3M D;  3AZL D;  3REJ D;  4DRA A;  1ZLA C;  5GXQ A;  3B6G A;  5B0Y A;  1R4V A;  1P3B B;  4XUJ B;  3LZ0 A;  5JRG A;  3VH5 T;  3WTP D;  3AZH D;  3AV1 A;  1ID3 D;  3NQJ A;  5B31 A;  2PYO A;  5B1L D;  5B2I C;  3AZJ B;  1P3I B;  2HUE B;  3REI C;  5DNN B;  3LJA C;  4WU8 C;  5AY8 C;  1P3L A;  1P3M B;  4UUZ B;  1P3F D;  3AZL B;  3REJ B;  3AZI C;  5B2J C;  1EQZ A;  3MVD A;  1U35 C;  3MGS A;  3V9R B;  1P3A C;  3LZ0 C;  1BH9 B;  3MGR C;  4J8U C;  3VH6 A;  3WTP B;  3AZH B;  5DNM C;  1P3B A;  4XZQ D;  4XUJ A;  5B1L B;  5BNV B;  4Z2M G;  2HIO B;  1P34 C;  2CWE A;  3AZG D;  5E5A C;  3AZJ A;  1P3I A;  1P3F B;  5B40 D;  5DNN A;  4R8P C;  2YFW B;  1P3M A;  4UUZ A;  5GT3 C;  3AZL A;  5B32 C;  3REJ A;  3UTB D;  5B1M D;  3X1V B;  2CV5 D;  2F8N H;  4CSR B;  1P3B C;  3KSY A;  3V9R A;  1BH9 A;  1JFI B;  2F8N K;  1H3O B;  3KWQ C;  3WKJ D;  4XZQ B;  2FJ7 C;  3WTP A;  3AZH A;  5CPJ C;  3REK D;  2BYK B;  3R45 B;  5B1L A;  5BNV A;  2HIO A;  4Z5T C;  5B40 B;  3C1B D;  5BS7 C;  3WA9 C;  3UTB B;  5B1M B;  2CV5 B;  1ZLA D;  1M1A A;  2YFW A;  3MGP C;  3X1V A;  4CSR A;  5C3I B;  1JFI A;  3REK B;  5AV8 C;  1H3O A;  2HIO C;  2LY8 A;  5B2I D;  4H9O B;  3REI D;  3C1B B;  3LJA D;  4WU8 D;  2BYK A;  3R45 A;  5AY8 D;  1M1A C;  2RVQ C;  4H9R B;  5B40 A;  3AZI D;  5B2J D;  1ZLA B;  5AV9 C;  4KGC C;  1U35 D;  3X1V C;  1P3A D;  3LZ0 D;  4WU9 C;  4H9N A;  3MGR D;  4J8U D;  3X1S C;  4CAY B;  5B1M A;  2CV5 A;  5GT0 C;  4ZUX C;  5B0Z B;  3AN2 C;  3AYW C;  5DNM D;  3X1U C;  1AOI C;  4ZBJ B;  5B2I B;  4DRB A;  2NQB C;  3VH6 W;  1BH8 B;  3REI B;  3REK A;  4E45 A;  1P34 D;  3LJA B;  4WU8 B;  5AY8 B;  5AVB C;  5E5A D;  4H9O A;  4YS3 C;  3AZI B;  3C1B A;  5B2J B;  4R8P D;  1U35 B;  2IO5 C;  1P3A B;  5GT3 D;  4G92 C;  5B32 D;  4H9R A;  4QLC C;  3MGR B;  4J8U B;  1ZLA A;  3C1C C;  1P3B D;  5DNM B;  3B0B A;  3KWQ D;  4CAY A;  2FJ7 D;  5CPJ D;  5B0Z A;  1BFM A;  4J8V C;  5B31 G;  5GSU C;  3AV2 C;  1P34 B;  5B2I A;  5E5A B;  1BH8 A;  4Z5T D;  3LJA A;  4WU8 A;  4R8P B;  2F8N B;  5AY8 A;  3REH C;  5GT3 B;  3WA9 D;  5B32 B;  3AZN C;  3AZI A;  5B2J A;  3WAA C;  1U35 A;  1P3A A;  3W96 C;  3MGP D;  3MGR A;  4J8U A;  1P3O A;  5B0Z C;  3KWQ B;  5JA4 B;  1F66 B;  1M19 C;  2FJ7 B;  5CPJ B;  4J8W C;  4ZBJ C;  5DNM A;  4LD9 C;  5AV8 D;  2HIO D;  5CP6 C;  4JJN C;  4Z5T B;  3B6F C;  1P34 A;  5E5A A;  1M1A D;  3WA9 B;  1Q9C A;  5AV9 D;  4R8P A;  2F8N A;  4KGC D;  1P3O C;  3X1V D;  4WU9 D;  5GT3 A;  4NE5 A;  3X1S D;  3MGP B;  5B32 A;  3LEL C;  3UTA C;  