5KDMB

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmB00
1HTAA 5AV8A 1EQZC 4UUZA 5AV6D 3UTAB 5B40A 3MGQB 5B0YD 4HGAC 3B0DC 5B32G 1P3FA 3WTPD 5B2IA 5FUGB 5B0YB 2AROB 3MGPB 3WTPB 4X23C 4R8PB 1S32C 3B6FD 3KSYA 3X1VD 5CPKA 3VH6T 4NFTA 3REID 5B1LA 5B24C 3X1VB 4G92C 1M1AB 3REIB 2HIOD 3W98A 4KGCA 3TU4B 3AZLA 5C3IC 4J8VA 5AV8D 2PYOC 5BO0B 3B6GA 4LD9C 4J8UC 4J8XD 1KX5B 4CAYB 5B2JA 1U35D 4J8XB 4R8PC 5GSUB 5B0ZA 1F66C 5AV9A 1P3PA 1HQ3A 1TAFB 5AVBC 4ZBJB 2FJ7C 2NZDD 5B1LD 5CPJC 3AZNA 5F99C 2NZDB 3W96C 3X1TD 1P3MA 5JRGD 1M18C 4KHAA 3B0BA 3KXBD 1KX4D 3B6GD 1KX5C 5JRGB 3RELA 3NQUA 4ZUXC 3KUYD 3KXBB 5B1MD 3AZKA 1P3LC 2F8NA 5B31C 2JSSA 3KUYB 5B1MB 3VH5T 5AV9D 3REHD 5B32D 3AZID 4ZBJC 5CPID 3REHB 3C1BD 5B32B 3AZIB 5CPIB 4Z5TA 3UTBD 1BH8A 5GT0C 3WAAA 3AYWC 3C1BB 5AV5C 5G49B 1BH9A 3UTBB 2YFWA 4H9RA 1P3MD 4H9SA 4YM6C 4WU8C 3AN2C 5AY8D 3AFAC 3AZFC 3AZJC 3LELC 3LZ1C 3W99B 4YS3D 3RELD 5AY8B 3NQJA 3REJA 1B6WA 4J8WC 3AV1B 5DNNB 3KWQA 1P3GA 2BYKA 4JJND 1M19D 1P3KD 5B33D 4JJNB 3WAAD 1P3KB 3AZGB 1P34A 4XZQA 3LZ0A 5B33B 3MVDD 2NQBA 1P3OA 1JFIB 3REJD 3AZHC 3AZMA 4XUJA 3AV1C 5DNNC 1P3AA 1AOIA 1H3OA 3X1UA 3R45A 1P3BD 3KWQD 4CSRB 1P3BB 5CP6D 4H9PB 1EQZA 5GXQD 3C1CD 1P3IB 5CP6B 5GXQB 2IO5B 4NE3A 4H9QB 3C1CB 5CHLB 5DNMC 4G91B 4E45A 4X23A 3LJAC 1S32A 3AZED 3WKJC 4XUJD 1AOID 4Z66B 3AZEB 5B24A 1KX3D 1ZLAC 3WA9C 5BS7C 5BT1C 4WU9C 5AVCC 4AWLB 4KUDD 1P3IC 1TZYC 3A6ND 3MGSC 2PYOA 3AV2B 4LD9A 4J8UA 3MGRD 2BYMB 5FUGA 3A6NB 3UT9C 5E5AC 3VH6W 5AV6B 3MGRB 4QLCD 1F66A 1ID3D 4H9OA 2L5AA 3O62D 3X1SC 5GT3D 5AVBA 4QLCB 3MNND 4Z66C 3W97C 3O62B 2FJ7A 4Z2MG 5BNVB 5GT3B 3V9RA 5KDMA 5CPJA 3MNNB 3B6FB 3VH6A 5F99A 3W96A 3AV2C 3REKD 2PYOD 1M18A 5JA4A 3UTAC 1KX5A 3MGQC 2HIOB 3REKB 5B40D 2F8NG 4ZUXA 5AV6C 5AV8B 1P3LA 4UUZB 5B0YC 1P3FD 5B31A 5B40B 2AROC 5B2ID 3MGPC 3WTPC 1P3FB 1U35B 5B2IB 2FJ7D 5CPKD 5GT0A 3B0CT 3AYWA 3X1VC 5AV5A 