5KDMB

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmB00
3KWQD 3MNND 3B6GB 1U35B 5B32B 5FUGB 5CHLB 3AZLD 1KX5B 2NZDD 5JRGA 3W98B 3AZND 4KGCA 3AYWA 1P3KD 3W97A 1BH9A 3MGQD 3W99D 4XUJA 5BT1C 1HQ3D 4X23B 4J8XC 3AZMC 3MGRD 5AV6A 4CAYB 3WAAA 5B2JD 3AZEC 1AOIA 3AFAD 4R8PC 1ZLAC 5BNVA 3VH5A 3W96C 4H9OA 4ZUXB 3UT9A 1N1JA 3AZJA 3AZFA 3O62D 5AVBD 3REHC 3LZ1D 4J8UD 5B31A 1P3PD 3X1SA 2NQBD 3AZKD 3REIC 1ID3C 4G92B 4J8XB 4KUDA 3AZMB 1P3AC 3MGPA 3LELA 5CP6D 4R8PB 1ZLAB 1H3OB 1M19D 3MVDA 4H9PA 5C3IC 3W96B 4WU8C 1P3BC 5GXQB 3C1BC 4WNNA 4ZBJC 3REHB 1KX3C 5JRGD 5B31G 4KGCD 1P3FA 3AYWD 2FJ7A 1P3OA 3C1CC 3W97D 3REIB 1ID3B 1TZYA 4XUJD 4YM6C 1P3AB 4NE6A 5AV9C 4LD9C 4NE3A 5C3IB 5AV6D 4WU8B 3WAAD 4M6BA 1M1AC 1P3BB 3C1BB 5AVCA 2RVQC 4ZBJB 5F99A 1KX3B 4UUZA 3KWQC 3UT9D 3AZJD 3AZFD 4YS3A 5CPIA 5GT0D 3C1CB 3AZLC 2NZDC 5B31D 3B6FC 3AZNC 4YM6B 4QLCA 3X1SD 3VH5T 5DNNA 1P3KC 5AV9B 4LD9B 4KUDD 1A7WA 4E45A 3W99C 3MGPD 3LELD 1M1AB 1HQ3C 1KX4A 3MGRC 3KWQB 5B2JC 1EQZA 3LZ0A 3AFAC 3X1TA 5BNXB 1P3ID 5B1MA 4J8WA 2BYKA 3B0CT 3AZLB 5KDMA 1P3FD 2NZDB 3B6FB 3AZNB 2HIOA 3KUYA 2FJ7D 1P3LA 1P3OD 3O62C 3V9RA 5AVBC 5DNMA 5AV8A 1P3KB 4KHAA 1Q9CA 1TZYD 4WV4B 3LZ1C 4J8UC 3AN2C 1P3PC 3W99B 1BH8B 5GSUA 1HQ3B 4H9NA 2NQBC 4EO5C 1R4VA 3MGRB 2YFVA 5B2JB 3WTPA 2CV5C 1TAFA 5CP6C 3AFAB 1M19C 4Z5TA 5AVCD 5F99D 3AV2D 5JA4B 1U35A 5B32A 2HUEC 4YS3D 3O62B 5FUGA 5AVBB 5BO0A 4ZUXC 5B2IC 5JRGC 3LZ1B 4J8UB 4QLCD 3AN2B 1P3PB 4H9QA 5DNND 2F8NA 1P3MA 2NQBB 3X1VC 4EO5B 4H9SC 2F8NH 4XUJC 2CV5B 4X23A 5CP6B 4H9RB 3RELD 1M19B 4G92C 1KX4D 5AV6C 4CAYA 3WAAC 4JJNA 1EQZD 5B32G 3X1TD 2PYOA 2HUEB 5B40A 5B1MD 4J8WD 3AZIA 5B2IB 5JRGB 5GXQC 3UTAA 3UT9C 2HIOD 3KUYD 3AZFC 2F8NG 1P3LD 1F66A 5E5AA 5DNMD 5GT0C 5AV8D 3X1VB 1BH9B 3NQUA 5B31C 1JFIA 4XUJB 5B24A 5CPKA 5GSUD 3AZGA 5B0ZA 4NE5A 3LJAA 4J8VC 4KUDC 5AV6B 3WA9A 4Z66A 3WTPD 3AZEA 3WAAB 3MGPC 3LELC 4R8PA 3VH6A 5BNVB 4NFTA 4Z5TD 2JSSA 5B33A 4H9OB 5AY8C 3AZHA 1U35D 5B32D 3UT9B 1N1JB 3AZFB 5GT0B 1P3IC 4Z2MG 3B0BA 3TU4A 2AROA 1P3FC 5B31B 5B1LA 3R45A 2F8ND 2FJ7C 1P3MD 3KXBA 3KSYA 4J8VB 4KUDB 2BYMA 5AV5A 3B0DC 3MGPB 3LELB 2IO5C 4H9PB 4JJND 5AY8B 3AV1A 3UTBA 1AOID 1P3BA 4XZQA 3C1BA 3WKJA 2PYOD 5B40D 3AZID 4WNNB 5F99C 1P3IB 3AV2C 1P3GA 2YFWA 3MNNC 3UTAD 1P3FB 3NQJB 4YS3C 5E5AD 1F66D 2FJ7B 1P3OB 1ULYA 1F1EA 3MGSA 5CPJA 5B24D 5CPKD 3B0DB 4QLCC 3AZGD 5DNNC 5B0ZD 3LJAD 4G91C 1M18A 2IO5B 3MGQC 3WA9D 4Z66D 1S32A 3AZED 1M1AA 5G49B 5B0YA 3RELC 3MVDD 1KX4C 5B33D 5AVCB 5F99B 3AV2B 3AZHD 3MNNB 3VH5W 4YS3B 5BNXA 3REJA 5B1MC 4J8WC 2AROD 3REKA 3TU4D 4WU9A 3B6FA 5B1LD 3VH6T 4QLCB 3KUYC 2LY8A 5DNNB 3KXBD 4G91B 5DNMC 5GT3A 5AV5D 1B67A 3MGQB 3A6NA 5GSUC 3AZKC 3RELB 3X1UA 1KX4B 3B0CW 3UTBD 3AV1D 3WTPC 1P3BD 4XZQD 3WKJD 1P34A 3VH6W 4Z5TC 4CSRB 5B1MB 4DRBA 4J8WB 1P3GD 5KDMB 3B6GA 1WWSA 3KUYB 5CPID 3V9RB 3MGSD 5DNMB 4KHAB 1KX5A 2L5AA 5CPJD 3W98A 4KGCC 3AN2A 3AYWC 5GSUB 4H9NB 1P3MC 2NQBA 3AZKB 1M18D 3W97C 1S32D 1M1AD 3WTPB 2CV5A 1TAFB 1BFMA 4H9RA 5B0YD 4Z5TB 2RVQD 5BS7A 4DRAA 4JJNC 3LZ0D 1AOIC 2PYOC 3REJD 5B40C 4WU9D 3REKD 3AZIC 5BO0B 4ZUXA 5B2IA 3B6FD 3UTAC 4KGCB 3AZJC 3AYWB 4H9QB 2F8NB 1F66C 5E5AC 1P3MB 5GT3D 3X1VA 4H9SA 3W97B 5CPKC 5B24C 3A6ND 4Z2MH 3X1SC 3AZGC 5B0ZC 1HTAA 3LJAC 3X1UD 4J8XA 3AZMA 4JJNB 4Z66C 3WA9C 1P34D 1AOIB 2PYOB 1ZLAA 1H3OA 5B40B 3MVDC 3W96A 5B33C 3AZIB 3AZHC 3B6GD 5GXQA 3UTAB 3AZJB 1F66B 5E5AB 5GT0A 3REHA 3TU4C 1KX5D 2AROC 3W98D 3NQUB 3AN2D 1KU5A 5CPKB 5B24B 5B1LC 1JFIB 3X1SB 3AZGB 3KXBC 5B0ZB 3LJAB 4J8VA 3REIA 1P3OC 1ID3A 1TZYC 5AV5C 3WA9B 4Z66B 3AZEB 2CV5D 1P3AA 2F8NK 4X23D 1WWIA 3MVDB 5B33B 5AY8A 4WU8A 3AV1C 3UTBC 3AZHB 4XZQC 3WKJC 5AVCC 4ZUXD 1P3IA 5B2ID 1KX3A 3TU4B 1P3GC 2AROB 3NQJA 5B1LB 3R45B 5CPIC 3X1VD 3KXBB 3MGSC 3C1CA 4WZSB 1TZYB 2BYMB 5AV5B 5CPJC 5BT1D 4YM6A 5AV9A 4J8XD 4LD9A 3AZMD 1M18C 1S32C 3AV1B 3UTBB 4R8PD 4XZQB 3WKJB 1ZLAD 5G49A 5B0YC 3W96D 3AV2A 3KWQA 4UUZB 1P3GB 2YFWB 4HGAC 5GXQD 3MNNA 1EQZC 3LZ0C 3X1TC 5CPIB 3REHD 3REJC 3MGSB 3AZLA 3REKC 4WU9C 2NZDA 5CPJB 3AZNA 2HIOC 1P3LC 4J8VD 3REID 5AV8C 1P3KA 5GT3C 1ID3D 1M18B 3MGQA 1S32B 3W99A 1P3AD 3A6NC 1BH8A 1HQ3A 5B0YB 3RELA 3X1UC 5AY8D 4AWLC 4WU8D 3MGRA 4HGAB 5B2JA 3C1BD 1EQZB 3LZ0B 1P34C 3AFAA 3X1TB 4CSRA 3REJB 1KX3D 4WU9B 3REKB 2BYKB 5JA4A 3B6GC 1U35C 5B32C 2HIOB 3WTPE 1P3LB 3O62A 5AVBA 3C1CD 5AV8B 5GT3B 1KX5C 3W98C 3LZ1A 4J8UA 4YM6D 1P3PA 3A6NB 5AV9D 3AZKA 4LD9D 3X1UB 1B6WA 2CWEA 4E44A 4AWLB 2YFVB 1P34B 4X23C 5CP6A 1M19A 5BS7C