5GT0 D;  4ZUX D;  1KX3 C;  3LZ1 C;  3AN2 D;  3AYW D;  5AV8 B;  5AV6 C;  3X1U D;  3KWQ A;  5JA4 A;  1F66 A;  1KX4 C;  2NQB D;  2FJ7 A;  1A7W A;  5CPJ A;  3REL C;  1KU5 A;  5AVB D;  1M1A B;  4YS3 D;  4Z5T A;  5CHL B;  5BS7 A;  5AV9 B;  4KGC B;  3MGQ B;  4WU9 B;  3X1S B;  3WA9 A;  4QLC D;  1TZY C;  5GT0 B;  4ZUX B;  3C1C D;  3AN2 B;  3AYW B;  1F66 C;  3MGP A;  3X1U B;  1AOI B;  2NQB B;  3WTP E;  4J8V D;  3VH6 T;  5AV8 A;  5GSU D;  5F99 A;  3AV2 D;  4KUD C;  5AVB B;  3AZE C;  4YS3 B;  3AZK C;  4H9N B;  3REH D;  2IO5 B;  4G92 B;  4WV4 B;  4QLC B;  3AZN D;  3X1T A;  1P3G C;  5AV9 A;  4KGC A;  3C1C B;  3WAA D;  1P3P C;  3MGQ A;  4WU9 A;  3W96 D;  3KUY C;  3X1S A;  3W99 C;  5B0Z D;  5GT0 A;  4ZUX A;  1M19 D;  4Z66 C;  5F99 C;  4J8W D;  3MNN C;  3AN2 A;  4J8V B;  3AYW A;  4X23 C;  4LD9 D;  1F1E A;  5GSU B;  3AV2 B;  3X1U A;  1AOI A;  2NQB A;  5CP6 D;  4JJN D;  3B6F D;  5AVB A;  3REH B;  3UT9 C;  3X1T C;  4YS3 A;  3AZN B;  5CPK C;  3MGQ C;  1P3O D;  3WAA B;  4Z2M H;  3W96 B;  1ID3 C;  1TAF B;  3LEL D;  4QLC A;  3UTA D;  3B0D C;  1S32 C;  1KX3 D;  1M19 B;  3LZ1 D;  3AFA C;  3C1C A;  1M18 C;  4J8W B;  4LD9 B;  5AV6 D;  1KX4 D;  4J8X C;  5CP6 B;  4JJN B;  3REL D;  4J8V A;  3B6F B;  5GSU A;  3AV2 A;  4M6B A;  1N1J B;  2F8N D;  5AV5 B;  4H9P A;  1KX5 C;  1P3O B;  3REH A;  1TZY D;  2L5A A;  3LEL B;  3UTA B;  3AZN A;  2ARO C;  1KX3 B;  3LZ1 B;  3WAA A;  3W96 A;  1F66 D;  1TAF A;  5AV6 B;  5BNX B;  1KX4 B;  1M19 A;  4J8W A;  3REL B;  5CPI C;  4LD9 A;  4KUD D;  3KXB C;  1WWS A;  3AZE D;  3AZM C;  3VH5 A;  5CP6 A;  3A6N C;  4JJN A;  3W98 C;  3AZK D;  3TU4 C;  3B6F A;  2YFV B;  1N1J A;  5AV5 A;  1TZY B;  1P3G D;  1P3P D;  2F8N G;  1HQ3 C;  3KUY D;  3W99 D;  4H9S C;  3LEL A;  3UTA A;  5B32 G;  4EO5 C;  3W97 A;  1KX3 A;  3LZ1 A;  4Z66 D;  5F99 D;  3AZF A;  3MNN D;  4G91 C;  5B24 C;  4X23 D;  5AV6 A;  4KUD B;  5BNX A;  5AVC B;  1KX4 A;  3AZE B;  3REL A;  5B33 C;  3AZK B;  5AV5 C;  2RVQ D;  3UT9 D;  3X1T D;  4AWL B;  4NE6 A;  5CPK D;  3MGQ D;  2YFV A;  1P3G B;  2NZD C;  3O62 C;  1P3P B;  4HGA C;  3W97 C;  3KUY B;  4YM6 C;  3W99 B;  3AZF C;  1TZY A;  1S32 D;  3AFA D;  4Z66 B;  5BO0 B;  5F99 B;  3MNN B;  1M18 D;  1AOI D;  4X23 B;  1P3K C;  4J8X D;  5GXQ C;  4E44 A;  5AVC A;  3B6G C;  5B0Y C;  3UT9 B;  3AZE A;  3X1T B;  4KUD A;  3AZK A;  5CPK B;  5JRG C;  1B67 A;  3AV1 C;  1KX5 D;  5B31 C;  2PYO C;  1ID3 B;  2BYM B;  3B0D B;  1S32 B;  2ARO D;  1P3G A;  3B0C W;  3AFA B;  1M18 B;  1P3P A;  3KUY A;  3W99 A;  