5KDMB

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone / dna binding protein
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmB00
1P3BB 5B0YA 5B1MD 3NQUA 3AZGA 3W96B 5B1MB 4H9OB 4WNNB 5B31A 4G92C 3X1VA 3WA9C 4JJNC 1HQ3B 5CPIC 1BH9B 4J8UD 3AZHD 3WTPE 1P3PA 3AZHB 3REJC 2HIOA 4ZBJC 1AOID 4EO5C 4H9PA 1AOIB 5AVBC 3AZEC 4J8VD 3W97C 5GT3A 4E44A 3MNNA 4R8PA 4J8VB 4KUDC 3LJAB 3C1BD 3AFAD 4WU8C 2CV5D 3KWQC 1KU5A 3MGRD 3C1BB 4NE3A 3W99D 5FUGB 5CPJC 1EQZD 3MGSD 1P3LA 3MGRB 3A6NC 5CP6B 1ID3D 3MGSB 3LELD 1KX3C 4YM6D 3UTAD 3O62D 4WV4B 1M18D 1ID3B 3LELB 4YM6B 3AZMA 5CPKD 3O62B 2YFVB 1M18B 5C3IC 5CPKB 5B2IA 2AROC 4XZQC 3WA9D 3AN2C 4LD9C 4JJND 3LZ1C 2NQBA 5CPID 3RELA 3B6FA 4J8XC 3REJD 5BS7A 2PYOA 2IO5B 5AVCD 3KXBA 2YFWB 3REJB 3AV1A 5AVBD 3AZED 5AVCB 4EO5B 3UTBC 5B32D 3MNNB 3W97D 5AV9C 4Z2MH 1JFIA 5B32B 4KUDD 3X1SC 3W97B 4X23A 2LY8A 1WWSA 3KWQD 3MVDB 4KUDB 3B0DB 4H9NA 1M19A 5CPJD 1P3AC 1P3GB 3KWQB 3A6ND 4H9QA 5DNMA 5B33C 1KX3D 3KUYA 1P3KA 3AZMB 5B0ZA 1P3OC 3AZJB 1Q9CA 3AZIA 1ZLAC 4HGAB 2AROD 5AY8C 4XZQD 1P3BC 3AN2D 4LD9D 2NQBB 5C3IB 3LZ1D 5G49A 3W96C 4XZQB 3WAAA 3AN2B 3B6FB 3REKC 3B6GA 4G91C 4J8XD 3VH6A 3VH5T 1M1AA 1HQ3C 3TU4A 4CSRA 3AZHC 1JFIB 5AV9D 3AYWA 4X23B 5JA4B 3X1SD 1AOIC 5AV9B 3C1CB 4Z66D 5GXQC 5BNXB 5AV6A 4J8VC 1P3AD 4Z66B 3LJAC 5B33D 1R4VA 3KUYB 3VH5A 2NZDA 5B33B 5F99A 4UUZB 3MGRC 5B0ZB 5CP6C 3MGSC 5BO0B 4Z5TB 3LZ0A 5AY8D 4QLCA 3LELC 1F66A 1P3BD 4ZUXA 3KSYA 3AV2D 5B31C 5CPKC 3W98B 3X1VC 3W96D 3REKD 3MGPA 3WKJA 1KX5A 3AV2B 3REKB 1HQ3D 4G91B 3VH6W 1P3PC 2HIOC 2IO5C 4CAYA 3UT9A 1F1EA 4J8WB 2CV5A 4DRBA 5AVCC 3B0CW 3MNNC 5GXQD 4YS3D 2F8NH 1S32A 1ULYA 5DNND 5B24D 2F8NB 5B32C 3LJAD 5GXQB 3V9RA 5AV8A 1TZYA 3REHA 4YS3B 5DNNB 5B24B 3UTAA 3MVDC 3B0DC 5F99B 5GSUA 1P3LC 1P3GC 1TAFB 1B6WA 3VH5W 5CP6D 3WA9A 1F66B 4JJNA 3AZMC 5CPIA 3AZFA 3AZJC 4E45A 5B2IC 5B0YB 3MGQA 4KHAA 3WKJB 5B31D 3NQUB 4HGAC 3X1VD 3AZGB 2FJ7A 2NQBC 2JSSA 5B31B 3X1VB 5KDMA 1N1JA 5AVBA 3AZEA 3RELC 1P3PD 3B6FC 3B0BA 2HIOD 3X1UA 3REIA 1P3PB 3KXBC 3UT9B 2HIOB 4WU8A 4H9PB 1U35A 3MNND 5CPJA 1P3MA 2BYKA 5AV8B 5B32G 4X23C 3A6NA 5GT3B 4Z2MG 4R8PB 4H9RA 3C1CC 1P3FA 5JRGA 3MVDD 1P3LD 1P3GD 4Z66C 4WU9A 3KUYC 1P3LB 4AWLB 2AROA 3AZMD 5B0ZC 1B67A 3LZ1A 3AZFB 1KX4A 3AZIC 3AZJD 4KHAB 5AV5A 5B2ID 4Z5TC 2FJ7B 5B2IB 2RVQC 4NE5A 2NQBD 5KDMB 1N1JB 4KGCA 3RELD 3W98C 3B6FD 3X1UB 3UTBA 1BH8A 3REIB 2PYOD 3TU4C 3AV2C 3RELB 3KXBD 1P34A 5B40A 3X1TA 3AV1D 2PYOB 2BYMA 3KXBB 1U35B 4XUJA 3AYWC 3AV1B 5B2JA 5GT0A 1P3AA 5B1LA 3WTPA 4DRAA 4X23D 4J8WC 3R45A 1P3FB 5JRGB 3C1CD 3AZKA 5E5AA 4WZSB 4H9NB 4NE6A 4YS3C 1P3OA 1M19B 5DNNC 5B24C 3KUYD 1P3KD 1ZLAA 4H9QB 5DNMB 5F99C 1P3IA 3AZNA 1P3BA 3AZLA 1KX4B 1P3KB 5B0ZD 3W96A 3AZID 3LZ0C 5B1MA 4H9OA 4Z5TD 4QLCC 1F66C 3AZIB 1HQ3A 2RVQD 1BH9A 4ZUXC 2HUEB 5B0YC 3MGPC 4J8UA 3AZHA 3W98D 3WKJC 3AZGC 5G49B 1KX5C 3WAAB 1M1AD 3TU4D 3B6GB 3X1TB 1AOIA 2BYMB 1M1AB 3TU4B 4CSRB 5B2JB 3AYWD 4J8VA 5B1LB 1HTAA 3UT9C 3LJAA 3AYWB 4J8WD 4H9SA 3C1BA 5E5AB 3AFAA 5FUGA 3REHC 5AV8C 3MGRA 1TZYC 5AV6B 5GT3C 2F8ND 3W99A 3NQJA 4R8PC 1EQZA 3MGSA 1P3IB 5GSUC 2NZDD 1ID3A 5F99D 3AZLB 3LELA 4YM6A 3O62A 2YFVA 2NZDB 1M18A 4AWLC 5CPKA 3LZ0D 2F8NK 4QLCD 1F66D 3AZFC 3LZ0B 4ZUXD 3MGQC 4QLCB 4J8UB 5B0YD 2CWEA 3MGPD 4ZUXB 2FJ7C 3WKJD 3AZGD 1KX5D 2L5AA 5B31G 3MGPB 2YFWA 3REJA 1KX5B 5BT1C 5AVCA 3X1UC 3REIC 3UT9D 5B32A 3W97A 5BS7C 2PYOC 4CAYB 1U35C 3AFAB 3MVDA 4KUDA 3AV1C 2CV5B 1S32D 1P3MC 1P3GA 3KWQA 3REHD 3NQJB 5AV8D 3W99B 1TZYD 1S32B 1EQZB 5GT3D 1P3FC 4R8PD 5JRGC 3REHB 3V9RB 1TZYB 5GSUD 3UTAB 4WU9C 1KX3A 1M19C 5GSUB 3AZJA 5DNMC 1KX4C 1P3KC 4G92B 3AZFD 3WA9B 5AV5C 1A7WA 4JJNB 4XZQA 3MGQD 4LD9A 3AN2A 5CPIB 2FJ7D 3MGQB 4KGCC 4ZBJB 2HUEC 4J8XA 5BT1D 3X1UD 5AVBB 3WAAC 3REID 3AZEB 1P34C 5B40C 3B6GC 3X1TC 5JA4A 4WU8D 5AV9A 4XUJC 1M1AC 3C1CA 1H3OA 5BNXA 1U35D 4NFTA 5B2JC 4WU8B 5GT0C 3X1SA 1P3MD 5B1LC 3VH6T 3WTPC 5BNVA 4Z66A 5CPJB 1P3MB 1P3FD 2BYKB 5JRGD 3A6NB 3AZKC 5E5AC 5B33A 4H9RB 1KX3B 4UUZA 4WU9D 5AV6C 3B0CT 1M19D 5BO0A 1P3IC 4Z5TA 4WU9B 1WWIA 5DNMD 3AZNC 3AZLC 1KX4D 2AROB 2NZDC 4LD9B 5AY8A 5AV5D 5B1MC 3LZ1B 3W98A 4M6BA 5AV5B 3AV2A 4KGCD 4J8XB 3REKA 4WNNA 4J8UC 3UTBD 4KGCB 3WAAD 1P34D 5B40D 3UTBB 3B6GD 1BH8B 3X1TD 4J8WA 1H3OB 1P34B 5B40B 4XUJD 3X1SB 5CHLB 5B2JD 5BNVB 5GT0D 5B1LD 4XUJB 3WTPD 2F8NA 5GXQA 4YS3A 5GT0B 4H9SC 1P3AB 5DNNA 3WTPB 5B24A 3C1BC 3AFAC 3AZKD 2CV5C 3R45B 5E5AD 1TAFA 3W99C 1P3OD 3AZKB 1S32C 5AV6D 1EQZC 1ZLAD 1P3OB 1P3ID 1ID3C 2F8NG 1BFMA 3AZND 5CP6A 4YM6C 3AZLD 3UTAC 1ZLAB 3O62C 1M18C 5AY8B 3AZNB