chains in the Genus database with same CATH superfamily
3KWQD 3MNND 3B6GB 1U35B 5B32B 5FUGB 5CHLB 3AZLD 1KX5B 2NZDD 5JRGA 3W98B 3AZND 4KGCA 3AYWA 1P3KD 3W97A 1BH9A 3MGQD 3W99D 4XUJA 5BT1C 1HQ3D 4X23B 2ZY5A 4J8XC 3AZMC 3A1IA 5AV6A 3MGRD 4CAYB 3WAAA 5B2JD 3AZEC 2Y2QA 1AOIA 3AFAD 4R8PC 2ZY3A 3IP4C 2J8PA 1ZLAC 5BNVA 3VH5A 2ZM5A 3W96C 4H9OA 4ZUXB 2RIQA 2FFFB 3UT9A 1N1JA 3AZJA 3AZFA 3O62D 5AVBD 3REHC 3LZ1D 4J8UD 5B31A 1P3PD 2ZY2A 3X1SA 2NQBD 3AZKD 3REIC 1ID3C 4G92B 4J8XB 4KUDA 3AZMB 1P3AC 3MGPA 3LELA 5CP6D 4R8PB 1ZLAB 1H3OB 1M19D 3MVDA 4H9PA 5C3IC 3W96B 4WU8C 1P3BC 5GXQB 3C1BC 4WNNA 4ZBJC 3REHB 1KX3C 5JRGD 5B31G 4KGCD 1P3FA 3AYWD 2F2AC 2FJ7A 1P3OA 3C1CC 3W97D 3REIB 1ID3B 1TZYA 4XUJD 4YM6C 1P3AB 4NE6A 5AV9C 4LD9C 4NE3A 5C3IB 5AV6D 4WU8B 2BG1A 3WAAD 4M6BA 1T3UA 1PZRA 1M1AC 1P3BB 3C1BB 5AVCA 2RVQC 2VQRA 4ZBJB 5F99A 3EPLA 4UUZA 3KWQC 1KX3B 3UT9D 3AZJD 3AZFD 4YS3A 5CPIA 5GT0D 3C1CB 3AZLC 2NZDC 5B31D 3B6FC 3AZNC 4YM6B 4QLCA 3X1SD 3VH5T 5DNNA 1P3KC 2DF4C 5AV9B 4KUDD 4LD9B 1A7WA 4E45A 3W99C 3MGPD 3LELD 1M1AB 1HQ3C 1KX4A 3MGRC 3KWQB 5B2JC 1EQZA 3LZ0A 3AFAC 3X1TA 5BNXB 1P3ID 5B1MA 4J8WA 2BYKA 3B0CT 3AZLB 5KDMA 1P3FD 2NZDB 3B6FB 3AZNB 3H0RC 2HIOA 3KUYA 2FJ7D 2UWXA 1P3LA 1P3OD 3O62C 3V9RA 5AVBC 5DNMA 5AV8A 1P3KB 4KHAA 1Q9CA 1TZYD 4WV4B 3LZ1C 4J8UC 2Y2MA 3AN2C 1P3PC 3W99B 1BH8B 5GSUA 1HQ3B 4H9NA 2NQBC 4EO5C 1R4VA 3MGRB 3H0MC 2YFVA 5B2JB 3WTPA 2CV5C 1TAFA 5CP6C 3AFAB 1M19C 4Z5TA 5AVCD 5F99D 3AV2D 5JA4B 1U35A 5B32A 2HUEC 4YS3D 3O62B 5FUGA 5AVBB 3FDDA 5BO0A 4ZUXC 5B2IC 5JRGC 3LZ1B 4J8UB 4QLCD 3AN2B 1P3PB 4H9QA 5DNND 2F8NA 1P3MA 2NQBB 3X1VC 4EO5B 4H9SC 2F8NH 4XUJC 2CV5B 4X23A 5CP6B 4H9RB 3RELD 1M19B 4G92C 2ZY4A 1KX4D 5AV6C 4CAYA 3WAAC 4JJNA 1EQZD 5B32G 3X1TD 2PYOA 2HUEB 5B40A 5B1MD 4J8WD 3AZIA 5B2IB 5JRGB 5GXQC 3UTAA 3UT9C 2HIOD 3KUYD 3AZFC 2F8NG 1P3LD 1F66A 5E5AA 5DNMD 5GT0C 5AV8D 3P5JB 3X1VB 1BH9B 3NQUA 5B31C 1JFIA 4XUJB 5B24A 5CPKA 5GSUD 3AZGA 5B0ZA 4NE5A 3LJAA 4J8VC 2DQNC 4KUDC 5AV6B 3WA9A 4Z66A 3WTPD 3AZEA 3WAAB 3MGPC 3LELC 4R8PA 3VH6A 5BNVB 4NFTA 4Z5TD 2JSSA 5B33A 4H9OB 5AY8C 3AZHA 1U35D 5B32D 3UT9B 1N1JB 3AZFB 5GT0B 1P3IC 4Z2MG 3B0BA 3TU4A 2AROA 1P3FC 5B31B 5B1LA 3R45A 2F8ND 2FJ7C 1P3MD 3KXBA 3KSYA 4J8VB 4KUDB 2BYMA 5AV5A 3B0DC 3MGPB 3LELB 2IO5C 4H9PB 4JJND 5AY8B 3AV1A 3UTBA 1AOID 1P3BA 4XZQA 3C1BA 3WKJA 2PYOD 5B40D 3AZID 4WNNB 5F99C 1P3IB 3AV2C 1P3GA 2YFWA 3MNNC 3UTAD 1P3FB 3NQJB 4YS3C 5E5AD 1F66D 2FJ7B 1P3OB 1ULYA 2JE5A 1F1EA 3MGSA 5CPJA 5B24D 5CPKD 3B0DB 4QLCC 3AZGD 5DNNC 5B0ZD 3LJAD 4G91C 2G5IC 1M18A 2IO5B 3MGQC 3WA9D 4Z66D 1S32A 3AZED 1M1AA 5G49B 5B0YA 3RELC 2Y2NA 3MVDD 1KX4C 5B33D 5AVCB 5F99B 3AV2B 3AZHD 3MNNB 3EPHA 3VH5W 4YS3B 5BNXA 3REJA 5B1MC 4J8WC 2AROD 3REKA 3TU4D 4WU9A 3B6FA 5B1LD 3VH6T 4QLCB 3KUYC 2LY8A 5DNNB 3KXBD 4G91B 5DNMC 5GT3A 5AV5D 1B67A 3MGQB 2G5HC 3A6NA 3EPJA 5GSUC 3AZKC 3RELB 3X1UA 1KX4B 3B0CW 3UTBD 3AV1D 3WTPC 1P3BD 4XZQD 3WKJD 1P34A 2Y2LA 3VH6W 4Z5TC 4CSRB 5B1MB 4DRBA 4J8WB 1P3GD 5KDMB 3B6GA 1WWSA 3KUYB 5CPID 3V9RB 3MGSD 5DNMB 4KHAB 1KX5A 2L5AA 5CPJD 3W98A 4KGCC 3AN2A 3F6TA 3AYWC 5GSUB 4H9NB 1P3MC 2NQBA 3AZKB 1M18D 3W97C 1S32D 3EG5B 2W8SA 1M1AD 3WTPB 2CV5A 1TAFB 1BFMA 4H9RA 5B0YD 4Z5TB 2RVQD 1Z2CB 5BS7A 4DRAA 4JJNC 3LZ0D 3H0LC 1AOIC 2PYOC 3REJD 5B40C 4WU9D 3REKD 3AZIC 5BO0B 4ZUXA 5B2IA 3B6FD 3UTAC 4KGCB 3AZJC 3AYWB 4H9QB 2F8NB 1F66C 5E5AC 1P3MB 5GT3D 3X1VA 4H9SA 3W97B 5CPKC 5B24C 2Y2IA 3A6ND 4Z2MH 3X1SC 3AZGC 5B0ZC 1HTAA 3LJAC 3X1UD 4J8XA 3AZMA 4JJNB 4Z66C 3WA9C 1P34D 1AOIB 2PYOB 1ZLAA 1H3OA 5B40B 3MVDC 3W96A 5B33C 3AZIB 3AL0C 3AZHC 3B6GD 5GXQA 3UTAB 3AZJB 1F66B 5E5AB 5GT0A 3REHA 3TU4C 1KX5D 2AROC 3W98D 3NQUB 3AN2D 1KU5A 5CPKB 5B24B 5B1LC 1JFIB 3X1SB 3AZGB 3KXBC 5B0ZB 3LJAB 3EPKA 4J8VA 3REIA 1P3OC 1ID3A 1TZYC 5AV5C 3WA9B 4Z66B 3AZEB 2CV5D 1P3AA 2F8NK 4X23D 1WWIA 3MVDB 5B33B 5AY8A 4WU8A 3AV1C 3UTBC 3AZHB 4XZQC 3WKJC 5AVCC 4ZUXD 1P3IA 1W2EA 5B2ID 3TU4B 1P3GC 2AROB 1KX3A 3NQJA 5B1LB 3R45B 5CPIC 3X1VD 3KXBB 2XD1A 3MGSC 3C1CA 4WZSB 1TZYB 2BYMB 5AV5B 5CPJC 5BT1D 4YM6A 5AV9A 4J8XD 4LD9A 3AZMD 1M18C 1S32C 3AV1B 3UTBB 2Y2OA 4R8PD 4XZQB 3WKJB 1ZLAD 5G49A 3KFUG 5B0YC 3W96D 3AV2A 3KWQA 4UUZB 1P3GB 2YFWB 4HGAC 5GXQD 3MNNA 4DQYB 3LZ0C 1EQZC 3X1TC 5CPIB 3REHD 4UPKA 3REJC 3MGSB 3AZLA 3REKC 4WU9C 2NZDA 5CPJB 3AZNA 2HIOC 1P3LC 3A1KA 4J8VD 5AV8C 3REID 5GT3C 1P3KA 1ID3D 2Y2PA 2Y2GA 1M18B 3MGQA 1S32B 2JCHA 1P3AD 3W99A 3A6NC 1BH8A 1HQ3A 2XD5A 5B0YB 3RELA 3X1UC 5AY8D 4AWLC 4WU8D 3MGRA 4HGAB 5B2JA 3C1BD 1EQZB 3LZ0B 1P34C 3AFAA 2Y2JA 3X1TB 2Y2HA 4CSRA 4WJ3C 3REJB 1KX3D 4WU9B 3REKB 2BYKB 5JA4A 3B6GC 1U35C 5B32C 2HIOB 3WTPE 1P3LB 3O62A 5AVBA 3C1CD 5AV8B 5GT3B 1KX5C 3W98C 3LZ1A 4J8UA 4YM6D 1P3PA 3A6NB 2Y2KA 5AV9D 3AZKA 4LD9D 3X1UB 1B6WA 2CWEA 4E44A 4AWLB 2YFVB 1P34B 4X23C 5CP6A 1M19A 5BS7C