1WWI A;  1P3L C;  4J8X B;  4Z66 A;  5BO0 A;  3MNN A;  5CPI D;  5AVC C;  4X23 A;  1EQZ C;  3MVD C;  3MGS C;  3KXB D;  3AZM D;  3A6N D;  3W98 D;  3TU4 D;  4AWL C;  1KX5 B;  3UT9 A;  4XUJ C;  3VH5 W;  5CPK A;  2ARO B;  1HQ3 D;  5KDM B;  1ID3 A;  2BYM A;  1S32 A;  5BT1 C;  3AZJ C;  1P3I C;  3AFA A;  1M18 A;  2HUE C;  4H9Q B;  3AZG B;  5B24 D;  5CPI B;  5DNN C;  1P3M C;  3KXB B;  4J8X A;  4H9P B;  3AZM B;  3AZL C;  3A6N B;  3REJ C;  3W98 B;  5B33 D;  3TU4 B;  1P3F A;  5AV5 D;  1ULY A;  2NZD D;  3WTP C;  3AZH C;  1B6W A;  3O62 D;  1KX5 A;  3WKJ B;  1HQ3 B;  3W97 D;  4YM6 D;  3AZF D;  5B1L C;  2ARO A;  4WNN B;  4EO5 B;  4XZQ A;  4WZS B;  4G91 B;  5KDM A;  5B24 B;  1P3K D;  5FUG B;  1P3F C;  4H9Q A;  3AZG A;  5B33 B;  5CPI A;  5GXQ D;  4KHA B;  3B6G D;  3KXB A;  5B0Y D;  3AZM A;  3A6N A;  3W98 A;  3TU4 A;  5JRG D;  3UTB A;  3AV1 D;  2NZD B;  5B31 D;  3O62 B; 
#chains in the Genus database with same CATH topology
 3NQU B;  4HGA B;  5G49 B;  2PYO D;  3W97 B;  4YM6 B;  4XZQ C;  3EPK A;  3AZF B;  3WKJ A;  1HQ3 A;  4H9S A;  1P3L D;  1P3K B;  3AZG C;  2JSS A;  4WNN A;  5B40 C;  5AVC D;  5B24 A;  1EQZ D;  3MVD D;  5GXQ B;  3MGS D;  3B6G B;  5FUG A;  5B0Y B;  3UTB C;  5B1M C;  5B33 A;  3LZ0 B;  2CV5 C;  2XD5 A;  3H0R C;  3IP4 C;  5JRG B;  3AV1 B;  4KHA A;  3NQJ B;  5B31 B;  2PYO B;  2Y2H A;  1HTA A;  4XUJ D;  3WKJ C;  1W2E A;  2NZD A;  5C3I C;  2Y2O A;  3O62 A;  3B0C T;  3NQU A;  5G49 A;  3REK C;  4YM6 A;  1P3L B;  5BT1 D;  3AZJ D;  2DF4 C;  1P3I D;  2UWX A;  4NFT A;  4NE3 A;  3A1K A;  5DNN D;  3C1B C;  1EQZ B;  3MVD B;  3REI A;  3MGS B;  1P3K A;  1P3M D;  2Y2Q A;  3AZL D;  3REJ D;  4DRA A;  1ZLA C;  5GXQ A;  3B6G A;  5B0Y A;  1R4V A;  1P3B B;  4XUJ B;  3LZ0 A;  5JRG A;  3VH5 T;  3WTP D;  3AZH D;  3AV1 A;  1ID3 D;  3NQJ A;  5B31 A;  2Y2M A;  2PYO A;  5B1L D;  3H0L C;  5B2I C;  3AZJ B;  1P3I B;  2HUE B;  3REI C;  5DNN B;  3LJA C;  4WU8 C;  5AY8 C;  1P3L A;  1P3M B;  4UUZ B;  1P3F D;  3AZL B;  3REJ B;  3AZI C;  2RIQ A;  5B2J C;  1EQZ A;  3MVD A;  2Y2J A;  1U35 C;  3MGS A;  3V9R B;  1P3A C;  3LZ0 C;  1BH9 B;  3MGR C;  4J8U C;  3VH6 A;  3WTP B;  2Y2G A;  3EPJ A;  3AZH B;  5DNM C;  1T3U A;  1P3B A;  4XZQ D;  4XUJ A;  5B1L B;  5BNV B;  4Z2M G;  2HIO B;  1P34 C;  2CWE A;  2ZY3 A;  5E5A C;  3AZG D;  3AZJ A;  1P3I A;  1P3F B;  5B40 D;  2ZY2 A;  5DNN A;  4R8P C;  2YFW B;  2Y2I A;  3FDD A;  1P3M A;  4UUZ A;  5GT3 C;  3AZL A;  5B32 C;  3REJ A;  3UTB D;  2Y2P A;  5B1M D;  3X1V B;  2CV5 D;  2F8N H;  4CSR B;  