chains in the Genus database with same CATH superfamily
1P3BB 5B0YA 5B1MD 3NQUA 3AZGA 3W96B 5B1MB 4H9OB 4WNNB 5B31A 4G92C 3X1VA 3WA9C 4JJNC 1HQ3B 5CPIC 1BH9B 4J8UD 3AZHD 3WTPE 1P3PA 3AZHB 3REJC 2HIOA 4ZBJC 1AOID 3EPLA 4EO5C 4H9PA 1AOIB 5AVBC 3AZEC 4J8VD 3W97C 1Z2CB 5GT3A 4E44A 2W8SA 4R8PA 3MNNA 4J8VB 4KUDC 3LJAB 3C1BD 3AFAD 4WU8C 2CV5D 3KWQC 1KU5A 3MGRD 3C1BB 4NE3A 3W99D 5FUGB 5CPJC 1EQZD 3MGSD 1P3LA 3MGRB 3A6NC 2Y2NA 5CP6B 1ID3D 3MGSB 3LELD 1KX3C 4YM6D 3UTAD 3O62D 4WV4B 1M18D 1ID3B 3LELB 4YM6B 3AZMA 5CPKD 3O62B 2YFVB 4DQYB 1M18B 5C3IC 5CPKB 5B2IA 2AROC 4XZQC 3WA9D 3AN2C 2G5HC 4LD9C 4JJND 3LZ1C 2NQBA 5CPID 3F6TA 3RELA 3B6FA 4J8XC 2Y2PA 3REJD 5BS7A 2PYOA 2IO5B 5AVCD 3KXBA 2YFWB 3REJB 3AV1A 5AVBD 3AZED 5AVCB 4EO5B 3UTBC 5B32D 3MNNB 3W97D 5AV9C 4Z2MH 1JFIA 5B32B 4KUDD 3X1SC 3W97B 4X23A 2LY8A 1WWSA 3KWQD 3MVDB 4KUDB 3B0DB 4H9NA 1M19A 5CPJD 1P3AC 1P3GB 3KWQB 3A6ND 4H9QA 5DNMA 5B33C 1KX3D 3KUYA 2ZY2A 1P3KA 3AZMB 5B0ZA 1P3OC 3AZJB 1Q9CA 2ZY4A 3AZIA 1ZLAC 4HGAB 2AROD 5AY8C 4XZQD 1P3BC 3AN2D 4LD9D 2ZY3A 2NQBB 5C3IB 3LZ1D 5G49A 3W96C 4XZQB 3WAAA 3AN2B 3B6FB 1T3UA 3REKC 3B6GA 4G91C 4J8XD 3VH6A 3VH5T 1M1AA 1HQ3C 3TU4A 4CSRA 3AZHC 3H0RC 1JFIB 5AV9D 2G5IC 3AYWA 3IP4C 4X23B 5JA4B 3X1SD 1AOIC 5AV9B 3C1CB 4Z66D 5GXQC 5BNXB 5AV6A 4J8VC 1P3AD 4Z66B 3LJAC 5B33D 1R4VA 3KUYB 3AL0C 3VH5A 2NZDA 5B33B 5F99A 4UUZB 3MGRC 5B0ZB 5CP6C 3MGSC 2JE5A 5BO0B 4Z5TB 2XD1A 3LZ0A 5AY8D 4QLCA 3LELC 1F66A 1P3BD 4ZUXA 3KSYA 3AV2D 5B31C 5CPKC 3W98B 3X1VC 3W96D 3REKD 3MGPA 3WKJA 1KX5A 3AV2B 1W2EA 1HQ3D 4G91B 3REKB 3VH6W 1P3PC 2HIOC 2IO5C 4CAYA 3UT9A 1F1EA 4J8WB 2CV5A 4DRBA 5AVCC 3B0CW 3MNNC 5GXQD 4YS3D 2F8NH 1S32A 1ULYA 5DNND 5B24D 2F8NB 5B32C 3LJAD 5GXQB 3V9RA 5AV8A 1TZYA 3REHA 4YS3B 5DNNB 2BG1A 5B24B 3UTAA 3MVDC 3B0DC 5F99B 5GSUA 1P3LC 2VQRA 1P3GC 1TAFB 1B6WA 3VH5W 5CP6D 3WA9A 1F66B 4JJNA 3AZMC 5CPIA 3EPKA 3AZFA 3AZJC 4E45A 5B2IC 5B0YB 3MGQA 4KHAA 3WKJB 5B31D 3NQUB 4HGAC 3X1VD 3AZGB 2FJ7A 2NQBC 2JSSA 5B31B 3X1VB 5KDMA 1N1JA 5AVBA 3AZEA 3RELC 1P3PD 3B6FC 3B0BA 2HIOD 3X1UA 3KFUG 3REIA 1P3PB 3KXBC 3UT9B 2HIOB 4WU8A 4H9PB 1U35A 3MNND 5CPJA 1P3MA 2BYKA 5AV8B 5B32G 4X23C 3A6NA 5GT3B 4Z2MG 2UWXA 4R8PB 4H9RA 3C1CC 1P3FA 5JRGA 3MVDD 3H0MC 1P3LD 1P3GD 4Z66C 4WU9A 3KUYC 1P3LB 4AWLB 2ZY5A 2AROA 3AZMD 1B67A 5B0ZC 3LZ1A 3AZFB 1KX4A 3AZIC 3AZJD 4KHAB 5AV5A 5B2ID 4Z5TC 2DF4C 2FJ7B 2ZM5A 2J8PA 5B2IB 2RVQC 4NE5A 2NQBD 5KDMB 1N1JB 4KGCA 3RELD 3W98C 3B6FD 3X1UB 3UTBA 1BH8A 3REIB 2Y2IA 2PYOD 3TU4C 3AV2C 3RELB 3KXBD 1P34A 5B40A 3X1TA 3AV1D 2PYOB 2BYMA 3KXBB 1U35B 4XUJA 3AYWC 3AV1B 5B2JA 3A1IA 5GT0A 1P3AA 5B1LA 3WTPA 4DRAA 4X23D 4J8WC 3R45A 1P3FB 5JRGB 3C1CD 3AZKA 5E5AA 4WZSB 4H9NB 4NE6A 4YS3C 1P3OA 1M19B 5DNNC 5B24C 3KUYD 1P3KD 1ZLAA 4H9QB 5DNMB 5F99C 1P3IA 3AZNA 1P3BA 3AZLA 1KX4B 1P3KB 5B0ZD 2Y2GA 3W96A 3AZID 3LZ0C 5B1MA 4H9OA 4Z5TD 4QLCC 1F66C 3AZIB 1HQ3A 2RVQD 1BH9A 4ZUXC 2HUEB 5B0YC 3MGPC 4J8UA 3AZHA 3W98D 3WKJC 3AZGC 5G49B 1KX5C 2JCHA 3WAAB 1M1AD 3TU4D 3B6GB 3X1TB 1AOIA 2BYMB 1M1AB 3TU4B 4CSRB 5B2JB 2DQNC 3AYWD 4J8VA 5B1LB 1HTAA 3UT9C 3LJAA 1PZRA 3AYWB 4J8WD 4H9SA 3C1BA 5E5AB 3AFAA 5FUGA 2F2AC 3REHC 5AV8C 3MGRA 1TZYC 2FFFB 5GT3C 5AV6B 2F8ND 3NQJA 4R8PC 3W99A 1EQZA 3MGSA 4UPKA 1P3IB 5GSUC 2NZDD 3EPJA 5F99D 3AZLB 1ID3A 3LELA 4YM6A 3P5JB 3O62A 2YFVA 2NZDB 1M18A 3H0LC 4AWLC 5CPKA 3LZ0D 2F8NK 4QLCD 1F66D 2Y2KA 3AZFC 3LZ0B 4ZUXD 3MGQC 4QLCB 4J8UB 5B0YD 2CWEA 3MGPD 4ZUXB 2FJ7C 2Y2OA 3WKJD 3AZGD 1KX5D 2L5AA 5B31G 3FDDA 3MGPB 2YFWA 3REJA 1KX5B 5BT1C 5AVCA 3X1UC 3REIC 3UT9D 5B32A 3W97A 5BS7C 2PYOC 4CAYB 1U35C 3AFAB 3MVDA 2Y2JA 4KUDA 3AV1C 2CV5B 1S32D 1P3MC 1P3GA 3KWQA 3REHD 3NQJB 5AV8D 3W99B 1TZYD 2Y2MA 1S32B 5GT3D 1P3FC 1EQZB 4R8PD 5JRGC 3REHB 3V9RB 4WJ3C 1TZYB 5GSUD 3UTAB 4WU9C 1KX3A 1M19C 5GSUB 3AZJA 3EPHA 5DNMC 1KX4C 2Y2QA 1P3KC 4G92B 3AZFD 3WA9B 5AV5C 1A7WA 4JJNB 4XZQA 3MGQD 4LD9A 3AN2A 5CPIB 2FJ7D 3MGQB 4KGCC 4ZBJB 2HUEC 4J8XA 5BT1D 3X1UD 5AVBB 3WAAC 3REID 3A1KA 3AZEB 5B40C 1P34C 3B6GC 3X1TC 5JA4A 4WU8D 5AV9A 4XUJC 1M1AC 3C1CA 1H3OA 5BNXA 1U35D 4NFTA 5B2JC 4WU8B 5GT0C 3X1SA 1P3MD 5B1LC 3VH6T 3WTPC 5BNVA 4Z66A 5CPJB 1P3MB 1P3FD 2BYKB 5JRGD 3A6NB 3AZKC 5E5AC 5B33A 4H9RB 1KX3B 4UUZA 4WU9D 5AV6C 3B0CT 1M19D 5BO0A 1P3IC 4Z5TA 4WU9B 1WWIA 5DNMD 3AZNC 3AZLC 1KX4D 2AROB 2NZDC 4LD9B 5AY8A 5AV5D 5B1MC 3LZ1B 3W98A 4M6BA 5AV5B 3AV2A 4KGCD 4J8XB 3REKA 4WNNA 4J8UC 3UTBD 4KGCB 2Y2HA 2XD5A 1P34D 3WAAD 5B40D 3UTBB 3B6GD 1BH8B 3X1TD 4J8WA 1H3OB 1P34B 5B40B 4XUJD 3X1SB 5CHLB 5B2JD 5BNVB 5GT0D 5B1LD 4XUJB 3WTPD 2F8NA 5GXQA 4YS3A 3EG5B 5GT0B 4H9SC 1P3AB 5DNNA 3WTPB 5B24A 3C1BC 3AFAC 2Y2LA 3AZKD 2CV5C 3R45B 5E5AD 1TAFA 3W99C 1P3OD 3AZKB 1S32C 5AV6D 1EQZC 1ZLAD 1P3OB 1P3ID 1ID3C 2F8NG 1BFMA 3AZND 5CP6A 4YM6C 3AZLD 3UTAC 1ZLAB 3O62C 1M18C 5AY8B 3AZNB 2RIQA