1M1AC 3REIC 1B67A 3TU4C 3W98D 4KGCD 5B1LB 4YM6A 4WU8A 3AZLD 3VH5W 3AN2A 4J8VD 3AFAA 3AZFA 3AZJA 3W98B 3LELA 3LZ1A 4KGCB 5BNXA 4ZUXD 3X1TB 3AZLB 2F8NK 4J8VB 2CWEA 5B2JD 1KX4B 4J8XC 3B6GB 4J8WA 5GSUC 1U35C 5B0ZD 5B2JB 1P3PD 1HQ3D 5B0ZB 5AV9B 1HQ3B 3AYWD 2NZDC 3AZND 4YM6D 3X1TC 5JRGC 3KXBC 1P3MB 1KX4C 4KHAB 3AZHA 3AV1A 1N1JA 5DNNA 3KUYC 3AZKD 5B1MC 2F8ND 3RELB 3NQUB 4YS3B 4WNNA 3AZKB 5AV9C 3REHC 2F8NB 5B32C 3AZIC 2CV5A 5CPIC 4Z5TD 3C1BC 1M19B 3UTBC 4Z5TB 1BH8B 3WAAB 5DNMA 2HUEB 3W99C 4DRAA 2YFWB 3LJAA 4H9RB 5AY8C 3WKJA 4YS3C 4H9NA 3MVDB 1ZLAA 3WA9A 4WV4B 5BS7A 3NQJB 3REJB 5AVCA 4WU9A 1P3GD 2CV5D 1P3IA 1TZYA 3MGSA 4JJNC 2RVQD 1P3KC 1M19C 3KWQB 3AZGC 1P3GB 2BYKB 5B33C 1P34D 4XZQD 3UT9A 3LZ0D 5E5AA 1P34B 3X1SA 3LJAD 1WWIA 2NQBD 3MVDC 4Z66A 3W97A 1P3OD 3AZMD 1P3AD 2NQBB 4M6BA 3X1UD 2YFVA 4WU9D 4XUJB 1P3BC 1P3AB 3AV2A 1H3OB 1AOIB 3X1UB 3R45B 3UTAA 1KX3B 1EQZD 3MGQA 5CP6C 5GXQC 2IO5C 5B31G 5AV6A 4KUDB 3C1CC 5B0YA 2AROA 3MGPA 1WWSA 4G91C 3WTPA 4R8PA 3B0DB 4X23D 1S32D 3W97D 1ID3B 3AZEC 1S32B 3X1VA 5B24D 1M1AA 3REIA 3TU4A 4AWLC 1KX3C 5B24B 3UTAD 5BO0A 3MGQD 4G92B 4NE6A 4KUDC 3A6NC 4LD9D 4J8UD 4CAYA 5C3IB 2PYOB 3MGRC 2AROD 4J8XA 3MGPD 3B0CW 5GSUA 4J8UB 4LD9B 1U35A 4R8PD 1F66D 1TAFA 1ULYA 4QLCC 1ID3C 5AVBD 3O62C 1F66B 5GT3C 4H9OB 3MNNC 5AVBB 5CPJD 1M1AD 3B6FC 2NZDA 3TU4D 2FJ7B 5F99D 5CPKB 3V9RB 5KDMB 5CPJB 3W96D 1M18D 3X1TA 5F99B 2HIOC 5JRGA 3REKC 3W96B 1KX5D 3KXBA 1KX4A 1M18B 5AV8C 5JA4B 5B40C 5GSUD 3KUYA 1P3LD 5B1MA 5B31D 4ZUXB 1P3FC 5B2IC 1P3LB 4E44A 3REHA 5B31B 5B32A 3AZIA 5CPIA 3VH5A 3C1BA 1P3PB 5G49A 5GT0D 5CPKC 5AV5D 3UTBA 5B1LC 5GT0B 3AYWB 1A7WA 5AV5B 4WU8D 3W98C 3AN2D 3W99A 4KGCC 3AFAD 4Z2MH 3AZFD 3AZJD 3AZLC 3LELD 3LZ1D 3AZNB 4J8VC 5AY8A 4YM6B 4WU8B 3AN2B 3B6GC 3AFAB 3AZFB 4YS3A 3AZJB 3LELB 3LZ1B 4WZSB 5BNXB 4J8WD 5B2JC 1BFMA 3WTPE 4J8WB 5B0ZC 2F8NH 1P3PC 1HQ3C 4JJNA 1M19A 