1P3B C;  3KSY A;  3V9R A;  1BH9 A;  1JFI B;  2F8N K;  1H3O B;  3KWQ C;  3WKJ D;  4XZQ B;  2FJ7 C;  3WTP A;  3AZH A;  5CPJ C;  3REK D;  2BYK B;  3R45 B;  5B1L A;  5BNV A;  2HIO A;  4Z5T C;  5B40 B;  3C1B D;  5BS7 C;  3WA9 C;  3UTB B;  5B1M B;  2CV5 B;  1ZLA D;  1M1A A;  2YFW A;  3MGP C;  3X1V A;  4CSR A;  2VQR A;  5C3I B;  1JFI A;  3REK B;  5AV8 C;  1H3O A;  2HIO C;  2LY8 A;  5B2I D;  4H9O B;  3REI D;  3C1B B;  3LJA D;  4WU8 D;  2BYK A;  3R45 A;  5AY8 D;  1M1A C;  3AL0 C;  2RVQ C;  4H9R B;  5B40 A;  3AZI D;  5B2J D;  1ZLA B;  5AV9 C;  4KGC C;  2G5I C;  1U35 D;  3X1V C;  1P3A D;  3LZ0 D;  4WU9 C;  4H9N A;  3MGR D;  4J8U D;  3X1S C;  4CAY B;  5B1M A;  2CV5 A;  5GT0 C;  4ZUX C;  5B0Z B;  3AN2 C;  3AYW C;  5DNM D;  3X1U C;  1AOI C;  4ZBJ B;  5B2I B;  4DRB A;  2NQB C;  2FFF B;  3VH6 W;  1BH8 B;  3REI B;  3REK A;  4E45 A;  1P34 D;  3LJA B;  4WU8 B;  3P5J B;  3F6T A;  5AVB C;  5E5A D;  4H9O A;  5AY8 B;  4YS3 C;  3AZI B;  2Y2L A;  3C1B A;  5B2J B;  4R8P D;  1U35 B;  2IO5 C;  1P3A B;  5GT3 D;  4G92 C;  5B32 D;  4H9R A;  4QLC C;  3MGR B;  4J8U B;  1ZLA A;  4WJ3 C;  3C1C C;  1P3B D;  5DNM B;  3B0B A;  3KWQ D;  4CAY A;  2FJ7 D;  5CPJ D;  5B0Z A;  1BFM A;  4J8V C;  5B31 G;  5GSU C;  3AV2 C;  1P34 B;  5B2I A;  5E5A B;  1BH8 A;  4Z5T D;  3LJA A;  4WU8 A;  4R8P B;  2F8N B;  5AY8 A;  3REH C;  3KFU G;  5GT3 B;  3WA9 D;  5B32 B;  3AZN C;  3AZI A;  5B2J A;  3WAA C;  1U35 A;  1P3A A;  3W96 C;  3MGP D;  3MGR A;  4J8U A;  1P3O A;  5B0Z C;  3KWQ B;  5JA4 B;  1F66 B;  1M19 C;  2FJ7 B;  5CPJ B;  4J8W C;  4ZBJ C;  5DNM A;  4LD9 C;  5AV8 D;  1Z2C B;  2HIO D;  5CP6 C;  4JJN C;  4Z5T B;  3B6F C;  1P34 A;  5E5A A;  1M1A D;  3WA9 B;  1PZR A;  1Q9C A;  5AV9 D;  4R8P A;  2F8N A;  4KGC D;  1P3O C;  3X1V D;  4WU9 D;  5GT3 A;  4NE5 A;  3X1S D;  3MGP B;  5B32 A;  3LEL C;  3UTA C;  5GT0 D;  4ZUX D;  1KX3 C;  3LZ1 C;  3AN2 D;  3AYW D;  5AV8 B;  5AV6 C;  3X1U D;  3KWQ A;  5JA4 A;  1F66 A;  1KX4 C;  2NQB D;  2FJ7 A;  1A7W A;  5CPJ A;  3REL C;  1KU5 A;  5AVB D;  3H0M C;  1M1A B;  4YS3 D;  4Z5T A;  5CHL B;  5BS7 A;  5AV9 B;  4KGC B;  3MGQ B;  4WU9 B;  2ZY4 A;  3X1S B;  3WA9 A;  4QLC D;  1TZY C;  5GT0 B;  4ZUX B;  3C1C D;  3AN2 B;  3AYW B;  1F66 C;  3MGP A;  3X1U B;  1AOI B;  2NQB B;  3WTP E;  4J8V D;  3VH6 T;  5AV8 A;  5GSU D;  5F99 A;  3AV2 D;  4KUD C;  5AVB B;  3AZE C;  4YS3 B;  3AZK C;  4H9N B;  3REH D;  2IO5 B;  4G92 B;  4WV4 B;  4QLC B;  3AZN D;  3X1T A;  1P3G C;  5AV9 A;  4KGC A;  3C1C B;  3WAA D;  1P3P C;  3MGQ A;  