chains in the Genus database with same CATH topology
1P3BB 5B0YA 5B1MD 3NQUA 3AZGA 3W96B 5B1MB 4H9OB 4WNNB 5B31A 4G92C 3X1VA 3WA9C 4JJNC 1HQ3B 5CPIC 1BH9B 4J8UD 3AZHD 3WTPE 1P3PA 3AZHB 3REJC 2HIOA 4ZBJC 1AOID 3EPLA 4EO5C 4H9PA 1AOIB 5AVBC 3AZEC 4J8VD 3W97C 1Z2CB 5GT3A 4E44A 2W8SA 4R8PA 3MNNA 4J8VB 4KUDC 3LJAB 3C1BD 3AFAD 4WU8C 2CV5D 3KWQC 1KU5A 3MGRD 3C1BB 4NE3A 3W99D 5FUGB 5CPJC 1EQZD 3MGSD 1P3LA 3MGRB 3A6NC 2Y2NA 5CP6B 1ID3D 3MGSB 3LELD 1KX3C 4YM6D 3UTAD 3O62D 4WV4B 1M18D 1ID3B 3LELB 4YM6B 3AZMA 5CPKD 3O62B 2YFVB 4DQYB 1M18B 5C3IC 5CPKB 5B2IA 2AROC 4XZQC 3WA9D 3AN2C 2G5HC 4LD9C 4JJND 3LZ1C 2NQBA 5CPID 3F6TA 3RELA 3B6FA 4J8XC 2Y2PA 3REJD 5BS7A 2PYOA 2IO5B 5AVCD 3KXBA 2YFWB 3REJB 3AV1A 5AVBD 3AZED 5AVCB 4EO5B 3UTBC 5B32D 3MNNB 3W97D 5AV9C 4Z2MH 1JFIA 5B32B 4KUDD 3X1SC 3W97B 4X23A 2LY8A 1WWSA 3KWQD 3MVDB 4KUDB 3B0DB 4H9NA 1M19A 5CPJD 1P3AC 1P3GB 3KWQB 3A6ND 4H9QA 5DNMA 5B33C 1KX3D 3KUYA 2ZY2A 1P3KA 3AZMB 5B0ZA 1P3OC 3AZJB 1Q9CA 2ZY4A 3AZIA 1ZLAC 4HGAB 2AROD 5AY8C 4XZQD 1P3BC 3AN2D 4LD9D 2ZY3A 2NQBB 5C3IB 3LZ1D 5G49A 3W96C 4XZQB 3WAAA 3AN2B 3B6FB 1T3UA 3REKC 3B6GA 4G91C 4J8XD 3VH6A 3VH5T 1M1AA 1HQ3C 3TU4A 4CSRA 3AZHC 3H0RC 1JFIB 5AV9D 2G5IC 3AYWA 3IP4C 4X23B 5JA4B 3X1SD 1AOIC 5AV9B 3C1CB 4Z66D 5GXQC 5BNXB 5AV6A 4J8VC 1P3AD 4Z66B 3LJAC 5B33D 1R4VA 3KUYB 3AL0C 3VH5A 2NZDA 5B33B 5F99A 4UUZB 3MGRC 5B0ZB 5CP6C 3MGSC 2JE5A 5BO0B 4Z5TB 2XD1A 3LZ0A 5AY8D 4QLCA 3LELC 1F66A 1P3BD 4ZUXA 3KSYA 3AV2D 5B31C 5CPKC 3W98B 3X1VC 3W96D 3REKD 3MGPA 3WKJA 1KX5A 3AV2B 1W2EA 1HQ3D 4G91B 3REKB 3VH6W 1P3PC 2HIOC 2IO5C 4CAYA 3UT9A 1F1EA 4J8WB 2CV5A 4DRBA 5AVCC 3B0CW 3MNNC 5GXQD 4YS3D 2F8NH 1S32A 1ULYA 5DNND 5B24D 2F8NB 5B32C 3LJAD 5GXQB 3V9RA 5AV8A 1TZYA 3REHA 4YS3B 5DNNB 2BG1A 5B24B 3UTAA 3MVDC 3B0DC 5F99B 5GSUA 1P3LC 2VQRA 1P3GC 1TAFB 1B6WA 3VH5W 5CP6D 3WA9A 1F66B 4JJNA 3AZMC 5CPIA 3EPKA 3AZFA 3AZJC 4E45A 5B2IC 5B0YB 3MGQA 4KHAA 3WKJB 5B31D 3NQUB 4HGAC 3X1VD 3AZGB 2FJ7A 2NQBC 2JSSA 5B31B 3X1VB 5KDMA 1N1JA 5AVBA 3AZEA 3RELC 1P3PD 3B6FC 3B0BA 2HIOD 3X1UA 3KFUG 3REIA 1P3PB 3KXBC 3UT9B 2HIOB 4WU8A 4H9PB 1U35A 3MNND 5CPJA 1P3MA 2BYKA 5AV8B 5B32G 4X23C 3A6NA 5GT3B 4Z2MG 2UWXA 4R8PB 4H9RA 3C1CC 1P3FA 5JRGA 3MVDD 3H0MC 1P3LD 1P3GD 4Z66C 4WU9A 3KUYC 1P3LB 4AWLB 2ZY5A 2AROA 3AZMD 1B67A 5B0ZC 3LZ1A 3AZFB 1KX4A 3AZIC 3AZJD 4KHAB 5AV5A 5B2ID 4Z5TC 2DF4C 2FJ7B 2ZM5A 2J8PA 5B2IB 2RVQC 4NE5A 2NQBD 5KDMB 1N1JB 4KGCA 3RELD 3W98C 3B6FD 3X1UB 3UTBA 1BH8A 3REIB 2Y2IA 2PYOD 3TU4C 3AV2C 3RELB 3KXBD 1P34A 5B40A 3X1TA 3AV1D 2PYOB 2BYMA 3KXBB 1U35B 4XUJA 3AYWC 3AV1B 5B2JA 3A1IA 5GT0A 1P3AA 5B1LA 3WTPA 4DRAA 4X23D 4J8WC 3R45A 1P3FB 5JRGB 3C1CD 3AZKA 5E5AA 4WZSB 4H9NB 4NE6A 4YS3C 1P3OA 1M19B 5DNNC 5B24C 3KUYD 1P3KD 1ZLAA 4H9QB 5DNMB 5F99C 1P3IA 3AZNA 1P3BA 3AZLA 1KX4B 1P3KB 5B0ZD 2Y2GA 3W96A 3AZID 3LZ0C 5B1MA 4H9OA 4Z5TD 4QLCC 1F66C 3AZIB 1HQ3A 2RVQD 1BH9A 4ZUXC 2HUEB 5B0YC 3MGPC 4J8UA 3AZHA 3W98D 3WKJC 3AZGC 5G49B 1KX5C 2JCHA 3WAAB 1M1AD 3TU4D 3B6GB 3X1TB 1AOIA 2BYMB 1M1AB 3TU4B 4CSRB 5B2JB 2DQNC 3AYWD 4J8VA 5B1LB 1HTAA 3UT9C 3LJAA 1PZRA 3AYWB 4J8WD 4H9SA 3C1BA 5E5AB 3AFAA 5FUGA 2F2AC 3REHC 5AV8C 3MGRA 1TZYC 2FFFB 5GT3C 5AV6B 2F8ND 3NQJA 4R8PC 3W99A 1EQZA 3MGSA 4UPKA 1P3IB 5GSUC 2NZDD 3EPJA 5F99D 3AZLB 1ID3A 3LELA 4YM6A 3P5JB 3O62A 2YFVA 2NZDB 1M18A 3H0LC 4AWLC 5CPKA 3LZ0D 2F8NK 4QLCD 1F66D 2Y2KA 3AZFC 3LZ0B 4ZUXD 3MGQC 4QLCB 4J8UB 5B0YD 2CWEA 3MGPD 4ZUXB 2FJ7C 2Y2OA 3WKJD 3AZGD 1KX5D 2L5AA 5B31G 3FDDA 3MGPB 2YFWA 3REJA 1KX5B 5BT1C 5AVCA 3X1UC 3REIC 3UT9D 5B32A 3W97A 5BS7C 2PYOC 4CAYB 1U35C 3AFAB 3MVDA 2Y2JA 4KUDA 3AV1C 2CV5B 1S32D 1P3MC 1P3GA 3KWQA 3REHD 3NQJB 5AV8D 3W99B 1TZYD 2Y2MA 1S32B 5GT3D 1P3FC 1EQZB 4R8PD 5JRGC 3REHB 3V9RB 4WJ3C 1TZYB 5GSUD 3UTAB 4WU9C 1KX3A 1M19C 5GSUB 3AZJA 3EPHA 5DNMC 1KX4C 2Y2QA 1P3KC 4G92B 3AZFD 3WA9B 