chains in the Genus database with same CATH topology
3KWQD 3MNND 3B6GB 1U35B 5B32B 5FUGB 5CHLB 3AZLD 1KX5B 2NZDD 5JRGA 3W98B 3AZND 4KGCA 3AYWA 1P3KD 3W97A 1BH9A 3MGQD 3W99D 4XUJA 5BT1C 1HQ3D 4X23B 2ZY5A 4J8XC 3AZMC 3A1IA 5AV6A 3MGRD 4CAYB 3WAAA 5B2JD 3AZEC 2Y2QA 1AOIA 3AFAD 4R8PC 2ZY3A 3IP4C 2J8PA 1ZLAC 5BNVA 3VH5A 2ZM5A 3W96C 4H9OA 4ZUXB 2RIQA 2FFFB 3UT9A 1N1JA 3AZJA 3AZFA 3O62D 5AVBD 3REHC 3LZ1D 4J8UD 5B31A 1P3PD 2ZY2A 3X1SA 2NQBD 3AZKD 3REIC 1ID3C 4G92B 4J8XB 4KUDA 3AZMB 1P3AC 3MGPA 3LELA 5CP6D 4R8PB 1ZLAB 1H3OB 1M19D 3MVDA 4H9PA 5C3IC 3W96B 4WU8C 1P3BC 5GXQB 3C1BC 4WNNA 4ZBJC 3REHB 1KX3C 5JRGD 5B31G 4KGCD 1P3FA 3AYWD 2F2AC 2FJ7A 1P3OA 3C1CC 3W97D 3REIB 1ID3B 1TZYA 4XUJD 4YM6C 1P3AB 4NE6A 5AV9C 4LD9C 4NE3A 5C3IB 5AV6D 4WU8B 2BG1A 3WAAD 4M6BA 1T3UA 1PZRA 1M1AC 1P3BB 3C1BB 5AVCA 2RVQC 2VQRA 4ZBJB 5F99A 3EPLA 4UUZA 3KWQC 1KX3B 3UT9D 3AZJD 3AZFD 4YS3A 5CPIA 5GT0D 3C1CB 3AZLC 2NZDC 5B31D 3B6FC 3AZNC 4YM6B 4QLCA 3X1SD 3VH5T 5DNNA 1P3KC 2DF4C 5AV9B 4KUDD 4LD9B 1A7WA 4E45A 3W99C 3MGPD 3LELD 1M1AB 1HQ3C 1KX4A 3MGRC 3KWQB 5B2JC 1EQZA 3LZ0A 3AFAC 3X1TA 5BNXB 1P3ID 5B1MA 4J8WA 2BYKA 3B0CT 3AZLB 5KDMA 1P3FD 2NZDB 3B6FB 3AZNB 3H0RC 2HIOA 3KUYA 2FJ7D 2UWXA 1P3LA 1P3OD 3O62C 3V9RA 5AVBC 5DNMA 5AV8A 1P3KB 4KHAA 1Q9CA 1TZYD 4WV4B 3LZ1C 4J8UC 2Y2MA 3AN2C 1P3PC 3W99B 1BH8B 5GSUA 1HQ3B 4H9NA 2NQBC 4EO5C 1R4VA 3MGRB 3H0MC 2YFVA 5B2JB 3WTPA 2CV5C 1TAFA 5CP6C 3AFAB 1M19C 4Z5TA 5AVCD 5F99D 3AV2D 5JA4B 1U35A 5B32A 2HUEC 4YS3D 3O62B 5FUGA 5AVBB 3FDDA 5BO0A 4ZUXC 5B2IC 5JRGC 3LZ1B 4J8UB 4QLCD 3AN2B 1P3PB 4H9QA 5DNND 2F8NA 1P3MA 2NQBB 3X1VC 4EO5B 4H9SC 2F8NH 4XUJC 2CV5B 4X23A 5CP6B 4H9RB 3RELD 1M19B 4G92C 2ZY4A 1KX4D 5AV6C 4CAYA 3WAAC 4JJNA 1EQZD 5B32G 3X1TD 2PYOA 2HUEB 5B40A 5B1MD 4J8WD 3AZIA 5B2IB 5JRGB 5GXQC 3UTAA 3UT9C 2HIOD 3KUYD 3AZFC 2F8NG 1P3LD 1F66A 5E5AA 5DNMD 5GT0C 5AV8D 3P5JB 3X1VB 1BH9B 3NQUA 5B31C 1JFIA 4XUJB 5B24A 5CPKA 5GSUD 3AZGA 5B0ZA 4NE5A 3LJAA 4J8VC 2DQNC 4KUDC 5AV6B 3WA9A 4Z66A 3WTPD 3AZEA 3WAAB 3MGPC 3LELC 4R8PA 3VH6A 5BNVB 4NFTA 4Z5TD 2JSSA 5B33A 4H9OB 5AY8C 3AZHA 1U35D 5B32D 3UT9B 1N1JB 3AZFB 5GT0B 1P3IC 4Z2MG 3B0BA 3TU4A 2AROA 1P3FC 5B31B 5B1LA 3R45A 2F8ND 2FJ7C 1P3MD 3KXBA 3KSYA 4J8VB 4KUDB 2BYMA 5AV5A 3B0DC 3MGPB 3LELB 2IO5C 4H9PB 4JJND 5AY8B 3AV1A 3UTBA 1AOID 1P3BA 4XZQA 3C1BA 3WKJA 2PYOD 5B40D 3AZID 4WNNB 5F99C 1P3IB 3AV2C 1P3GA 2YFWA 3MNNC 3UTAD 1P3FB 3NQJB 4YS3C 5E5AD 1F66D 2FJ7B 1P3OB 1ULYA 2JE5A 1F1EA 3MGSA 5CPJA 5B24D 5CPKD 3B0DB 4QLCC 3AZGD 5DNNC 5B0ZD 3LJAD 4G91C 2G5IC 1M18A 2IO5B 3MGQC 3WA9D 4Z66D 1S32A 3AZED 1M1AA 5G49B 5B0YA 3RELC 2Y2NA 3MVDD 1KX4C 5B33D 5AVCB 5F99B 3AV2B 3AZHD 3MNNB 3EPHA 3VH5W 4YS3B 5BNXA 3REJA 5B1MC 4J8WC 2AROD 3REKA 3TU4D 4WU9A 3B6FA 5B1LD 3VH6T 4QLCB 3KUYC 2LY8A 5DNNB 3KXBD 4G91B 5DNMC 5GT3A 5AV5D 1B67A 3MGQB 2G5HC 3A6NA 3EPJA 5GSUC 3AZKC 3RELB 3X1UA 1KX4B 3B0CW 3UTBD 3AV1D 3WTPC 1P3BD 4XZQD 3WKJD 1P34A 2Y2LA 3VH6W 4Z5TC 4CSRB 5B1MB 4DRBA 4J8WB 1P3GD 5KDMB 3B6GA 1WWSA 3KUYB 5CPID 3V9RB 3MGSD 5DNMB 4KHAB 1KX5A 2L5AA 5CPJD 3W98A 4KGCC 3AN2A 3F6TA 3AYWC 5GSUB 4H9NB 1P3MC 2NQBA 3AZKB 1M18D 3W97C 1S32D 3EG5B 2W8SA 1M1AD 3WTPB 2CV5A 1TAFB 1BFMA 4H9RA 5B0YD 4Z5TB 2RVQD 1Z2CB 5BS7A 4DRAA 4JJNC 3LZ0D 3H0LC 1AOIC 2PYOC 3REJD 5B40C 4WU9D 3REKD 3AZIC 5BO0B 4ZUXA 5B2IA 3B6FD 3UTAC 4KGCB 3AZJC 3AYWB 4H9QB 2F8NB 1F66C 5E5AC 1P3MB 5GT3D 3X1VA 4H9SA 3W97B 5CPKC 5B24C 2Y2IA 3A6ND 4Z2MH 3X1SC 3AZGC 5B0ZC 1HTAA 3LJAC 3X1UD 4J8XA 3AZMA 4JJNB 4Z66C 3WA9C 1P34D 1AOIB 2PYOB 1ZLAA 1H3OA 5B40B 3MVDC 3W96A 5B33C 3AZIB 3AL0C 3AZHC 3B6GD 5GXQA 3UTAB 3AZJB 1F66B 5E5AB 5GT0A 3REHA 3TU4C 1KX5D 2AROC 3W98D 3NQUB 3AN2D 1KU5A 5CPKB 5B24B 5B1LC 1JFIB 3X1SB 3AZGB 3KXBC 5B0ZB 3LJAB 3EPKA 4J8VA 3REIA 1P3OC 1ID3A 1TZYC 5AV5C 3WA9B 4Z66B 3AZEB 2CV5D 1P3AA 2F8NK 4X23D 1WWIA 3MVDB 5B33B 5AY8A 4WU8A 3AV1C 3UTBC 3AZHB 4XZQC 3WKJC 5AVCC 4ZUXD 