4WU9 A;  3W96 D;  3KUY C;  3X1S A;  3W99 C;  5B0Z D;  5GT0 A;  4ZUX A;  1M19 D;  4Z66 C;  5F99 C;  4J8W D;  3MNN C;  3AN2 A;  4J8V B;  3AYW A;  4X23 C;  4LD9 D;  1F1E A;  5GSU B;  3AV2 B;  3X1U A;  1AOI A;  2NQB A;  5CP6 D;  4JJN D;  3B6F D;  4UPK A;  5AVB A;  3REH B;  3UT9 C;  3X1T C;  4YS3 A;  3AZN B;  5CPK C;  3MGQ C;  1P3O D;  3WAA B;  4Z2M H;  2W8S A;  3W96 B;  1ID3 C;  1TAF B;  3LEL D;  4QLC A;  3UTA D;  3B0D C;  1S32 C;  1KX3 D;  1M19 B;  3LZ1 D;  2XD1 A;  3AFA C;  3C1C A;  1M18 C;  4J8W B;  4LD9 B;  5AV6 D;  1KX4 D;  4J8X C;  5CP6 B;  4JJN B;  3REL D;  4J8V A;  3B6F B;  5GSU A;  3AV2 A;  4M6B A;  1N1J B;  2F8N D;  5AV5 B;  4H9P A;  1KX5 C;  1P3O B;  3REH A;  1TZY D;  2L5A A;  3LEL B;  3UTA B;  3AZN A;  2ARO C;  1KX3 B;  3LZ1 B;  3WAA A;  3W96 A;  1F66 D;  1TAF A;  3EPH A;  5AV6 B;  5BNX B;  1KX4 B;  1M19 A;  4J8W A;  3REL B;  5CPI C;  4LD9 A;  4KUD D;  3KXB C;  1WWS A;  3AZE D;  3AZM C;  3VH5 A;  5CP6 A;  3A6N C;  4JJN A;  3W98 C;  3AZK D;  3TU4 C;  3B6F A;  2YFV B;  1N1J A;  5AV5 A;  1TZY B;  1P3G D;  1P3P D;  2F8N G;  1HQ3 C;  3KUY D;  3W99 D;  4H9S C;  3LEL A;  3UTA A;  2ZM5 A;  5B32 G;  4EO5 C;  3W97 A;  1KX3 A;  3LZ1 A;  4Z66 D;  5F99 D;  3AZF A;  3MNN D;  4G91 C;  5B24 C;  4X23 D;  2JE5 A;  5AV6 A;  4KUD B;  5BNX A;  5AVC B;  1KX4 A;  3AZE B;  3REL A;  5B33 C;  3AZK B;  5AV5 C;  2RVQ D;  3UT9 D;  3X1T D;  4AWL B;  2JCH A;  4NE6 A;  5CPK D;  3MGQ D;  2YFV A;  1P3G B;  2NZD C;  3O62 C;  1P3P B;  4HGA C;  3W97 C;  3KUY B;  2Y2K A;  4YM6 C;  3AZF C;  3W99 B;  1TZY A;  1S32 D;  2G5H C;  3AFA D;  4Z66 B;  5BO0 B;  5F99 B;  3MNN B;  1M18 D;  1AOI D;  4X23 B;  1P3K C;  4J8X D;  5GXQ C;  4E44 A;  5AVC A;  3B6G C;  5B0Y C;  3UT9 B;  3AZE A;  3X1T B;  2F2A C;  4KUD A;  3AZK A;  5CPK B;  5JRG C;  1B67 A;  3AV1 C;  1KX5 D;  5B31 C;  2PYO C;  1ID3 B;  2BYM B;  3B0D B;  1S32 B;  2ARO D;  1P3G A;  3B0C W;  3AFA B;  1M18 B;  1P3P A;  3KUY A;  3W99 A;  1WWI A;  1P3L C;  4J8X B;  3EPL A;  4Z66 A;  5BO0 A;  3MNN A;  5CPI D;  5AVC C;  4X23 A;  1EQZ C;  3MVD C;  3MGS C;  3KXB D;  3AZM D;  3A6N D;  3W98 D;  3TU4 D;  4AWL C;  1KX5 B;  3UT9 A;  3A1I A;  4XUJ C;  2J8P A;  3VH5 W;  5CPK A;  2ARO B;  3EG5 B;  1HQ3 D;  5KDM B;  1ID3 A;  2BYM A;  1S32 A;  5BT1 C;  3AZJ C;  1P3I C;  3AFA A;  1M18 A;  2HUE C;  4H9Q B;  3AZG B;  5B24 D;  5CPI B;  2Y2N A;  5DNN C;  2DQN C;  1P3M C;  3KXB B;  4J8X A;  4H9P B;  3AZM B;  3AZL C;  3A6N B;  3REJ C;  3W98 B;  5B33 D;  3TU4 B;  1P3F A;  5AV5 D;  4DQY B;  1ULY A;  2NZD D;  3WTP C;  3AZH C;  1B6W A;  3O62 D;  1KX5 A;  3WKJ B;  2BG1 A;  1HQ3 B;  3W97 D;  4YM6 D;  3AZF D;  5B1L C;  2ARO A;  4WNN B;  4EO5 B;  4XZQ A;  4WZS B;  2ZY5 A;  4G91 B;  5KDM A;  5B24 B;  1P3K D;  5FUG B;  1P3F C;  4H9Q A;  3AZG A;  5B33 B;  5CPI A;  5GXQ D;  4KHA B;  3B6G D;  3KXB A;  5B0Y D;  3AZM A;  3A6N A;  3W98 A;  3TU4 A;  5JRG D;  3UTB A;  3AV1 D;  2NZD B;  5B31 D;  3O62 B; 
#chains in the Genus database with same CATH homology
 3NQU B;  4HGA B;  5G49 B;  2PYO D;  3W97 B;  4YM6 B;  4XZQ C;  3EPK A;  3AZF B;  3WKJ A;  1HQ3 A;  4H9S A;  1P3L D;  1P3K B;  3AZG C;  2JSS A;  4WNN A;  5B40 C;  5AVC D;  5B24 A;  1EQZ D;  3MVD D;  5GXQ B;  3MGS D;  3B6G B;  5FUG A;  5B0Y B;  3UTB C;  5B1M C;  5B33 A;  3LZ0 B;  2CV5 C;  2XD5 A;  3H0R C;  3IP4 C;  5JRG B;  3AV1 B;  4KHA A;  3NQJ B;  5B31 B;  2PYO B;  2Y2H A;  1HTA A;  4XUJ D;  3WKJ C;  1W2E A;  2NZD A;  5C3I C;  2Y2O A;  3O62 A;  3B0C T;  3NQU A;  5G49 A;  3REK C;  4YM6 A;  1P3L B;  5BT1 D;  3AZJ D;  2DF4 C;  1P3I D;  2UWX A;  4NFT A;  4NE3 A;  3A1K A;  5DNN D;  3C1B C;  1EQZ B;  3MVD B;  3REI A;  3MGS B;  1P3K A;  1P3M D;  2Y2Q A;  3AZL D;  3REJ D;  4DRA A;  1ZLA C;  5GXQ A;  3B6G A;  5B0Y A;  1R4V A;  1P3B B;  4XUJ B;  3LZ0 A;  5JRG A;  3VH5 T;  3WTP D;  3AZH D;  3AV1 A;  1ID3 D;  3NQJ A;  5B31 A;  2Y2M A;  2PYO A;  5B1L D;  3H0L C;  5B2I C;  3AZJ B;  1P3I B;  2HUE B;  3REI C;  5DNN B;  3LJA C;  4WU8 C;  5AY8 C;  1P3L A;  1P3M B;  4UUZ B;  1P3F D;  3AZL B;  3REJ B;  3AZI C;  2RIQ A;  5B2J C;  1EQZ A;  3MVD A;  2Y2J A;  1U35 C;  3MGS A;  3V9R B;  1P3A C;  3LZ0 C;  1BH9 B;  3MGR C;  4J8U C;  3VH6 A;  3WTP B;  2Y2G A;  3EPJ A;  3AZH B;  5DNM C;  1T3U A;  1P3B A;  4XZQ D;  4XUJ A;  5B1L B;  5BNV B;  4Z2M G;  2HIO B;  1P34 C;  2CWE A;  2ZY3 A;  5E5A C;  3AZG D;  3AZJ A;  1P3I A;  1P3F B;  5B40 D;  2ZY2 A;  5DNN A;  4R8P C;  2YFW B;  2Y2I A;  3FDD A;  1P3M A;  4UUZ A;  5GT3 C;  3AZL A;  5B32 C;  3REJ A;  3UTB D;  2Y2P A;  5B1M D;  3X1V B;  2CV5 D;  2F8N H;  4CSR B;  1P3B C;  3KSY A;  3V9R A;  1BH9 A;  1JFI B;  2F8N K;  1H3O B;  3KWQ C;  3WKJ D;  4XZQ B;  2FJ7 C;  3WTP A;  3AZH A;  5CPJ C;  3REK D;  2BYK B;  3R45 B;  5B1L A;  5BNV A;  2HIO A;  4Z5T C;  5B40 B;  3C1B D;  5BS7 C;  3WA9 C;  3UTB B;  5B1M B;  2CV5 B;  1ZLA D;  1M1A A;  2YFW A;  3MGP C;  3X1V A;  4CSR A;  2VQR A;  5C3I B;  1JFI A;  3REK B;  5AV8 C;  1H3O A;  2HIO C;  2LY8 A;  5B2I D;  4H9O B;  3REI D;  3C1B B;  3LJA D;  4WU8 D;  2BYK A;  3R45 A;  5AY8 D;  