5AV5C 1A7WA 4JJNB 4XZQA 3MGQD 4LD9A 3AN2A 5CPIB 2FJ7D 3MGQB 4KGCC 4ZBJB 2HUEC 4J8XA 5BT1D 3X1UD 5AVBB 3WAAC 3REID 3A1KA 3AZEB 5B40C 1P34C 3B6GC 3X1TC 5JA4A 4WU8D 5AV9A 4XUJC 1M1AC 3C1CA 1H3OA 5BNXA 1U35D 4NFTA 5B2JC 4WU8B 5GT0C 3X1SA 1P3MD 5B1LC 3VH6T 3WTPC 5BNVA 4Z66A 5CPJB 1P3MB 1P3FD 2BYKB 5JRGD 3A6NB 3AZKC 5E5AC 5B33A 4H9RB 1KX3B 4UUZA 4WU9D 5AV6C 3B0CT 1M19D 5BO0A 1P3IC 4Z5TA 4WU9B 1WWIA 5DNMD 3AZNC 3AZLC 1KX4D 2AROB 2NZDC 4LD9B 5AY8A 5AV5D 5B1MC 3LZ1B 3W98A 4M6BA 5AV5B 3AV2A 4KGCD 4J8XB 3REKA 4WNNA 4J8UC 3UTBD 4KGCB 2Y2HA 2XD5A 1P34D 3WAAD 5B40D 3UTBB 3B6GD 1BH8B 3X1TD 4J8WA 1H3OB 1P34B 5B40B 4XUJD 3X1SB 5CHLB 5B2JD 5BNVB 5GT0D 5B1LD 4XUJB 3WTPD 2F8NA 5GXQA 4YS3A 3EG5B 5GT0B 4H9SC 1P3AB 5DNNA 3WTPB 5B24A 3C1BC 3AFAC 2Y2LA 3AZKD 2CV5C 3R45B 5E5AD 1TAFA 3W99C 1P3OD 3AZKB 1S32C 5AV6D 1EQZC 1ZLAD 1P3OB 1P3ID 1ID3C 2F8NG 1BFMA 3AZND 5CP6A 4YM6C 3AZLD 3UTAC 1ZLAB 3O62C 1M18C 5AY8B 3AZNB 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B B;  5B0Y A;  5B1M D;  3NQU A;  3AZG A;  3W96 B;  5B1M B;  4H9O B;  4WNN B;  5B31 A;  4G92 C;  3X1V A;  3WA9 C;  4JJN C;  1HQ3 B;  5CPI C;  1BH9 B;  4J8U D;  3AZH D;  3WTP E;  1P3P A;  3AZH B;  3REJ C;  2HIO A;  4ZBJ C;  1AOI D;  4EO5 C;  4H9P A;  1AOI B;  5AVB C;  3AZE C;  4J8V D;  3W97 C;  5GT3 A;  4E44 A;  3MNN A;  4R8P A;  4J8V B;  4KUD C;  3LJA B;  3C1B D;  3AFA D;  4WU8 C;  2CV5 D;  3KWQ C;  1KU5 A;  3MGR D;  3C1B B;  4NE3 A;  3W99 D;  5FUG B;  5CPJ C;  1EQZ D;  3MGS D;  1P3L A;  3MGR B;  3A6N C;  5CP6 B;  1ID3 D;  3MGS B;  3LEL D;  1KX3 C;  4YM6 D;  3UTA D;  3O62 D;  4WV4 B;  1M18 D;  1ID3 B;  3LEL B;  4YM6 B;  3AZM A;  5CPK D;  3O62 B;  2YFV B;  1M18 B;  5C3I C;  5CPK B;  5B2I A;  2ARO C;  4XZQ C;  3WA9 D;  3AN2 C;  4LD9 C;  4JJN D;  3LZ1 C;  2NQB A;  5CPI D;  3REL A;  3B6F A;  4J8X C;  3REJ D;  5BS7 A;  2PYO A;  2IO5 B;  5AVC D;  3KXB A;  2YFW B;  3REJ B;  3AV1 A;  5AVB D;  3AZE D;  5AVC B;  4EO5 B;  3UTB C;  5B32 D;  3MNN B;  3W97 D;  5AV9 C;  4Z2M H;  1JFI A;  5B32 B;  4KUD D;  3X1S C;  3W97 B;  4X23 A;  2LY8 A;  1WWS A;  3KWQ D;  3MVD B;  4KUD B;  3B0D B;  4H9N A;  1M19 A;  5CPJ D;  1P3A C;  1P3G B;  3KWQ B;  3A6N D;  4H9Q A;  5DNM A;  5B33 C;  1KX3 D;  3KUY A;  1P3K A;  3AZM B;  5B0Z A;  1P3O C;  3AZJ B;  1Q9C A;  3AZI A;  1ZLA C;  4HGA B;  2ARO D;  5AY8 C;  4XZQ D;  1P3B C;  3AN2 D;  4LD9 D;  2NQB B;  5C3I B;  3LZ1 D;  5G49 A;  3W96 C;  4XZQ B;  3WAA A;  3AN2 B;  3B6F B;  3REK C;  3B6G A;  4G91 C;  4J8X D;  3VH6 A;  3VH5 T;  1M1A A;  1HQ3 C;  3TU4 A;  4CSR A;  3AZH C;  1JFI B;  5AV9 D;  3AYW A;  4X23 B;  5JA4 B;  3X1S D;  1AOI C;  5AV9 B;  3C1C B;  4Z66 D;  5GXQ C;  5BNX B;  5AV6 A;  4J8V C;  1P3A D;  4Z66 B;  3LJA C;  5B33 D;  1R4V A;  3KUY B;  3VH5 A;  2NZD A;  5B33 B;  5F99 A;  4UUZ B;  3MGR C;  5B0Z B;  5CP6 C;  3MGS C;  5BO0 B;  4Z5T B;  3LZ0 A;  5AY8 D;  4QLC A;  3LEL C;  1F66 A;  1P3B D;  4ZUX A;  3KSY A;  3AV2 D;  5B31 C;  5CPK C;  3W98 B;  3X1V C;  3W96 D;  3REK D;  3MGP A;  3WKJ A;  1KX5 A;  3AV2 B;  3REK B;  1HQ3 D;  4G91 B;  3VH6 W;  1P3P C;  2HIO C;  2IO5 C;  4CAY A;  3UT9 A;  1F1E A;  4J8W B;  2CV5 A;  4DRB A;  5AVC C;  3B0C W;  3MNN C;  5GXQ D;  4YS3 D;  2F8N H;  1S32 A;  1ULY A;  5DNN D;  5B24 D;  2F8N B;  5B32 C;  3LJA D;  5GXQ B;  3V9R A;  5AV8 A;  1TZY A;  3REH A;  4YS3 B;  5DNN B;  5B24 B;  3UTA A;  3MVD C;  3B0D C;  5F99 B;  5GSU A;  1P3L C;  1P3G C;  1TAF B;  1B6W A;  3VH5 W;  5CP6 D;  3WA9 A;  1F66 B;  4JJN A;  3AZM C;  5CPI A;  3AZF A;  3AZJ C;  4E45 A;  5B2I C;  5B0Y B;  3MGQ A;  4KHA A;  3WKJ B;  5B31 D;  3NQU B;  4HGA C;  3X1V D;  3AZG B;  2FJ7 A;  2NQB C;  2JSS A;  5B31 B;  3X1V B;  5KDM A;  1N1J A;  5AVB A;  3AZE A;  3REL C;  1P3P D;  3B6F C;  3B0B A;  2HIO D;  3X1U A;  3REI A;  1P3P B;  3KXB C;  3UT9 B;  2HIO B;  4WU8 A;  4H9P B;  1U35 A;  3MNN D;  5CPJ A;  1P3M A;  2BYK A;  5AV8 B;  5B32 G;  4X23 C;  3A6N A;  5GT3 B;  4Z2M G;  4R8P B;  4H9R A;  3C1C C;  1P3F A;  5JRG A;  3MVD D;  1P3L D;  1P3G D;  4Z66 C;  4WU9 A;  3KUY C;  1P3L B;  4AWL B;  2ARO A;  3AZM D;  5B0Z C;  1B67 A;  3LZ1 A;  3AZF B;  1KX4 A;  3AZI C;  3AZJ D;  4KHA B;  5AV5 A;  5B2I D;  4Z5T C;  2FJ7 B;  5B2I B;  2RVQ C;  4NE5 A;  2NQB D;  5KDM B;  1N1J B;  4KGC A;  3REL D;  3W98 C;  3B6F D;  3X1U B;  3UTB A;  1BH8 A;  3REI B;  2PYO D;  3TU4 C;  3AV2 C;  