1P3KA 3AZGA 5B33A 1KU5A 3W99D 3AZNC 1BH9B 1JFIA 1P3MC 3MVDA 3AZHD 1Q9CA 3AV1D 5DNND 3RELC 3AZKC 4CSRA 3AZHB 1N1JB 1P3BA 4DRBA 4H9PA 4WNNB 3AZGD 5CP6A 5GXQA 2CV5B 4H9QA 3C1CA 4Z5TC 2LY8A 3WAAC 2HUEC 5DNMD 4XZQB 3LZ0B 4H9SC 4NE5A 5DNMB 3WKJD 3AZEA 3LJAB 3WKJB 1ZLAD 1P3OB 3WA9D 3REJC 4H9NB 5BT1D 1KX3A 3AZMB 5AVCD 1ZLAB 1P3ID 1TZYD 3KWQC 1F1EA 3MGSD 1P3GC 3WA9B 4KUDA 2CV5C 4WU9B 5AVCB 2BYMA 3A6NA 2RVQC 1TZYB 4EO5B 3MGSB 3UT9D 3MGRA 5E5AD 1P34C 1EQZB 4XZQC 3LZ0C 3UT9B 4HGAB 5E5AB 4QLCA 3X1SD 1ID3A 3O62A 4Z66D 5BNVA 5GT3A 3X1SB 2NQBC 3MNNA 1P3OC 4X23B 3B6FA 3W97B 3AZMC 4XUJC 1AOIC 1P3AC 3X1UC 3AV2D 2HIOA 2YFVB 1R4VA 4EO5C 3REKA
chains in the Genus database with same CATH superfamily
1HTAA 5AV8A 1EQZC 4UUZA 5AV6D 3UTAB 5B40A 3MGQB 5B0YD 4HGAC 3B0DC 5B32G 1P3FA 3WTPD 3EPLA 2Y2KA 5B2IA 5FUGB 5B0YB 2AROB 3MGPB 3WTPB 4X23C 4R8PB 1S32C 3F6TA 2XD5A 3B6FD 3KSYA 3X1VD 5CPKA 3VH6T 4NFTA 3REID 5B1LA 5B24C 3X1VB 4G92C 1M1AB 3REIB 2HIOD 3W98A 4KGCA 3TU4B 3AZLA 5C3IC 4J8VA 5AV8D 2PYOC 5BO0B 3B6GA 3EPJA 4LD9C 2Y2PA 4J8UC 4J8XD 1KX5B 4CAYB 5B2JA 1U35D 4J8XB 4R8PC 5GSUB 5B0ZA 1F66C 5AV9A 1P3PA 1HQ3A 1TAFB 2G5IC 5AVBC 4ZBJB 2FJ7C 2NZDD 5B1LD 5CPJC 2XD1A 3AZNA 2DF4C 5F99C 2NZDB 3W96C 3X1TD 2F2AC 1P3MA 5JRGD 1M18C 4KHAA 3B0BA 2UWXA 3KXBD 1KX4D 3B6GD 1KX5C 5JRGB 3RELA 3NQUA 4ZUXC 2Y2NA 3KXBB 5B1MD 3KUYD 3AZKA 1P3LC 2F8NA 5B31C 2JSSA 3KUYB 5B1MB 3VH5T 5AV9D 3REHD 5B32D 3AZID 4ZBJC 5CPID 3REHB 3C1BD 5B32B 3AZIB 5CPIB 4Z5TA 3UTBD 1BH8A 5GT0C 3WAAA 3AYWC 3C1BB 5AV5C 5G49B 1BH9A 3KFUG 3UTBB 2YFWA 4H9RA 1P3MD 4H9SA 4YM6C 4DQYB 4WU8C 3AN2C 3A1KA 5AY8D 3AFAC 3AZFC 3AZJC 3LELC 3LZ1C 3W99B 4YS3D 3RELD 5AY8B 3NQJA 3REJA 1B6WA 4J8WC 3AV1B 5DNNB 3KWQA 1P3GA 2BYKA 4JJND 1M19D 1P3KD 5B33D 4JJNB 3WAAD 1P3KB 3AZGB 1P34A 4XZQA 3LZ0A 5B33B 3MVDD 2NQBA 1P3OA 1JFIB 3REJD 3AZHC 3AZMA 4XUJA 3AV1C 5DNNC 1P3AA 1AOIA 1H3OA 3X1UA 