1P3IA 1W2EA 5B2ID 3TU4B 1P3GC 2AROB 1KX3A 3NQJA 5B1LB 3R45B 5CPIC 3X1VD 3KXBB 2XD1A 3MGSC 3C1CA 4WZSB 1TZYB 2BYMB 5AV5B 5CPJC 5BT1D 4YM6A 5AV9A 4J8XD 4LD9A 3AZMD 1M18C 1S32C 3AV1B 3UTBB 2Y2OA 4R8PD 4XZQB 3WKJB 1ZLAD 5G49A 3KFUG 5B0YC 3W96D 3AV2A 3KWQA 4UUZB 1P3GB 2YFWB 4HGAC 5GXQD 3MNNA 4DQYB 3LZ0C 1EQZC 3X1TC 5CPIB 3REHD 4UPKA 3REJC 3MGSB 3AZLA 3REKC 4WU9C 2NZDA 5CPJB 3AZNA 2HIOC 1P3LC 3A1KA 4J8VD 5AV8C 3REID 5GT3C 1P3KA 1ID3D 2Y2PA 2Y2GA 1M18B 3MGQA 1S32B 2JCHA 1P3AD 3W99A 3A6NC 1BH8A 1HQ3A 2XD5A 5B0YB 3RELA 3X1UC 5AY8D 4AWLC 4WU8D 3MGRA 4HGAB 5B2JA 3C1BD 1EQZB 3LZ0B 1P34C 3AFAA 2Y2JA 3X1TB 2Y2HA 4CSRA 4WJ3C 3REJB 1KX3D 4WU9B 3REKB 2BYKB 5JA4A 3B6GC 1U35C 5B32C 2HIOB 3WTPE 1P3LB 3O62A 5AVBA 3C1CD 5AV8B 5GT3B 1KX5C 3W98C 3LZ1A 4J8UA 4YM6D 1P3PA 3A6NB 2Y2KA 5AV9D 3AZKA 4LD9D 3X1UB 1B6WA 2CWEA 4E44A 4AWLB 2YFVB 1P34B 4X23C 5CP6A 1M19A 5BS7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ D;  3MNN D;  3B6G B;  1U35 B;  5B32 B;  5FUG B;  5CHL B;  3AZL D;  1KX5 B;  2NZD D;  5JRG A;  3W98 B;  3AZN D;  4KGC A;  3AYW A;  1P3K D;  3W97 A;  1BH9 A;  3MGQ D;  3W99 D;  4XUJ A;  5BT1 C;  1HQ3 D;  4X23 B;  4J8X C;  3AZM C;  3MGR D;  5AV6 A;  4CAY B;  3WAA A;  5B2J D;  3AZE C;  1AOI A;  3AFA D;  4R8P C;  1ZLA C;  5BNV A;  3VH5 A;  3W96 C;  4H9O A;  4ZUX B;  3UT9 A;  1N1J A;  3AZJ A;  3AZF A;  3O62 D;  5AVB D;  3REH C;  3LZ1 D;  4J8U D;  5B31 A;  1P3P D;  3X1S A;  2NQB D;  3AZK D;  3REI C;  1ID3 C;  4G92 B;  4J8X B;  4KUD A;  3AZM B;  1P3A C;  3MGP A;  3LEL A;  5CP6 D;  4R8P B;  1ZLA B;  1H3O B;  1M19 D;  3MVD A;  4H9P A;  5C3I C;  3W96 B;  4WU8 C;  1P3B C;  5GXQ B;  3C1B C;  4WNN A;  4ZBJ C;  3REH B;  1KX3 C;  5JRG D;  5B31 G;  4KGC D;  1P3F A;  3AYW D;  2FJ7 A;  1P3O A;  3C1C C;  3W97 D;  3REI B;  1ID3 B;  1TZY A;  4XUJ D;  4YM6 C;  1P3A B;  4NE6 A;  5AV9 C;  4LD9 C;  4NE3 A;  5C3I B;  5AV6 D;  4WU8 B;  3WAA D;  4M6B A;  1M1A C;  1P3B B;  3C1B B;  5AVC A;  2RVQ C;  4ZBJ B;  5F99 A;  1KX3 B;  4UUZ A;  3KWQ C;  3UT9 D;  3AZJ D;  3AZF D;  4YS3 A;  5CPI A;  5GT0 D;  3C1C B;  3AZL C;  2NZD C;  5B31 D;  3B6F C;  3AZN C;  4YM6 B;  4QLC A;  3X1S D;  3VH5 T;  5DNN A;  1P3K C;  5AV9 B;  4LD9 B;  4KUD D;  1A7W A;  4E45 A;  3W99 C;  3MGP D;  3LEL D;  1M1A B;  1HQ3 C;  1KX4 A;  3MGR C;  3KWQ B;  5B2J C;  1EQZ A;  3LZ0 A;  3AFA C;  3X1T A;  5BNX B;  1P3I D;  5B1M A;  4J8W A;  2BYK A;  3B0C T;  3AZL B;  5KDM A;  1P3F D;  2NZD B;  3B6F B;  3AZN B;  2HIO A;  3KUY A;  2FJ7 D;  1P3L A;  1P3O D;  3O62 C;  3V9R A;  5AVB C;  5DNM A;  5AV8 A;  1P3K B;  4KHA A;  1Q9C A;  1TZY D;  4WV4 B;  3LZ1 C;  4J8U C;  3AN2 C;  1P3P C;  3W99 B;  1BH8 B;  5GSU A;  1HQ3 B;  4H9N A;  2NQB C;  4EO5 C;  1R4V A;  3MGR B;  2YFV A;  5B2J B;  3WTP A;  2CV5 C;  1TAF A;  5CP6 C;  3AFA B;  1M19 C;  4Z5T A;  5AVC D;  5F99 D;  3AV2 D;  5JA4 B;  1U35 A;  5B32 A;  2HUE C;  4YS3 D;  3O62 B;  5FUG A;  5AVB B;  5BO0 A;  4ZUX C;  5B2I C;  5JRG C;  3LZ1 B;  4J8U B;  4QLC D;  3AN2 B;  1P3P B;  4H9Q A;  5DNN D;  2F8N A;  1P3M A;  2NQB B;  3X1V C;  4EO5 B;  4H9S C;  2F8N H;  4XUJ C;  2CV5 B;  4X23 A;  5CP6 B;  4H9R B;  3REL D;  1M19 B;  4G92 C;  1KX4 D;  5AV6 C;  4CAY A;  3WAA C;  4JJN A;  1EQZ D;  5B32 G;  3X1T D;  2PYO A;  2HUE B;  5B40 A;  5B1M D;  4J8W D;  3AZI A;  5B2I B;  5JRG B;  5GXQ C;  3UTA A;  3UT9 C;  2HIO D;  3KUY D;  3AZF C;  2F8N G;  1P3L D;  1F66 A;  5E5A A;  5DNM D;  5GT0 C;  5AV8 D;  3X1V B;  1BH9 B;  3NQU A;  5B31 C;  1JFI A;  4XUJ B;  5B24 A;  5CPK A;  5GSU D;  3AZG A;  5B0Z A;  4NE5 A;  3LJA A;  4J8V C;  4KUD C;  5AV6 B;  3WA9 A;  4Z66 A;  3WTP D;  3AZE A;  3WAA B;  3MGP C;  3LEL C;  4R8P A;  3VH6 A;  5BNV B;  4NFT A;  4Z5T D;  2JSS A;  5B33 A;  4H9O B;  5AY8 C;  3AZH A;  1U35 D;  5B32 D;  3UT9 B;  1N1J B;  3AZF B;  5GT0 B;  1P3I C;  4Z2M G;  3B0B A;  3TU4 A;  2ARO A;  1P3F C;  5B31 B;  5B1L A;  3R45 A;  2F8N D;  2FJ7 C;  1P3M D;  3KXB A;  3KSY A;  4J8V B;  4KUD B;  2BYM A;  5AV5 A;  3B0D C;  3MGP B;  3LEL B;  2IO5 C;  4H9P B;  4JJN D;  5AY8 B;  3AV1 A;  3UTB A;  1AOI D;  1P3B A;  4XZQ A;  3C1B A;  3WKJ A;  2PYO D;  5B40 D;  3AZI D;  4WNN B;  5F99 C;  1P3I B;  3AV2 C;  1P3G A;  2YFW A;  3MNN C;  3UTA D;  1P3F B;  3NQJ B;  4YS3 C;  5E5A D;  1F66 D;  2FJ7 B;  1P3O B;  1ULY A;  1F1E A;  3MGS A;  5CPJ A;  5B24 D;  5CPK D;  3B0D B;  4QLC