3REL B;  3KXB D;  1P34 A;  5B40 A;  3X1T A;  3AV1 D;  2PYO B;  2BYM A;  3KXB B;  1U35 B;  4XUJ A;  3AYW C;  3AV1 B;  5B2J A;  5GT0 A;  1P3A A;  5B1L A;  3WTP A;  4DRA A;  4X23 D;  4J8W C;  3R45 A;  1P3F B;  5JRG B;  3C1C D;  3AZK A;  5E5A A;  4WZS B;  4H9N B;  4NE6 A;  4YS3 C;  1P3O A;  1M19 B;  5DNN C;  5B24 C;  3KUY D;  1P3K D;  1ZLA A;  4H9Q B;  5DNM B;  5F99 C;  1P3I A;  3AZN A;  1P3B A;  3AZL A;  1KX4 B;  1P3K B;  5B0Z D;  3W96 A;  3AZI D;  3LZ0 C;  5B1M A;  4H9O A;  4Z5T D;  4QLC C;  1F66 C;  3AZI B;  1HQ3 A;  2RVQ D;  1BH9 A;  4ZUX C;  2HUE B;  5B0Y C;  3MGP C;  4J8U A;  3AZH A;  3W98 D;  3WKJ C;  3AZG C;  5G49 B;  1KX5 C;  3WAA B;  1M1A D;  3TU4 D;  3B6G B;  3X1T B;  1AOI A;  2BYM B;  1M1A B;  3TU4 B;  4CSR B;  5B2J B;  3AYW D;  4J8V A;  5B1L B;  1HTA A;  3UT9 C;  3LJA A;  3AYW B;  4J8W D;  4H9S A;  3C1B A;  5E5A B;  3AFA A;  5FUG A;  3REH C;  5AV8 C;  3MGR A;  1TZY C;  5AV6 B;  5GT3 C;  2F8N D;  3W99 A;  3NQJ A;  4R8P C;  1EQZ A;  3MGS A;  1P3I B;  5GSU C;  2NZD D;  1ID3 A;  5F99 D;  3AZL B;  3LEL A;  4YM6 A;  3O62 A;  2YFV A;  2NZD B;  1M18 A;  4AWL C;  5CPK A;  3LZ0 D;  2F8N K;  4QLC D;  1F66 D;  3AZF C;  3LZ0 B;  4ZUX D;  3MGQ C;  4QLC B;  4J8U B;  5B0Y D;  2CWE A;  3MGP D;  4ZUX B;  2FJ7 C;  3WKJ D;  3AZG D;  1KX5 D;  2L5A A;  5B31 G;  3MGP B;  2YFW A;  3REJ A;  1KX5 B;  5BT1 C;  5AVC A;  3X1U C;  3REI C;  3UT9 D;  5B32 A;  3W97 A;  5BS7 C;  2PYO C;  4CAY B;  1U35 C;  3AFA B;  3MVD A;  4KUD A;  3AV1 C;  2CV5 B;  1S32 D;  1P3M C;  1P3G A;  3KWQ A;  3REH D;  3NQJ B;  5AV8 D;  3W99 B;  1TZY D;  1S32 B;  1EQZ B;  5GT3 D;  1P3F C;  4R8P D;  5JRG C;  3REH B;  3V9R B;  1TZY B;  5GSU D;  3UTA B;  4WU9 C;  1KX3 A;  1M19 C;  5GSU B;  3AZJ A;  5DNM C;  1KX4 C;  1P3K C;  4G92 B;  3AZF D;  3WA9 B;  5AV5 C;  1A7W A;  4JJN B;  4XZQ A;  3MGQ D;  4LD9 A;  3AN2 A;  5CPI B;  2FJ7 D;  3MGQ B;  4KGC C;  4ZBJ B;  2HUE C;  4J8X A;  5BT1 D;  3X1U D;  5AVB B;  3WAA C;  3REI D;  3AZE B;  1P34 C;  5B40 C;  3B6G C;  3X1T C;  5JA4 A;  4WU8 D;  5AV9 A;  4XUJ C;  1M1A C;  3C1C A;  1H3O A;  5BNX A;  1U35 D;  4NFT A;  5B2J C;  4WU8 B;  5GT0 C;  3X1S A;  1P3M D;  5B1L C;  3VH6 T;  3WTP C;  5BNV A;  4Z66 A;  5CPJ B;  1P3M B;  1P3F D;  2BYK B;  5JRG D;  3A6N B;  3AZK C;  5E5A C;  5B33 A;  4H9R B;  1KX3 B;  4UUZ A;  4WU9 D;  5AV6 C;  3B0C T;  1M19 D;  5BO0 A;  1P3I C;  4Z5T A;  4WU9 B;  1WWI A;  5DNM D;  3AZN C;  3AZL C;  1KX4 D;  2ARO B;  2NZD C;  4LD9 B;  5AY8 A;  5AV5 D;  5B1M C;  3LZ1 B;  3W98 A;  4M6B A;  5AV5 B;  3AV2 A;  4KGC D;  4J8X B;  3REK A;  4WNN A;  4J8U C;  3UTB D;  4KGC B;  3WAA D;  1P34 D;  5B40 D;  3UTB B;  3B6G D;  1BH8 B;  3X1T D;  4J8W A;  1H3O B;  1P34 B;  5B40 B;  4XUJ D;  3X1S B;  5CHL B;  5B2J D;  5BNV B;  5GT0 D;  5B1L D;  4XUJ B;  3WTP D;  2F8N A;  5GXQ A;  4YS3 A;  5GT0 B;  4H9S C;  1P3A B;  5DNN A;  3WTP B;  5B24 A;  3C1B C;  3AFA C;  3AZK D;  2CV5 C;  3R45 B;  5E5A D;  1TAF A;  3W99 C;  1P3O D;  3AZK B;  1S32 C;  5AV6 D;  1EQZ C;  1ZLA D;  1P3O B;  1P3I D;  1ID3 C;  2F8N G;  1BFM A;  3AZN D;  5CP6 A;  4YM6 C;  3AZL D;  3UTA C;  1ZLA B;  3O62 C;  1M18 C;  5AY8 B;  3AZN B; 
#chains in the Genus database with same CATH topology
 1P3B B;  5B0Y A;  5B1M D;  3NQU A;  3AZG A;  3W96 B;  5B1M B;  4H9O B;  4WNN B;  5B31 A;  4G92 C;  3X1V A;  3WA9 C;  4JJN C;  1HQ3 B;  5CPI C;  1BH9 B;  4J8U D;  3AZH D;  3WTP E;  1P3P A;  3AZH B;  3REJ C;  2HIO A;  4ZBJ C;  1AOI D;  3EPL A;  4EO5 C;  4H9P A;  1AOI B;  5AVB C;  3AZE C;  4J8V D;  3W97 C;  1Z2C B;  5GT3 A;  4E44 A;  2W8S A;  4R8P A;  3MNN A;  4J8V B;  4KUD C;  3LJA B;  3C1B D;  3AFA D;  4WU8 C;  2CV5 D;  3KWQ C;  1KU5 A;  3MGR D;  3C1B B;  4NE3 A;  3W99 D;  5FUG B;  5CPJ C;  1EQZ D;  3MGS D;  1P3L A;  3MGR B;  3A6N C;  2Y2N A;  5CP6 B;  1ID3 D;  3MGS B;  3LEL D;  1KX3 C;  4YM6 D;  3UTA D;  3O62 D;  4WV4 B;  1M18 D;  1ID3 B;  3LEL B;  4YM6 B;  3AZM A;  5CPK D;  3O62 B;  2YFV B;  4DQY B;  1M18 B;  5C3I C;  5CPK B;  5B2I A;  2ARO C;  4XZQ C;  3WA9 D;  3AN2 C;  2G5H C;  4LD9 C;  4JJN D;  3LZ1 C;  2NQB A;  5CPI D;  3F6T A;  3REL A;  3B6F A;  4J8X C;  2Y2P A;  3REJ D;  5BS7 A;  2PYO A;  2IO5 B;  5AVC D;  3KXB A;  2YFW B;  3REJ B;  3AV1 A;  5AVB D;  3AZE D;  5AVC B;  4EO5 B;  3UTB C;  5B32 D;  3MNN B;  3W97 D;  5AV9 C;  4Z2M H;  1JFI A;  5B32 B;  4KUD D;  3X1S