3R45A 1P3BD 3KWQD 4CSRB 1P3BB 5CP6D 4H9PB 1EQZA 5GXQD 3C1CD 2ZY5A 1P3IB 5CP6B 5GXQB 2IO5B 2JCHA 4NE3A 4H9QB 3C1CB 5CHLB 5DNMC 4G91B 4E45A 4X23A 3LJAC 1S32A 3AZED 3WKJC 4XUJD 1AOID 4Z66B 3AZEB 5B24A 1KX3D 1ZLAC 3WA9C 5BS7C 5BT1C 4WU9C 5AVCC 4AWLB 4KUDD 1P3IC 1TZYC 3A6ND 3MGSC 2PYOA 3AV2B 4LD9A 4J8UA 3MGRD 2BYMB 5FUGA 3A6NB 3UT9C 5E5AC 3VH6W 5AV6B 3MGRB 2Y2QA 4QLCD 1F66A 1ID3D 4H9OA 2L5AA 3O62D 3X1SC 5GT3D 5AVBA 4QLCB 2RIQA 4Z66C 3MNND 3W97C 3O62B 2FJ7A 4Z2MG 5BNVB 5GT3B 3V9RA 5KDMA 5CPJA 3MNNB 3B6FB 3VH6A 5F99A 3W96A 3AV2C 3REKD 2PYOD 1M18A 5JA4A 3UTAC 1KX5A 3MGQC 2HIOB 3REKB 5B40D 2F8NG 4ZUXA 3H0RC 5AV6C 5AV8B 1P3LA 4UUZB 5B0YC 1P3FD 5B31A 5B40B 2AROC 5B2ID 3MGPC 3WTPC 1P3FB 1U35B 5B2IB 2Y2OA 2FJ7D 2G5HC 5CPKD 5GT0A 3B0CT 3AYWA 3X1VC 5AV5A 1M1AC 3REIC 1B67A 3TU4C 3W98D 4KGCD 5B1LB 4YM6A 4WU8A 3AZLD 3VH5W 3AN2A 4J8VD 3AFAA 3AZFA 3AZJA 3W98B 3LELA 3LZ1A 2Y2MA 4KGCB 5BNXA 4ZUXD 3X1TB 3AZLB 2F8NK 4J8VB 2CWEA 5B2JD 1KX4B 4J8XC 3B6GB 4J8WA 5GSUC 1U35C 5B0ZD 5B2JB 1P3PD 2DQNC 1HQ3D 1T3UA 5B0ZB 5AV9B 1HQ3B 3AYWD 2NZDC 3AZND 4YM6D 3X1TC 5JRGC 3KXBC 1P3MB 1KX4C 4KHAB 3AZHA 3AV1A 1N1JA 5DNNA 2Y2LA 3H0MC 3KUYC 3AZKD 5B1MC 2F8ND 3RELB 3NQUB 4YS3B 4WNNA 3AZKB 5AV9C 3REHC 2F8NB 2ZM5A 5B32C 3AZIC 2CV5A 5CPIC 4WJ3C 4Z5TD 3C1BC 3A1IA 2JE5A 1M19B 3UTBC 2Y2JA 4Z5TB 1BH8B 3WAAB 5DNMA 2HUEB 1W2EA 3W99C 4DRAA 3EPHA 2YFWB 3LJAA 4H9RB 5AY8C 3WKJA 3AL0C 4YS3C 4H9NA 3MVDB 1Z2CB 1ZLAA 3WA9A 4WV4B 5BS7A 3NQJB 3REJB 5AVCA 4WU9A 1P3GD 2FFFB 2CV5D 1P3IA 1TZYA 3MGSA 4JJNC 2RVQD 1P3KC 1M19C 3KWQB 3AZGC 1P3GB 2BYKB 2W8SA 5B33C 2ZY3A 1P34D 4XZQD 3UT9A 3LZ0D 5E5AA 1P34B 3X1SA 3LJAD 1WWIA 2NQBD 3MVDC 4Z66A 3W97A 3EG5B 1P3OD 3EPKA 3AZMD 1P3AD 2NQBB 4M6BA 3X1UD 2YFVA 4WU9D 4XUJB 1P3BC 1P3AB 3AV2A 1H3OB 1AOIB 3X1UB 3R45B 3UTAA 1KX3B 1EQZD 3MGQA 5CP6C 5GXQC 2IO5C 5B31G 5AV6A 4KUDB 3C1CC 2Y2GA 5B0YA 2AROA 2Y2IA 