C;  3AZG D;  5DNN C;  5B0Z D;  3LJA D;  4G91 C;  1M18 A;  2IO5 B;  3MGQ C;  3WA9 D;  4Z66 D;  1S32 A;  3AZE D;  1M1A A;  5G49 B;  5B0Y A;  3REL C;  3MVD D;  1KX4 C;  5B33 D;  5AVC B;  5F99 B;  3AV2 B;  3AZH D;  3MNN B;  3VH5 W;  4YS3 B;  5BNX A;  3REJ A;  5B1M C;  4J8W C;  2ARO D;  3REK A;  3TU4 D;  4WU9 A;  3B6F A;  5B1L D;  3VH6 T;  4QLC B;  3KUY C;  2LY8 A;  5DNN B;  3KXB D;  4G91 B;  5DNM C;  5GT3 A;  5AV5 D;  1B67 A;  3MGQ B;  3A6N A;  5GSU C;  3AZK C;  3REL B;  3X1U A;  1KX4 B;  3B0C W;  3UTB D;  3AV1 D;  3WTP C;  1P3B D;  4XZQ D;  3WKJ D;  1P34 A;  3VH6 W;  4Z5T C;  4CSR B;  5B1M B;  4DRB A;  4J8W B;  1P3G D;  5KDM B;  3B6G A;  1WWS A;  3KUY B;  5CPI D;  3V9R B;  3MGS D;  5DNM B;  4KHA B;  1KX5 A;  2L5A A;  5CPJ D;  3W98 A;  4KGC C;  3AN2 A;  3AYW C;  5GSU B;  4H9N B;  1P3M C;  2NQB A;  3AZK B;  1M18 D;  3W97 C;  1S32 D;  1M1A D;  3WTP B;  2CV5 A;  1TAF B;  1BFM A;  4H9R A;  5B0Y D;  4Z5T B;  2RVQ D;  5BS7 A;  4DRA A;  4JJN C;  3LZ0 D;  1AOI C;  2PYO C;  3REJ D;  5B40 C;  4WU9 D;  3REK D;  3AZI C;  5BO0 B;  4ZUX A;  5B2I A;  3B6F D;  3UTA C;  4KGC B;  3AZJ C;  3AYW B;  4H9Q B;  2F8N B;  1F66 C;  5E5A C;  1P3M B;  5GT3 D;  3X1V A;  4H9S A;  3W97 B;  5CPK C;  5B24 C;  3A6N D;  4Z2M H;  3X1S C;  3AZG C;  5B0Z C;  1HTA A;  3LJA C;  3X1U D;  4J8X A;  3AZM A;  4JJN B;  4Z66 C;  3WA9 C;  1P34 D;  1AOI B;  2PYO B;  1ZLA A;  1H3O A;  5B40 B;  3MVD C;  3W96 A;  5B33 C;  3AZI B;  3AZH C;  3B6G D;  5GXQ A;  3UTA B;  3AZJ B;  1F66 B;  5E5A B;  5GT0 A;  3REH A;  3TU4 C;  1KX5 D;  2ARO C;  3W98 D;  3NQU B;  3AN2 D;  1KU5 A;  5CPK B;  5B24 B;  5B1L C;  1JFI B;  3X1S B;  3AZG B;  3KXB C;  5B0Z B;  3LJA B;  4J8V A;  3REI A;  1P3O C;  1ID3 A;  1TZY C;  5AV5 C;  3WA9 B;  4Z66 B;  3AZE B;  2CV5 D;  1P3A A;  2F8N K;  4X23 D;  1WWI A;  3MVD B;  5B33 B;  5AY8 A;  4WU8 A;  3AV1 C;  3UTB C;  3AZH B;  4XZQ C;  3WKJ C;  5AVC C;  4ZUX D;  1P3I A;  5B2I D;  1KX3 A;  3TU4 B;  1P3G C;  2ARO B;  3NQJ A;  5B1L B;  3R45 B;  5CPI C;  3X1V D;  3KXB B;  3MGS C;  3C1C A;  4WZS B;  1TZY B;  2BYM B;  5AV5 B;  5CPJ C;  5BT1 D;  4YM6 A;  5AV9 A;  4J8X D;  4LD9 A;  3AZM D;  1M18 C;  1S32 C;  3AV1 B;  3UTB B;  4R8P D;  4XZQ B;  3WKJ B;  1ZLA D;  5G49 A;  5B0Y C;  3W96 D;  3AV2 A;  3KWQ A;  4UUZ B;  1P3G B;  2YFW B;  4HGA C;  5GXQ D;  3MNN A;  1EQZ C;  3LZ0 C;  3X1T C;  5CPI B;  3REH D;  3REJ C;  3MGS B;  3AZL A;  3REK C;  4WU9 C;  2NZD A;  5CPJ B;  3AZN A;  2HIO C;  1P3L C;  4J8V D;  3REI D;  5AV8 C;  1P3K A;  5GT3 C;  1ID3 D;  1M18 B;  3MGQ A;  1S32 B;  3W99 A;  1P3A D;  3A6N C;  1BH8 A;  1HQ3 A;  5B0Y B;  3REL A;  3X1U C;  5AY8 D;  4AWL C;  4WU8 D;  3MGR A;  4HGA B;  5B2J A;  3C1B D;  1EQZ B;  3LZ0 B;  1P34 C;  3AFA A;  3X1T B;  4CSR A;  3REJ B;  1KX3 D;  4WU9 B;  3REK B;  2BYK B;  5JA4 A;  3B6G C;  1U35 C;  5B32 C;  2HIO B;  3WTP E;  1P3L B;  3O62 A;  5AVB A;  3C1C D;  5AV8 B;  5GT3 B;  1KX5 C;  3W98 C;  3LZ1 A;  4J8U A;  4YM6 D;  1P3P A;  3A6N B;  5AV9 D;  3AZK A;  4LD9 D;  3X1U B;  1B6W A;  2CWE A;  4E44 A;  4AWL B;  2YFV B;  1P34 B;  4X23 C;  5CP6 A;  1M19 A;  5BS7 C; 
#chains in the Genus database with same CATH topology
 3KWQ D;  3MNN D;  3B6G B;  1U35 B;  5B32 B;  5FUG B;  5CHL B;  3AZL D;  1KX5 B;  2NZD D;  5JRG A;  3W98 B;  3AZN D;  4KGC A;  3AYW A;  1P3K D;  3W97 A;  1BH9 A;  3MGQ D;  3W99 D;  4XUJ A;  5BT1 C;  1HQ3 D;  4X23 B;  2ZY5 A;  4J8X C;  3AZM C;  3A1I A;  5AV6 A;  3MGR D;  4CAY B;  3WAA A;  5B2J D;  3AZE C;  2Y2Q A;  1AOI A;  3AFA D;  4R8P C;  2ZY3 A;  3IP4 C;  2J8P A;  1ZLA C;  5BNV A;  3VH5 A;  2ZM5 A;  3W96 C;  4H9O A;  4ZUX B;  2RIQ A;  2FFF B;  3UT9 A;  1N1J A;  3AZJ A;  3AZF A;  3O62 D;  5AVB D;  3REH C;  3LZ1 D;  4J8U D;  5B31 A;  1P3P D;  2ZY2 A;  3X1S A;  2NQB D;  3AZK D;  3REI C;  1ID3 C;  4G92 B;  4J8X B;  4KUD A;  3AZM B;  1P3A C;  3MGP A;  3LEL A;  5CP6 D;  4R8P B;  1ZLA B;  1H3O B;  1M19 D;  3MVD A;  4H9P A;  5C3I C;  3W96 B;  4WU8 C;  1P3B C;  5GXQ B;  3C1B C;  4WNN A;  4ZBJ C;  3REH B;  1KX3 C;  5JRG D;  5B31 G;  4KGC D;  1P3F A;  3AYW D;  2F2A C;  2FJ7 A;  1P3O A;  3C1C C;  3W97 D;  3REI B;  1ID3 B;  1TZY A;  4XUJ D;  4YM6 C;  1P3A B;  4NE6 A;  5AV9 C;  4LD9 C;  4NE3 A;  5C3I B;  5AV6 D;  4WU8 B;  2BG1 A;  3WAA D;  4M6B A;  1T3U A;  1PZR A;  1M1A C;  1P3B B;  3C1B B;  5AVC A;  2RVQ C;  