C;  3W97 B;  4X23 A;  2LY8 A;  1WWS A;  3KWQ D;  3MVD B;  4KUD B;  3B0D B;  4H9N A;  1M19 A;  5CPJ D;  1P3A C;  1P3G B;  3KWQ B;  3A6N D;  4H9Q A;  5DNM A;  5B33 C;  1KX3 D;  3KUY A;  2ZY2 A;  1P3K A;  3AZM B;  5B0Z A;  1P3O C;  3AZJ B;  1Q9C A;  2ZY4 A;  3AZI A;  1ZLA C;  4HGA B;  2ARO D;  5AY8 C;  4XZQ D;  1P3B C;  3AN2 D;  4LD9 D;  2ZY3 A;  2NQB B;  5C3I B;  3LZ1 D;  5G49 A;  3W96 C;  4XZQ B;  3WAA A;  3AN2 B;  3B6F B;  1T3U A;  3REK C;  3B6G A;  4G91 C;  4J8X D;  3VH6 A;  3VH5 T;  1M1A A;  1HQ3 C;  3TU4 A;  4CSR A;  3AZH C;  3H0R C;  1JFI B;  5AV9 D;  2G5I C;  3AYW A;  3IP4 C;  4X23 B;  5JA4 B;  3X1S D;  1AOI C;  5AV9 B;  3C1C B;  4Z66 D;  5GXQ C;  5BNX B;  5AV6 A;  4J8V C;  1P3A D;  4Z66 B;  3LJA C;  5B33 D;  1R4V A;  3KUY B;  3AL0 C;  3VH5 A;  2NZD A;  5B33 B;  5F99 A;  4UUZ B;  3MGR C;  5B0Z B;  5CP6 C;  3MGS C;  2JE5 A;  5BO0 B;  4Z5T B;  2XD1 A;  3LZ0 A;  5AY8 D;  4QLC A;  3LEL C;  1F66 A;  1P3B D;  4ZUX A;  3KSY A;  3AV2 D;  5B31 C;  5CPK C;  3W98 B;  3X1V C;  3W96 D;  3REK D;  3MGP A;  3WKJ A;  1KX5 A;  3AV2 B;  1W2E A;  1HQ3 D;  4G91 B;  3REK B;  3VH6 W;  1P3P C;  2HIO C;  2IO5 C;  4CAY A;  3UT9 A;  1F1E A;  4J8W B;  2CV5 A;  4DRB A;  5AVC C;  3B0C W;  3MNN C;  5GXQ D;  4YS3 D;  2F8N H;  1S32 A;  1ULY A;  5DNN D;  5B24 D;  2F8N B;  5B32 C;  3LJA D;  5GXQ B;  3V9R A;  5AV8 A;  1TZY A;  3REH A;  4YS3 B;  5DNN B;  2BG1 A;  5B24 B;  3UTA A;  3MVD C;  3B0D C;  5F99 B;  5GSU A;  1P3L C;  2VQR A;  1P3G C;  1TAF B;  1B6W A;  3VH5 W;  5CP6 D;  3WA9 A;  1F66 B;  4JJN A;  3AZM C;  5CPI A;  3EPK A;  3AZF A;  3AZJ C;  4E45 A;  5B2I C;  5B0Y B;  3MGQ A;  4KHA A;  3WKJ B;  5B31 D;  3NQU B;  4HGA C;  3X1V D;  3AZG B;  2FJ7 A;  2NQB C;  2JSS A;  5B31 B;  3X1V B;  5KDM A;  1N1J A;  5AVB A;  3AZE A;  3REL C;  1P3P D;  3B6F C;  3B0B A;  2HIO D;  3X1U A;  3KFU G;  3REI A;  1P3P B;  3KXB C;  3UT9 B;  2HIO B;  4WU8 A;  4H9P B;  1U35 A;  3MNN D;  5CPJ A;  1P3M A;  2BYK A;  5AV8 B;  5B32 G;  4X23 C;  3A6N A;  5GT3 B;  4Z2M G;  2UWX A;  4R8P B;  4H9R A;  3C1C C;  1P3F A;  5JRG A;  3MVD D;  3H0M C;  1P3L D;  1P3G D;  4Z66 C;  4WU9 A;  3KUY C;  1P3L B;  4AWL B;  2ZY5 A;  2ARO A;  3AZM D;  1B67 A;  5B0Z C;  3LZ1 A;  3AZF B;  1KX4 A;  3AZI C;  3AZJ D;  4KHA B;  5AV5 A;  5B2I D;  4Z5T C;  2DF4 C;  2FJ7 B;  2ZM5 A;  2J8P A;  5B2I B;  2RVQ C;  4NE5 A;  2NQB D;  5KDM B;  1N1J B;  4KGC A;  3REL D;  3W98 C;  3B6F D;  3X1U B;  3UTB A;  1BH8 A;  3REI B;  2Y2I A;  2PYO D;  3TU4 C;  3AV2 C;  3REL B;  3KXB D;  1P34 A;  5B40 A;  3X1T A;  3AV1 D;  2PYO B;  2BYM A;  3KXB B;  1U35 B;  4XUJ A;  3AYW C;  3AV1 B;  5B2J A;  3A1I A;  5GT0 A;  1P3A A;  5B1L A;  3WTP A;  4DRA A;  4X23 D;  4J8W C;  3R45 A;  1P3F B;  5JRG B;  3C1C D;  3AZK A;  5E5A A;  4WZS B;  4H9N B;  4NE6 A;  4YS3 C;  1P3O A;  1M19 B;  5DNN C;  5B24 C;  3KUY D;  1P3K D;  1ZLA A;  4H9Q B;  5DNM B;  5F99 C;  1P3I A;  3AZN A;  1P3B A;  3AZL A;  1KX4 B;  1P3K B;  5B0Z D;  2Y2G A;  3W96 A;  3AZI D;  3LZ0 C;  5B1M A;  4H9O A;  4Z5T D;  4QLC C;  1F66 C;  3AZI B;  1HQ3 A;  2RVQ D;  1BH9 A;  4ZUX C;  2HUE B;  5B0Y C;  3MGP C;  4J8U A;  3AZH A;  3W98 D;  3WKJ C;  3AZG C;  5G49 B;  1KX5 C;  2JCH A;  3WAA B;  1M1A D;  3TU4 D;  3B6G B;  3X1T B;  1AOI A;  2BYM B;  1M1A B;  3TU4 B;  4CSR B;  5B2J B;  2DQN C;  3AYW D;  4J8V A;  5B1L B;  1HTA A;  3UT9 C;  3LJA A;  1PZR A;  3AYW B;  4J8W D;  4H9S A;  3C1B A;  5E5A B;  3AFA A;  5FUG A;  2F2A C;  3REH C;  5AV8 C;  3MGR A;  1TZY C;  2FFF B;  5GT3 C;  5AV6 B;  2F8N D;  3NQJ A;  4R8P C;  3W99 A;  1EQZ A;  3MGS A;  4UPK A;  1P3I B;  5GSU C;  2NZD D;  3EPJ A;  5F99 D;  3AZL B;  1ID3 A;  3LEL A;  4YM6 A;  3P5J B;  3O62 A;  2YFV A;  2NZD B;  1M18 A;  3H0L C;  4AWL C;  5CPK A;  3LZ0 D;  2F8N K;  4QLC D;  1F66 D;  2Y2K A;  3AZF C;  3LZ0 B;  4ZUX D;  3MGQ C;  4QLC B;  4J8U B;  5B0Y D;  2CWE A;  3MGP D;  4ZUX B;  2FJ7 C;  2Y2O A;  3WKJ D;  3AZG D;  1KX5 D;  2L5A A;  5B31 G;  3FDD A;  3MGP B;  2YFW A;  3REJ A;  1KX5 B;  5BT1 C;  5AVC A;  3X1U C;  3REI C;  3UT9 D;  5B32 A;  3W97 A;  5BS7 C;  2PYO C;  4CAY B;  1U35 C;  3AFA B;  3MVD A;  2Y2J A;  4KUD A;  3AV1 C;  2CV5 B;  1S32 D;  1P3M C;  1P3G A;  3KWQ A;  3REH D;  3NQJ B;  5AV8 D;  3W99 B;  1TZY D;  2Y2M A;  1S32 B;  5GT3 D;  1P3F C;  1EQZ B;  4R8P D;  5JRG C;  3REH B;  3V9R B;  4WJ3 C;  1TZY B;  