1M1A C;  3AL0 C;  2RVQ C;  4H9R B;  5B40 A;  3AZI D;  5B2J D;  1ZLA B;  5AV9 C;  4KGC C;  2G5I C;  1U35 D;  3X1V C;  1P3A D;  3LZ0 D;  4WU9 C;  4H9N A;  3MGR D;  4J8U D;  3X1S C;  4CAY B;  5B1M A;  2CV5 A;  5GT0 C;  4ZUX C;  5B0Z B;  3AN2 C;  3AYW C;  5DNM D;  3X1U C;  1AOI C;  4ZBJ B;  5B2I B;  4DRB A;  2NQB C;  2FFF B;  3VH6 W;  1BH8 B;  3REI B;  3REK A;  4E45 A;  1P34 D;  3LJA B;  4WU8 B;  3P5J B;  3F6T A;  5AVB C;  5E5A D;  4H9O A;  5AY8 B;  4YS3 C;  3AZI B;  2Y2L A;  3C1B A;  5B2J B;  4R8P D;  1U35 B;  2IO5 C;  1P3A B;  5GT3 D;  4G92 C;  5B32 D;  4H9R A;  4QLC C;  3MGR B;  4J8U B;  1ZLA A;  4WJ3 C;  3C1C C;  1P3B D;  5DNM B;  3B0B A;  3KWQ D;  4CAY A;  2FJ7 D;  5CPJ D;  5B0Z A;  1BFM A;  4J8V C;  5B31 G;  5GSU C;  3AV2 C;  1P34 B;  5B2I A;  5E5A B;  1BH8 A;  4Z5T D;  3LJA A;  4WU8 A;  4R8P B;  2F8N B;  5AY8 A;  3REH C;  3KFU G;  5GT3 B;  3WA9 D;  5B32 B;  3AZN C;  3AZI A;  5B2J A;  3WAA C;  1U35 A;  1P3A A;  3W96 C;  3MGP D;  3MGR A;  4J8U A;  1P3O A;  5B0Z C;  3KWQ B;  5JA4 B;  1F66 B;  1M19 C;  2FJ7 B;  5CPJ B;  4J8W C;  4ZBJ C;  5DNM A;  4LD9 C;  5AV8 D;  1Z2C B;  2HIO D;  5CP6 C;  4JJN C;  4Z5T B;  3B6F C;  1P34 A;  5E5A A;  1M1A D;  3WA9 B;  1PZR A;  1Q9C A;  5AV9 D;  4R8P A;  2F8N A;  4KGC D;  1P3O C;  3X1V D;  4WU9 D;  5GT3 A;  4NE5 A;  3X1S D;  3MGP B;  5B32 A;  3LEL C;  3UTA C;  5GT0 D;  4ZUX D;  1KX3 C;  3LZ1 C;  3AN2 D;  3AYW D;  5AV8 B;  5AV6 C;  3X1U D;  3KWQ A;  5JA4 A;  1F66 A;  1KX4 C;  2NQB D;  2FJ7 A;  1A7W A;  5CPJ A;  3REL C;  1KU5 A;  5AVB D;  3H0M C;  1M1A B;  4YS3 D;  4Z5T A;  5CHL B;  5BS7 A;  5AV9 B;  4KGC B;  3MGQ B;  4WU9 B;  2ZY4 A;  3X1S B;  3WA9 A;  4QLC D;  1TZY C;  5GT0 B;  4ZUX B;  3C1C D;  3AN2 B;  3AYW B;  1F66 C;  3MGP A;  3X1U B;  1AOI B;  2NQB B;  3WTP E;  4J8V D;  3VH6 T;  5AV8 A;  5GSU D;  5F99 A;  3AV2 D;  4KUD C;  5AVB B;  3AZE C;  4YS3 B;  3AZK C;  4H9N B;  3REH D;  2IO5 B;  4G92 B;  4WV4 B;  4QLC B;  3AZN D;  3X1T A;  1P3G C;  5AV9 A;  4KGC A;  3C1C B;  3WAA D;  1P3P C;  3MGQ A;  4WU9 A;  3W96 D;  3KUY C;  3X1S A;  3W99 C;  5B0Z D;  5GT0 A;  4ZUX A;  1M19 D;  4Z66 C;  5F99 C;  4J8W D;  3MNN C;  3AN2 A;  4J8V B;  3AYW A;  4X23 C;  4LD9 D;  1F1E A;  5GSU B;  3AV2 B;  3X1U A;  1AOI A;  2NQB A;  5CP6 D;  4JJN D;  3B6F D;  4UPK A;  5AVB A;  3REH B;  3UT9 C;  3X1T C;  4YS3 A;  3AZN B;  5CPK C;  3MGQ C;  1P3O D;  3WAA B;  4Z2M H;  2W8S A;  3W96 B;  1ID3 C;  1TAF B;  3LEL D;  4QLC A;  3UTA D;  3B0D C;  1S32 C;  1KX3 D;  1M19 B;  3LZ1 D;  