2VQR A;  4ZBJ B;  5F99 A;  3EPL A;  4UUZ A;  3KWQ C;  1KX3 B;  3UT9 D;  3AZJ D;  3AZF D;  4YS3 A;  5CPI A;  5GT0 D;  3C1C B;  3AZL C;  2NZD C;  5B31 D;  3B6F C;  3AZN C;  4YM6 B;  4QLC A;  3X1S D;  3VH5 T;  5DNN A;  1P3K C;  2DF4 C;  5AV9 B;  4KUD D;  4LD9 B;  1A7W A;  4E45 A;  3W99 C;  3MGP D;  3LEL D;  1M1A B;  1HQ3 C;  1KX4 A;  3MGR C;  3KWQ B;  5B2J C;  1EQZ A;  3LZ0 A;  3AFA C;  3X1T A;  5BNX B;  1P3I D;  5B1M A;  4J8W A;  2BYK A;  3B0C T;  3AZL B;  5KDM A;  1P3F D;  2NZD B;  3B6F B;  3AZN B;  3H0R C;  2HIO A;  3KUY A;  2FJ7 D;  2UWX A;  1P3L A;  1P3O D;  3O62 C;  3V9R A;  5AVB C;  5DNM A;  5AV8 A;  1P3K B;  4KHA A;  1Q9C A;  1TZY D;  4WV4 B;  3LZ1 C;  4J8U C;  2Y2M A;  3AN2 C;  1P3P C;  3W99 B;  1BH8 B;  5GSU A;  1HQ3 B;  4H9N A;  2NQB C;  4EO5 C;  1R4V A;  3MGR B;  3H0M C;  2YFV A;  5B2J B;  3WTP A;  2CV5 C;  1TAF A;  5CP6 C;  3AFA B;  1M19 C;  4Z5T A;  5AVC D;  5F99 D;  3AV2 D;  5JA4 B;  1U35 A;  5B32 A;  2HUE C;  4YS3 D;  3O62 B;  5FUG A;  5AVB B;  3FDD A;  5BO0 A;  4ZUX C;  5B2I C;  5JRG C;  3LZ1 B;  4J8U B;  4QLC D;  3AN2 B;  1P3P B;  4H9Q A;  5DNN D;  2F8N A;  1P3M A;  2NQB B;  3X1V C;  4EO5 B;  4H9S C;  2F8N H;  4XUJ C;  2CV5 B;  4X23 A;  5CP6 B;  4H9R B;  3REL D;  1M19 B;  4G92 C;  2ZY4 A;  1KX4 D;  5AV6 C;  4CAY A;  3WAA C;  4JJN A;  1EQZ D;  5B32 G;  3X1T D;  2PYO A;  2HUE B;  5B40 A;  5B1M D;  4J8W D;  3AZI A;  5B2I B;  5JRG B;  5GXQ C;  3UTA A;  3UT9 C;  2HIO D;  3KUY D;  3AZF C;  2F8N G;  1P3L D;  1F66 A;  5E5A A;  5DNM D;  5GT0 C;  5AV8 D;  3P5J B;  3X1V B;  1BH9 B;  3NQU A;  5B31 C;  1JFI A;  4XUJ B;  5B24 A;  5CPK A;  5GSU D;  3AZG A;  5B0Z A;  4NE5 A;  3LJA A;  4J8V C;  2DQN C;  4KUD C;  5AV6 B;  3WA9 A;  4Z66 A;  3WTP D;  3AZE A;  3WAA B;  3MGP C;  3LEL C;  4R8P A;  3VH6 A;  5BNV B;  4NFT A;  4Z5T D;  2JSS A;  5B33 A;  4H9O B;  5AY8 C;  3AZH A;  1U35 D;  5B32 D;  3UT9 B;  1N1J B;  3AZF B;  5GT0 B;  1P3I C;  4Z2M G;  3B0B A;  3TU4 A;  2ARO A;  1P3F C;  5B31 B;  5B1L A;  3R45 A;  2F8N D;  2FJ7 C;  1P3M D;  3KXB A;  3KSY A;  4J8V B;  4KUD B;  2BYM A;  5AV5 A;  3B0D C;  3MGP B;  3LEL B;  2IO5 C;  4H9P B;  4JJN D;  5AY8 B;  3AV1 A;  3UTB A;  1AOI D;  1P3B A;  4XZQ A;  3C1B A;  3WKJ A;  2PYO D;  5B40 D;  3AZI D;  4WNN B;  5F99 C;  1P3I B;  3AV2 C;  1P3G A;  2YFW A;  3MNN C;  3UTA D;  1P3F B;  3NQJ B;  4YS3 C;  5E5A D;  1F66 D;  2FJ7 B;  1P3O B;  1ULY A;  2JE5 A;  1F1E A;  3MGS A;  5CPJ A;  5B24 D;  5CPK D;  3B0D B;  4QLC C;  3AZG D;  5DNN C;  5B0Z D;  3LJA D;  4G91 C;  2G5I C;  1M18 A;  2IO5 B;  3MGQ C;  3WA9 D;  4Z66 D;  1S32 A;  3AZE D;  1M1A A;  5G49 B;  5B0Y A;  3REL C;  2Y2N A;  3MVD D;  1KX4 C;  5B33 D;  5AVC B;  5F99 B;  3AV2 B;  3AZH D;  3MNN B;  3EPH A;  3VH5 W;  4YS3 B;  5BNX A;  3REJ A;  5B1M C;  4J8W C;  2ARO D;  3REK A;  3TU4 D;  4WU9 A;  3B6F A;  5B1L D;  3VH6 T;  4QLC B;  3KUY C;  2LY8 A;  5DNN B;  3KXB D;  4G91 B;  5DNM C;  5GT3 A;  5AV5 D;  1B67 A;  3MGQ B;  2G5H C;  3A6N A;  3EPJ A;  5GSU C;  3AZK C;  3REL B;  3X1U A;  1KX4 B;  3B0C W;  3UTB D;  3AV1 D;  3WTP C;  1P3B D;  4XZQ D;  3WKJ D;  1P34 A;  2Y2L A;  3VH6 W;  4Z5T C;  4CSR B;  5B1M B;  4DRB A;  4J8W B;  1P3G D;  5KDM B;  3B6G A;  1WWS A;  3KUY B;  5CPI D;  3V9R B;  3MGS D;  5DNM B;  4KHA B;  1KX5 A;  2L5A A;  5CPJ D;  3W98 A;  4KGC C;  3AN2 A;  3F6T A;  3AYW C;  5GSU B;  4H9N B;  1P3M C;  2NQB A;  3AZK B;  1M18 D;  3W97 C;  1S32 D;  3EG5 B;  2W8S A;  1M1A D;  3WTP B;  2CV5 A;  1TAF B;  1BFM A;  4H9R A;  5B0Y D;  4Z5T B;  2RVQ D;  1Z2C B;  5BS7 A;  4DRA A;  4JJN C;  3LZ0 D;  3H0L C;  1AOI C;  2PYO C;  3REJ D;  5B40 C;  4WU9 D;  3REK D;  3AZI C;  5BO0 B;  4ZUX A;  5B2I A;  3B6F D;  3UTA C;  4KGC B;  3AZJ C;  3AYW B;  4H9Q B;  2F8N B;  1F66 C;  5E5A C;  1P3M B;  5GT3 D;  3X1V A;  4H9S A;  3W97 B;  5CPK C;  5B24 C;  2Y2I A;  3A6N D;  4Z2M H;  3X1S C;  3AZG C;  5B0Z C;  1HTA A;  3LJA C;  3X1U D;  4J8X A;  3AZM A;  4JJN B;  4Z66 C;  3WA9 C;  1P34 D;  1AOI B;  2PYO B;  1ZLA A;  1H3O A;  5B40 B;  3MVD C;  3W96 A;  5B33 C;  3AZI B;  3AL0 C;  3AZH C;  3B6G D;  5GXQ A;  3UTA B;  3AZJ B;  1F66 B;  5E5A B;  5GT0 A;  3REH A;  3TU4 C;  1KX5 D;  2ARO C;  3W98 D;  3NQU B;  3AN2 D;  1KU5 A;  5CPK B;  5B24 B;  5B1L C;  1JFI B;  3X1S B;  3AZG B;  3KXB C;  5B0Z B;  3LJA B;  3EPK A;  4J8V A;  3REI A;  1P3O C;  1ID3 