5GSU D;  3UTA B;  4WU9 C;  1KX3 A;  1M19 C;  5GSU B;  3AZJ A;  3EPH A;  5DNM C;  1KX4 C;  2Y2Q A;  1P3K C;  4G92 B;  3AZF D;  3WA9 B;  5AV5 C;  1A7W A;  4JJN B;  4XZQ A;  3MGQ D;  4LD9 A;  3AN2 A;  5CPI B;  2FJ7 D;  3MGQ B;  4KGC C;  4ZBJ B;  2HUE C;  4J8X A;  5BT1 D;  3X1U D;  5AVB B;  3WAA C;  3REI D;  3A1K A;  3AZE B;  5B40 C;  1P34 C;  3B6G C;  3X1T C;  5JA4 A;  4WU8 D;  5AV9 A;  4XUJ C;  1M1A C;  3C1C A;  1H3O A;  5BNX A;  1U35 D;  4NFT A;  5B2J C;  4WU8 B;  5GT0 C;  3X1S A;  1P3M D;  5B1L C;  3VH6 T;  3WTP C;  5BNV A;  4Z66 A;  5CPJ B;  1P3M B;  1P3F D;  2BYK B;  5JRG D;  3A6N B;  3AZK C;  5E5A C;  5B33 A;  4H9R B;  1KX3 B;  4UUZ A;  4WU9 D;  5AV6 C;  3B0C T;  1M19 D;  5BO0 A;  1P3I C;  4Z5T A;  4WU9 B;  1WWI A;  5DNM D;  3AZN C;  3AZL C;  1KX4 D;  2ARO B;  2NZD C;  4LD9 B;  5AY8 A;  5AV5 D;  5B1M C;  3LZ1 B;  3W98 A;  4M6B A;  5AV5 B;  3AV2 A;  4KGC D;  4J8X B;  3REK A;  4WNN A;  4J8U C;  3UTB D;  4KGC B;  2Y2H A;  2XD5 A;  1P34 D;  3WAA D;  5B40 D;  3UTB B;  3B6G D;  1BH8 B;  3X1T D;  4J8W A;  1H3O B;  1P34 B;  5B40 B;  4XUJ D;  3X1S B;  5CHL B;  5B2J D;  5BNV B;  5GT0 D;  5B1L D;  4XUJ B;  3WTP D;  2F8N A;  5GXQ A;  4YS3 A;  3EG5 B;  5GT0 B;  4H9S C;  1P3A B;  5DNN A;  3WTP B;  5B24 A;  3C1B C;  3AFA C;  2Y2L A;  3AZK D;  2CV5 C;  3R45 B;  5E5A D;  1TAF A;  3W99 C;  1P3O D;  3AZK B;  1S32 C;  5AV6 D;  1EQZ C;  1ZLA D;  1P3O B;  1P3I D;  1ID3 C;  2F8N G;  1BFM A;  3AZN D;  5CP6 A;  4YM6 C;  3AZL D;  3UTA C;  1ZLA B;  3O62 C;  1M18 C;  5AY8 B;  3AZN B;  2RIQ A; 
#chains in the Genus database with same CATH homology
 1P3B B;  5B0Y A;  5B1M D;  3NQU A;  3AZG A;  3W96 B;  5B1M B;  4H9O B;  4WNN B;  5B31 A;  4G92 C;  3X1V A;  3WA9 C;  4JJN C;  1HQ3 B;  5CPI C;  1BH9 B;  4J8U D;  3AZH D;  3WTP E;  1P3P A;  3AZH B;  3REJ C;  2HIO A;  4ZBJ C;  1AOI D;  3EPL A;  4EO5 C;  4H9P A;  1AOI B;  5AVB C;  3AZE C;  4J8V D;  3W97 C;  1Z2C B;  5GT3 A;  4E44 A;  2W8S A;  4R8P A;  3MNN A;  4J8V B;  4KUD C;  3LJA B;  3C1B D;  3AFA D;  4WU8 C;  2CV5 D;  3KWQ C;  1KU5 A;  3MGR D;  3C1B B;  4NE3 A;  3W99 D;  5FUG B;  5CPJ C;  1EQZ D;  3MGS D;  1P3L A;  3MGR B;  3A6N C;  2Y2N A;  5CP6 B;  1ID3 D;  3MGS B;  3LEL D;  1KX3 C;  4YM6 D;  3UTA D;  3O62 D;  4WV4 B;  1M18 D;  1ID3 B;  3LEL B;  4YM6 B;  3AZM A;  5CPK D;  3O62 B;  2YFV B;  4DQY B;  1M18 B;  5C3I C;  5CPK B;  5B2I A;  2ARO C;  4XZQ C;  3WA9 D;  3AN2 C;  2G5H C;  4LD9 C;  4JJN D;  3LZ1 C;  2NQB A;  5CPI D;  3F6T A;  3REL A;  3B6F A;  4J8X C;  2Y2P A;  3REJ D;  5BS7 A;  2PYO A;  2IO5 B;  5AVC D;  3KXB A;  2YFW B;  3REJ B;  3AV1 A;  5AVB D;  3AZE D;  5AVC B;  4EO5 B;  3UTB C;  5B32 D;  3MNN B;  3W97 D;  5AV9 C;  4Z2M H;  1JFI A;  5B32 B;  4KUD D;  3X1S C;  3W97 B;  4X23 A;  2LY8 A;  1WWS A;  3KWQ D;  3MVD B;  4KUD B;  3B0D B;  4H9N A;  1M19 A;  5CPJ D;  1P3A C;  1P3G B;  3KWQ B;  3A6N D;  4H9Q A;  5DNM A;  5B33 C;  1KX3 D;  3KUY A;  2ZY2 A;  1P3K A;  3AZM B;  5B0Z A;  1P3O C;  3AZJ B;  1Q9C A;  2ZY4 A;  3AZI A;  1ZLA C;  4HGA B;  2ARO D;  5AY8 C;  4XZQ D;  1P3B C;  3AN2 D;  4LD9 D;  2ZY3 A;  2NQB B;  5C3I B;  3LZ1 D;  5G49 A;  3W96 C;  4XZQ B;  3WAA A;  3AN2 B;  3B6F B;  1T3U A;  3REK C;  3B6G A;  4G91 C;  4J8X D;  3VH6 A;  3VH5 T;  1M1A A;  1HQ3 C;  3TU4 A;  4CSR A;  3AZH C;  3H0R C;  1JFI B;  5AV9 D;  2G5I C;  3AYW A;  3IP4 C;  4X23 B;  5JA4 B;  3X1S D;  1AOI C;  5AV9 B;  3C1C B;  4Z66 D;  5GXQ C;  5BNX B;  5AV6 A;  4J8V C;  1P3A D;  4Z66 B;  3LJA C;  5B33 D;  1R4V A;  3KUY B;  3AL0 C;  3VH5 A;  2NZD A;  5B33 B;  5F99 A;  4UUZ B;  3MGR C;  5B0Z B;  5CP6 C;  3MGS C;  2JE5 A;  5BO0 B;  4Z5T B;  2XD1 A;  3LZ0 A;  5AY8 D;  4QLC A;  3LEL C;  1F66 A;  1P3B D;  4ZUX A;  3KSY A;  3AV2 D;  5B31 C;  5CPK C;  3W98 B;  3X1V C;  3W96 D;  3REK D;  3MGP A;  3WKJ A;  1KX5 A;  3AV2 B;  1W2E A;  1HQ3 D;  4G91 B;  3REK B;  3VH6 W;  1P3P C;  2HIO C;  2IO5 C;  4CAY A;  3UT9 A;  1F1E A;  4J8W B;  2CV5 A;  4DRB A;  5AVC C;  3B0C W;  3MNN C;  5GXQ D;  4YS3 D;  2F8N H;  1S32 A;  1ULY A;  5DNN D;  5B24 D;  2F8N B;  5B32 C;  3LJA D;  5GXQ B;  3V9R A;  5AV8 A;  1TZY A;  3REH A;  4YS3 B;  5DNN B;  2BG1 A;  5B24 B;  3UTA A;  3MVD C;  3B0D C;  5F99 B;  5GSU A;  1P3L C;  2VQR A;  1P3G C;  1TAF B;  1B6W A;  3VH5 W;  5CP6 D;  3WA9 A;  1F66 B;  4JJN A;  3AZM C;  5CPI A;  3EPK A;  3AZF A;  3AZJ C;  4E45 A;  5B2I C;  5B0Y B;  3MGQ A;  4KHA A;  3WKJ B;  5B31 D;  3NQU B;  4HGA C;  3X1V D;  3AZG B;  2FJ7 A;  2NQB C;  2JSS A;  5B31 B;  3X1V B;  5KDM A;  1N1J A;  5AVB A;  3AZE A;  3REL C;  1P3P D;  3B6F C;  3B0B A;  2HIO D;  3X1U A;  3KFU G;  3REI A;  1P3P B;  3KXB C;  3UT9 B;  2HIO B;  4WU8 A;  4H9P B;  1U35 A;  3MNN D;  5CPJ A;  1P3M A;  2BYK A;  5AV8 B;  5B32 G;  4X23 C;  3A6N A;  5GT3 B;  4Z2M G;  2UWX A;  4R8P B;  4H9R A;  3C1C C;  1P3F A;  5JRG A;  3MVD D;  3H0M C;  1P3L D;  1P3G D;  4Z66 C;  4WU9 A;  3KUY C;  1P3L B;  4AWL B;  2ZY5 A;  2ARO A;  3AZM D;  1B67 A;  5B0Z C;  3LZ1 A;  3AZF B;  1KX4 A;  3AZI C;  3AZJ D;  4KHA B;  5AV5 A;  5B2I D;  4Z5T C;  2DF4 C;  2FJ7 B;  2ZM5 A;  2J8P A;  5B2I B;  2RVQ C;  4NE5 A;  2NQB D;  5KDM B;  1N1J B;  4KGC A;  3REL D;  3W98 C;  3B6F D;  3X1U B;  3UTB A;  1BH8 A;  3REI B;  2Y2I A;  2PYO D;  3TU4 C;  3AV2 C;  3REL B;  3KXB D;  1P34 A;  5B40 A;  3X1T A;  3AV1 D;  2PYO B;  2BYM A;  3KXB B;  1U35 B;  4XUJ A;  3AYW C;  3AV1 B;  5B2J A;  3A1I A;  5GT0 A;  1P3A A;  5B1L A;  3WTP A;  4DRA A;  4X23 D;  4J8W C;  3R45 A;  1P3F B;  5JRG B;  3C1C D;  3AZK A;  5E5A A;  4WZS B;  4H9N B;  4NE6 A;  4YS3 C;  1P3O A;  1M19 B;  5DNN C;  5B24 C;  3KUY D;  1P3K D;  1ZLA A;  4H9Q B;  5DNM B;  5F99 C;  1P3I A;  3AZN A;  1P3B A;  3AZL A;  1KX4 B;  1P3K B;  5B0Z D;  2Y2G A;  3W96 A;  3AZI D;  3LZ0 C;  5B1M A;  4H9O A;  4Z5T D;  4QLC C;  1F66 C;  3AZI B;  1HQ3 A;  2RVQ D;  1BH9 A;  4ZUX C;  2HUE B;  5B0Y C;  3MGP C;  4J8U A;  3AZH A;  3W98 D;  3WKJ C;  3AZG C;  5G49 B;  1KX5 C;  2JCH A;  3WAA B;  1M1A D;  3TU4 D;  3B6G B;  3X1T B;  1AOI A;  2BYM B;  1M1A B;  3TU4 B;  4CSR B;  5B2J B;  2DQN C;  3AYW D;  4J8V A;  5B1L B;  1HTA A;  3UT9 C;  3LJA A;  1PZR A;  3AYW B;  4J8W D;  4H9S A;  3C1B A;  5E5A B;  3AFA A;  5FUG A;  2F2A C;  3REH C;  5AV8 C;  3MGR A;  1TZY C;  2FFF B;  5GT3 C;  5AV6 B;  2F8N D;  3NQJ A;  4R8P C;  3W99 A;  1EQZ A;  3MGS A;  4UPK A;  1P3I B;  5GSU C;  2NZD D;  3EPJ A;  5F99 D;  3AZL B;  1ID3 A;  3LEL A;  4YM6 A;  3P5J B;  3O62 A;  2YFV A;  2NZD B;  1M18 A;  3H0L C;  4AWL C;  5CPK A;  3LZ0 D;  2F8N K;  4QLC D;  1F66 D;  2Y2K A;  3AZF C;  3LZ0 B;  4ZUX D;  3MGQ C;  4QLC B;  4J8U B;  5B0Y D;  2CWE A;  3MGP D;  4ZUX B;  2FJ7 C;  2Y2O A;  3WKJ D;  3AZG D;  1KX5 D;  2L5A A;  5B31 G;  3FDD A;  3MGP B;  2YFW A;  3REJ A;  1KX5 B;  5BT1 C;  5AVC A;  3X1U C;  3REI C;  3UT9 D;  5B32 A;  3W97 A;  5BS7 C;  2PYO C;  4CAY B;  1U35 C;  3AFA B;  3MVD A;  2Y2J A;  4KUD A;  3AV1 C;  2CV5 B;  1S32 D;  1P3M C;  1P3G A;  3KWQ A;  3REH D;  3NQJ B;  5AV8 D;  3W99 B;  1TZY D;  2Y2M A;  1S32 B;  5GT3 D;  1P3F C;  1EQZ B;  4R8P D;  5JRG C;  3REH B;  3V9R B;  4WJ3 C;  1TZY B;  5GSU D;  3UTA B;  4WU9 C;  1KX3 A;  1M19 C;  5GSU B;  3AZJ A;  3EPH A;  5DNM C;  1KX4 C;  2Y2Q A;  1P3K C;  4G92 B;  3AZF D;  3WA9 B;  5AV5 C;  1A7W A;  4JJN B;  4XZQ A;  3MGQ D;  4LD9 A;  3AN2 A;  5CPI B;  2FJ7 D;  3MGQ B;  4KGC C;  4ZBJ B;  2HUE C;  4J8X A;  5BT1 D;  3X1U D;  5AVB B;  3WAA C;  3REI D;  3A1K A;  3AZE B;  5B40 C;  1P34 C;  3B6G C;  3X1T C;  5JA4 A;  4WU8 D;  5AV9 A;  4XUJ C;  1M1A C;  3C1C A;  1H3O A;  5BNX A;  1U35 D;  4NFT A;  5B2J C;  4WU8 B;  5GT0 C;  3X1S A;  1P3M D;  5B1L C;  3VH6 T;  3WTP C;  5BNV A;  4Z66 A;  5CPJ B;  1P3M B;  1P3F D;  2BYK B;  5JRG D;  3A6N B;  3AZK C;  5E5A C;  5B33 A;  4H9R B;  1KX3 B;  4UUZ A;  4WU9 D;  5AV6 C;  3B0C T;  1M19 D;  5BO0 A;  1P3I C;  4Z5T A;  4WU9 B;  1WWI A;  5DNM D;  3AZN C;  3AZL C;  1KX4 D;  2ARO B;  2NZD C;  4LD9 B;  5AY8 A;  5AV5 D;  5B1M C;  3LZ1 B;  3W98 A;  4M6B A;  5AV5 B;  3AV2 A;  4KGC D;  4J8X B;  3REK A;  4WNN A;  4J8U C;  3UTB D;  4KGC B;  2Y2H A;  2XD5 A;  1P34 D;  3WAA D;  5B40 D;  3UTB B;  3B6G D;  1BH8 B;  3X1T D;  4J8W A;  1H3O B;  1P34 B;  5B40 B;  4XUJ D;  3X1S B;  5CHL B;  5B2J D;  5BNV B;  5GT0 D;  5B1L D;  4XUJ B;  3WTP D;  2F8N A;  5GXQ A;  4YS3 A;  3EG5 B;  5GT0 B;  4H9S C;  1P3A B;  5DNN A;  3WTP B;  5B24 A;  3C1B C;  3AFA C;  2Y2L A;  3AZK D;  2CV5 C;  3R45 B;  5E5A D;  1TAF A;  3W99 C;  1P3O D;  3AZK B;  1S32 C;  5AV6 D;  1EQZ C;  1ZLA D;  1P3O B;  1P3I D;  1ID3 C;  2F8N G;  1BFM A;  3AZN D;  5CP6 A;  4YM6 C;  3AZL D;  3UTA C;  1ZLA B;  3O62 C;  1M18 C;  5AY8 B;  3AZN B;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...