2XD1 A;  3AFA C;  3C1C A;  1M18 C;  4J8W B;  4LD9 B;  5AV6 D;  1KX4 D;  4J8X C;  5CP6 B;  4JJN B;  3REL D;  4J8V A;  3B6F B;  5GSU A;  3AV2 A;  4M6B A;  1N1J B;  2F8N D;  5AV5 B;  4H9P A;  1KX5 C;  1P3O B;  3REH A;  1TZY D;  2L5A A;  3LEL B;  3UTA B;  3AZN A;  2ARO C;  1KX3 B;  3LZ1 B;  3WAA A;  3W96 A;  1F66 D;  1TAF A;  3EPH A;  5AV6 B;  5BNX B;  1KX4 B;  1M19 A;  4J8W A;  3REL B;  5CPI C;  4LD9 A;  4KUD D;  3KXB C;  1WWS A;  3AZE D;  3AZM C;  3VH5 A;  5CP6 A;  3A6N C;  4JJN A;  3W98 C;  3AZK D;  3TU4 C;  3B6F A;  2YFV B;  1N1J A;  5AV5 A;  1TZY B;  1P3G D;  1P3P D;  2F8N G;  1HQ3 C;  3KUY D;  3W99 D;  4H9S C;  3LEL A;  3UTA A;  2ZM5 A;  5B32 G;  4EO5 C;  3W97 A;  1KX3 A;  3LZ1 A;  4Z66 D;  5F99 D;  3AZF A;  3MNN D;  4G91 C;  5B24 C;  4X23 D;  2JE5 A;  5AV6 A;  4KUD B;  5BNX A;  5AVC B;  1KX4 A;  3AZE B;  3REL A;  5B33 C;  3AZK B;  5AV5 C;  2RVQ D;  3UT9 D;  3X1T D;  4AWL B;  2JCH A;  4NE6 A;  5CPK D;  3MGQ D;  2YFV A;  1P3G B;  2NZD C;  3O62 C;  1P3P B;  4HGA C;  3W97 C;  3KUY B;  2Y2K A;  4YM6 C;  3AZF C;  3W99 B;  1TZY A;  1S32 D;  2G5H C;  3AFA D;  4Z66 B;  5BO0 B;  5F99 B;  3MNN B;  1M18 D;  1AOI D;  4X23 B;  1P3K C;  4J8X D;  5GXQ C;  4E44 A;  5AVC A;  3B6G C;  5B0Y C;  3UT9 B;  3AZE A;  3X1T B;  2F2A C;  4KUD A;  3AZK A;  5CPK B;  5JRG C;  1B67 A;  3AV1 C;  1KX5 D;  5B31 C;  2PYO C;  1ID3 B;  2BYM B;  3B0D B;  1S32 B;  2ARO D;  1P3G A;  3B0C W;  3AFA B;  1M18 B;  1P3P A;  3KUY A;  3W99 A;  1WWI A;  1P3L C;  4J8X B;  3EPL A;  4Z66 A;  5BO0 A;  3MNN A;  5CPI D;  5AVC C;  4X23 A;  1EQZ C;  3MVD C;  3MGS C;  3KXB D;  3AZM D;  3A6N D;  3W98 D;  3TU4 D;  4AWL C;  1KX5 B;  3UT9 A;  3A1I A;  4XUJ C;  2J8P A;  3VH5 W;  5CPK A;  2ARO B;  3EG5 B;  1HQ3 D;  5KDM B;  1ID3 A;  2BYM A;  1S32 A;  5BT1 C;  3AZJ C;  1P3I C;  3AFA A;  1M18 A;  2HUE C;  4H9Q B;  3AZG B;  5B24 D;  5CPI B;  2Y2N A;  5DNN C;  2DQN C;  1P3M C;  3KXB B;  4J8X A;  4H9P B;  3AZM B;  3AZL C;  3A6N B;  3REJ C;  3W98 B;  5B33 D;  3TU4 B;  1P3F A;  5AV5 D;  4DQY B;  1ULY A;  2NZD D;  3WTP C;  3AZH C;  1B6W A;  3O62 D;  1KX5 A;  3WKJ B;  2BG1 A;  1HQ3 B;  3W97 D;  4YM6 D;  3AZF D;  5B1L C;  2ARO A;  4WNN B;  4EO5 B;  4XZQ A;  4WZS B;  2ZY5 A;  4G91 B;  5KDM A;  5B24 B;  1P3K D;  5FUG B;  1P3F C;  4H9Q A;  3AZG A;  5B33 B;  5CPI A;  5GXQ D;  4KHA B;  3B6G D;  3KXB A;  5B0Y D;  3AZM A;  3A6N A;  3W98 A;  3TU4 A;  5JRG D;  3UTB A;  3AV1 D;  2NZD B;  5B31 D;  3O62 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...