A;  1TZY C;  5AV5 C;  3WA9 B;  4Z66 B;  3AZE B;  2CV5 D;  1P3A A;  2F8N K;  4X23 D;  1WWI A;  3MVD B;  5B33 B;  5AY8 A;  4WU8 A;  3AV1 C;  3UTB C;  3AZH B;  4XZQ C;  3WKJ C;  5AVC C;  4ZUX D;  1P3I A;  1W2E A;  5B2I D;  3TU4 B;  1P3G C;  2ARO B;  1KX3 A;  3NQJ A;  5B1L B;  3R45 B;  5CPI C;  3X1V D;  3KXB B;  2XD1 A;  3MGS C;  3C1C A;  4WZS B;  1TZY B;  2BYM B;  5AV5 B;  5CPJ C;  5BT1 D;  4YM6 A;  5AV9 A;  4J8X D;  4LD9 A;  3AZM D;  1M18 C;  1S32 C;  3AV1 B;  3UTB B;  2Y2O A;  4R8P D;  4XZQ B;  3WKJ B;  1ZLA D;  5G49 A;  3KFU G;  5B0Y C;  3W96 D;  3AV2 A;  3KWQ A;  4UUZ B;  1P3G B;  2YFW B;  4HGA C;  5GXQ D;  3MNN A;  4DQY B;  3LZ0 C;  1EQZ C;  3X1T C;  5CPI B;  3REH D;  4UPK A;  3REJ C;  3MGS B;  3AZL A;  3REK C;  4WU9 C;  2NZD A;  5CPJ B;  3AZN A;  2HIO C;  1P3L C;  3A1K A;  4J8V D;  5AV8 C;  3REI D;  5GT3 C;  1P3K A;  1ID3 D;  2Y2P A;  2Y2G A;  1M18 B;  3MGQ A;  1S32 B;  2JCH A;  1P3A D;  3W99 A;  3A6N C;  1BH8 A;  1HQ3 A;  2XD5 A;  5B0Y B;  3REL A;  3X1U C;  5AY8 D;  4AWL C;  4WU8 D;  3MGR A;  4HGA B;  5B2J A;  3C1B D;  1EQZ B;  3LZ0 B;  1P34 C;  3AFA A;  2Y2J A;  3X1T B;  2Y2H A;  4CSR A;  4WJ3 C;  3REJ B;  1KX3 D;  4WU9 B;  3REK B;  2BYK B;  5JA4 A;  3B6G C;  1U35 C;  5B32 C;  2HIO B;  3WTP E;  1P3L B;  3O62 A;  5AVB A;  3C1C D;  5AV8 B;  5GT3 B;  1KX5 C;  3W98 C;  3LZ1 A;  4J8U A;  4YM6 D;  1P3P A;  3A6N B;  2Y2K A;  5AV9 D;  3AZK A;  4LD9 D;  3X1U B;  1B6W A;  2CWE A;  4E44 A;  4AWL B;  2YFV B;  1P34 B;  4X23 C;  5CP6 A;  1M19 A;  5BS7 C; 
#chains in the Genus database with same CATH homology
 3KWQ D;  3MNN D;  3B6G B;  1U35 B;  5B32 B;  5FUG B;  5CHL B;  3AZL D;  1KX5 B;  2NZD D;  5JRG A;  3W98 B;  3AZN D;  4KGC A;  3AYW A;  1P3K D;  3W97 A;  1BH9 A;  3MGQ D;  3W99 D;  4XUJ A;  5BT1 C;  1HQ3 D;  4X23 B;  2ZY5 A;  4J8X C;  3AZM C;  3A1I A;  5AV6 A;  3MGR D;  4CAY B;  3WAA A;  5B2J D;  3AZE C;  2Y2Q A;  1AOI A;  3AFA D;  4R8P C;  2ZY3 A;  3IP4 C;  2J8P A;  1ZLA C;  5BNV A;  3VH5 A;  2ZM5 A;  3W96 C;  4H9O A;  4ZUX B;  2RIQ A;  2FFF B;  3UT9 A;  1N1J A;  3AZJ A;  3AZF A;  3O62 D;  5AVB D;  3REH C;  3LZ1 D;  4J8U D;  5B31 A;  1P3P D;  2ZY2 A;  3X1S A;  2NQB D;  3AZK D;  3REI C;  1ID3 C;  4G92 B;  4J8X B;  4KUD A;  3AZM B;  1P3A C;  3MGP A;  3LEL A;  5CP6 D;  4R8P B;  1ZLA B;  1H3O B;  1M19 D;  3MVD A;  4H9P A;  5C3I C;  3W96 B;  4WU8 C;  1P3B C;  5GXQ B;  3C1B C;  4WNN A;  4ZBJ C;  3REH B;  1KX3 C;  5JRG D;  5B31 G;  4KGC D;  1P3F A;  3AYW D;  2F2A C;  2FJ7 A;  1P3O A;  3C1C C;  3W97 D;  3REI B;  1ID3 B;  1TZY A;  4XUJ D;  4YM6 C;  1P3A B;  4NE6 A;  5AV9 C;  4LD9 C;  4NE3 A;  5C3I B;  5AV6 D;  4WU8 B;  2BG1 A;  3WAA D;  4M6B A;  1T3U A;  1PZR A;  1M1A C;  1P3B B;  3C1B B;  5AVC A;  2RVQ C;  2VQR A;  4ZBJ B;  5F99 A;  3EPL A;  4UUZ A;  3KWQ C;  1KX3 B;  3UT9 D;  3AZJ D;  3AZF D;  4YS3 A;  5CPI A;  5GT0 D;  3C1C B;  3AZL C;  2NZD C;  5B31 D;  3B6F C;  3AZN C;  4YM6 B;  4QLC A;  3X1S D;  3VH5 T;  5DNN A;  1P3K C;  2DF4 C;  5AV9 B;  4KUD D;  4LD9 B;  1A7W A;  4E45 A;  3W99 C;  3MGP D;  3LEL D;  1M1A B;  1HQ3 C;  1KX4 A;  3MGR C;  3KWQ B;  5B2J C;  1EQZ A;  3LZ0 A;  3AFA C;  3X1T A;  5BNX B;  1P3I D;  5B1M A;  4J8W A;  2BYK A;  3B0C T;  3AZL B;  5KDM A;  1P3F D;  2NZD B;  3B6F B;  3AZN B;  3H0R C;  2HIO A;  3KUY A;  2FJ7 D;  2UWX A;  1P3L A;  1P3O D;  3O62 C;  3V9R A;  5AVB C;  5DNM A;  5AV8 A;  1P3K B;  4KHA A;  1Q9C A;  1TZY D;  4WV4 B;  3LZ1 C;  4J8U C;  2Y2M A;  3AN2 C;  1P3P C;  3W99 B;  1BH8 B;  5GSU A;  1HQ3 B;  4H9N A;  2NQB C;  4EO5 C;  1R4V A;  3MGR B;  3H0M C;  2YFV A;  5B2J B;  3WTP A;  2CV5 C;  1TAF A;  5CP6 C;  3AFA B;  1M19 C;  4Z5T A;  5AVC D;  5F99 D;  3AV2 D;  5JA4 B;  1U35 A;  5B32 A;  2HUE C;  4YS3 D;  3O62 B;  5FUG A;  5AVB B;  3FDD A;  5BO0 A;  4ZUX C;  5B2I C;  5JRG C;  3LZ1 B;  4J8U B;  4QLC D;  3AN2 B;  1P3P B;  4H9Q A;  5DNN D;  2F8N A;  1P3M A;  2NQB B;  3X1V C;  4EO5 B;  4H9S C;  2F8N H;  4XUJ C;  2CV5 B;  4X23 A;  5CP6 B;  4H9R B;  3REL D;  1M19 B;  4G92 C;  2ZY4 A;  1KX4 D;  5AV6 C;  4CAY A;  3WAA C;  4JJN A;  1EQZ D;  5B32 G;  3X1T D;  2PYO A;  2HUE B;  5B40 A;  5B1M D;  4J8W D;  3AZI A;  5B2I B;  5JRG B;  5GXQ C;  3UTA A;  3UT9 C;  2HIO D;  3KUY D;  3AZF C;  2F8N G;  1P3L D;  1F66 A;  5E5A A;  5DNM D;  5GT0 C;  5AV8 D;  3P5J B;  3X1V B;  1BH9 B;  3NQU A;  5B31 C;  1JFI A;  4XUJ B;  5B24 A;  5CPK A;  5GSU D;  3AZG A;  5B0Z A;  4NE5 A;  3LJA A;  4J8V C;  2DQN C;  4KUD C;  5AV6 B;  3WA9 A;  4Z66 A;  3WTP D;  3AZE A;  3WAA B;  3MGP C;  3LEL C;  4R8P A;  3VH6 A;  5BNV B;  4NFT A;  4Z5T D;  2JSS A;  5B33 A;  4H9O B;  5AY8 C;  3AZH A;  1U35 D;  5B32 D;  3UT9 B;  1N1J B;  3AZF B;  5GT0 B;  1P3I C;  4Z2M G;  3B0B A;  3TU4 A;  2ARO A;  1P3F C;  5B31 B;  5B1L A;  3R45 A;  2F8N D;  2FJ7 C;  1P3M D;  3KXB A;  3KSY A;  4J8V B;  4KUD B;  2BYM A;  5AV5 A;  3B0D C;  3MGP B;  3LEL B;  2IO5 C;  4H9P B;  4JJN D;  5AY8 B;  3AV1 A;  3UTB A;  1AOI D;  1P3B A;  4XZQ A;  3C1B A;  3WKJ A;  2PYO D;  5B40 D;  3AZI D;  4WNN B;  5F99 C;  1P3I B;  3AV2 C;  1P3G A;  2YFW A;  3MNN C;  3UTA D;  1P3F B;  3NQJ B;  4YS3 C;  5E5A D;  1F66 D;  2FJ7 B;  1P3O B;  1ULY A;  2JE5 A;  1F1E A;  3MGS A;  5CPJ A;  5B24 D;  5CPK D;  3B0D B;  4QLC C;  3AZG D;  5DNN C;  5B0Z D;  3LJA D;  4G91 C;  2G5I C;  1M18 A;  2IO5 B;  3MGQ C;  3WA9 D;  4Z66 D;  1S32 A;  3AZE D;  1M1A A;  5G49 B;  5B0Y A;  3REL C;  2Y2N A;  3MVD D;  1KX4 C;  5B33 D;  5AVC B;  5F99 B;  3AV2 B;  3AZH D;  3MNN B;  3EPH A;  3VH5 W;  4YS3 B;  5BNX A;  3REJ A;  5B1M C;  4J8W C;  2ARO D;  3REK A;  3TU4 D;  4WU9 A;  3B6F A;  5B1L D;  3VH6 T;  4QLC B;  3KUY C;  2LY8 A;  5DNN B;  3KXB D;  4G91 B;  5DNM C;  5GT3 A;  5AV5 D;  1B67 A;  3MGQ B;  2G5H C;  3A6N A;  3EPJ A;  5GSU C;  3AZK C;  3REL B;  3X1U A;  1KX4 B;  3B0C W;  3UTB D;  3AV1 D;  3WTP C;  1P3B D;  4XZQ D;  3WKJ D;  1P34 A;  2Y2L A;  3VH6 W;  4Z5T C;  4CSR B;  5B1M B;  4DRB A;  4J8W B;  1P3G D;  5KDM B;  3B6G A;  1WWS A;  3KUY B;  5CPI D;  3V9R B;  3MGS D;  5DNM B;  4KHA B;  1KX5 A;  2L5A A;  5CPJ D;  3W98 A;  4KGC C;  3AN2 A;  3F6T A;  3AYW C;  5GSU B;  4H9N B;  1P3M C;  2NQB A;  3AZK B;  1M18 D;  3W97 C;  1S32 D;  3EG5 B;  2W8S A;  1M1A D;  3WTP B;  2CV5 A;  1TAF B;  1BFM A;  4H9R A;  5B0Y D;  4Z5T B;  2RVQ D;  1Z2C B;  5BS7 A;  4DRA A;  4JJN C;  3LZ0 D;  3H0L C;  1AOI C;  2PYO C;  3REJ D;  5B40 C;  4WU9 D;  3REK D;  3AZI C;  5BO0 B;  4ZUX A;  5B2I A;  3B6F D;  3UTA C;  4KGC B;  3AZJ C;  3AYW B;  4H9Q B;  2F8N B;  1F66 C;  5E5A C;  1P3M B;  5GT3 D;  3X1V A;  4H9S A;  3W97 B;  5CPK C;  5B24 C;  2Y2I A;  3A6N D;  4Z2M H;  3X1S C;  3AZG C;  5B0Z C;  1HTA A;  3LJA C;  3X1U D;  4J8X A;  3AZM A;  4JJN B;  4Z66 C;  3WA9 C;  1P34 D;  1AOI B;  2PYO B;  1ZLA A;  1H3O A;  5B40 B;  3MVD C;  3W96 A;  5B33 C;  3AZI B;  3AL0 C;  3AZH C;  3B6G D;  5GXQ A;  3UTA B;  3AZJ B;  1F66 B;  5E5A B;  5GT0 A;  3REH A;  3TU4 C;  1KX5 D;  2ARO C;  3W98 D;  3NQU B;  3AN2 D;  1KU5 A;  5CPK B;  5B24 B;  5B1L C;  1JFI B;  3X1S B;  3AZG B;  3KXB C;  5B0Z B;  3LJA B;  3EPK A;  4J8V A;  3REI A;  1P3O C;  1ID3 A;  1TZY C;  5AV5 C;  3WA9 B;  4Z66 B;  3AZE B;  2CV5 D;  1P3A A;  2F8N K;  4X23 D;  1WWI A;  3MVD B;  5B33 B;  5AY8 A;  4WU8 A;  3AV1 C;  3UTB C;  3AZH B;  4XZQ C;  3WKJ C;  5AVC C;  4ZUX D;  1P3I A;  1W2E A;  5B2I D;  3TU4 B;  1P3G C;  2ARO B;  1KX3 A;  3NQJ A;  5B1L B;  3R45 B;  5CPI C;  3X1V D;  3KXB B;  2XD1 A;  3MGS C;  3C1C A;  4WZS B;  1TZY B;  2BYM B;  5AV5 B;  5CPJ C;  5BT1 D;  4YM6 A;  5AV9 A;  4J8X D;  4LD9 A;  3AZM D;  1M18 C;  1S32 C;  3AV1 B;  3UTB B;  2Y2O A;  4R8P D;  4XZQ B;  3WKJ B;  1ZLA D;  5G49 A;  3KFU G;  5B0Y C;  3W96 D;  3AV2 A;  3KWQ A;  4UUZ B;  1P3G B;  2YFW B;  4HGA C;  5GXQ D;  3MNN A;  4DQY B;  3LZ0 C;  1EQZ C;  3X1T C;  5CPI B;  3REH D;  4UPK A;  3REJ C;  3MGS B;  3AZL A;  3REK C;  4WU9 C;  2NZD A;  5CPJ B;  3AZN A;  2HIO C;  1P3L C;  3A1K A;  4J8V D;  5AV8 C;  3REI D;  5GT3 C;  1P3K A;  1ID3 D;  2Y2P A;  2Y2G A;  1M18 B;  3MGQ A;  1S32 B;  2JCH A;  1P3A D;  3W99 A;  3A6N C;  1BH8 A;  1HQ3 A;  2XD5 A;  5B0Y B;  3REL A;  3X1U C;  5AY8 D;  4AWL C;  4WU8 D;  3MGR A;  4HGA B;  5B2J A;  3C1B D;  1EQZ B;  3LZ0 B;  1P34 C;  3AFA A;  2Y2J A;  3X1T B;  2Y2H A;  4CSR A;  4WJ3 C;  3REJ B;  1KX3 D;  4WU9 B;  3REK B;  2BYK B;  5JA4 A;  3B6G C;  1U35 C;  5B32 C;  2HIO B;  3WTP E;  1P3L B;  3O62 A;  5AVB A;  3C1C D;  5AV8 B;  5GT3 B;  1KX5 C;  3W98 C;  3LZ1 A;  4J8U A;  4YM6 D;  1P3P A;  3A6N B;  2Y2K A;  5AV9 D;  3AZK A;  4LD9 D;  3X1U B;  1B6W A;  2CWE A;  4E44 A;  4AWL B;  2YFV B;  1P34 B;  4X23 C;  5CP6 A;  1M19 A;  5BS7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...