3MGPA 1WWSA 4G91C 3WTPA 4R8PA 3B0DB 4X23D 1S32D 3W97D 1ID3B 3AZEC 1S32B 3X1VA 5B24D 1M1AA 3REIA 2BG1A 3TU4A 4AWLC 1KX3C 5B24B 3UTAD 5BO0A 3MGQD 4G92B 4NE6A 4KUDC 3A6NC 4LD9D 4J8UD 4CAYA 5C3IB 2PYOB 3MGRC 2AROD 4J8XA 3MGPD 3B0CW 5GSUA 4J8UB 4LD9B 1U35A 4R8PD 1F66D 1TAFA 1ULYA 4QLCC 1ID3C 5AVBD 3O62C 1F66B 3P5JB 5GT3C 4H9OB 3MNNC 5AVBB 5CPJD 1M1AD 3B6FC 2NZDA 3TU4D 3H0LC 2FJ7B 5F99D 5CPKB 3V9RB 5KDMB 5CPJB 3W96D 1M18D 3X1TA 5F99B 2HIOC 5JRGA 3REKC 3W96B 1KX5D 3KXBA 1KX4A 1M18B 5AV8C 5JA4B 5B40C 5GSUD 3KUYA 1P3LD 5B1MA 5B31D 4ZUXB 1P3FC 5B2IC 1P3LB 4E44A 3REHA 5B31B 5B32A 3AZIA 5CPIA 3VH5A 3C1BA 1P3PB 5G49A 5GT0D 2J8PA 5CPKC 5AV5D 3UTBA 2ZY4A 5B1LC 5GT0B 3IP4C 3AYWB 1A7WA 5AV5B 4WU8D 3W98C 3AN2D 3W99A 4KGCC 3AFAD 4Z2MH 3AZFD 3AZJD 3AZLC 3LELD 3LZ1D 3AZNB 4J8VC 5AY8A 4YM6B 4WU8B 3AN2B 3B6GC 3AFAB 3AZFB 4YS3A 3AZJB 3LELB 3LZ1B 4WZSB 5BNXB 4J8WD 5B2JC 1BFMA 3WTPE 4J8WB 5B0ZC 2F8NH 1P3PC 1HQ3C 4JJNA 1M19A 1P3KA 3FDDA 3AZGA 5B33A 1KU5A 3W99D 3AZNC 1BH9B 1JFIA 1P3MC 3MVDA 3AZHD 1Q9CA 3AV1D 5DNND 3RELC 3AZKC 4CSRA 3AZHB 1N1JB 1P3BA 4DRBA 4H9PA 2ZY2A 4WNNB 3AZGD 5CP6A 5GXQA 2CV5B 4H9QA 3C1CA 4Z5TC 2LY8A 3WAAC 2HUEC 5DNMD 4XZQB 1PZRA 3LZ0B 4H9SC 4NE5A 5DNMB 3WKJD 3AZEA 3LJAB 3WKJB 1ZLAD 1P3OB 3WA9D 3REJC 4H9NB 5BT1D 1KX3A 3AZMB 5AVCD 1ZLAB 1P3ID 1TZYD 3KWQC 1F1EA 3MGSD 1P3GC 3WA9B 4KUDA 2CV5C 4WU9B 5AVCB 2BYMA 2Y2HA 3A6NA 2RVQC 1TZYB 4EO5B 3MGSB 3UT9D 3MGRA 5E5AD 1P34C 1EQZB 4XZQC 3LZ0C 3UT9B 4HGAB 5E5AB 4QLCA 3X1SD 1ID3A 3O62A 4Z66D 5BNVA 5GT3A 3X1SB 2NQBC 3MNNA 1P3OC 4X23B 4UPKA 3B6FA 3W97B 3AZMC 4XUJC 1AOIC 1P3AC 3X1UC 3AV2D 2VQRA 2HIOA 2YFVB 1R4VA 4EO5C 3REKA
chains in the Genus database with same CATH topology
1HTAA 5AV8A 1EQZC 4UUZA 5AV6D 3UTAB 5B40A 3MGQB 5B0YD 4HGAC 3B0DC 5B32G 1P3FA 3WTPD 3EPLA 2Y2KA 5B2IA 5FUGB 5B0YB 2AROB 3MGPB 3WTPB 4X23C 4R8PB 1S32C 3F6TA 2XD5A 3B6FD 3KSYA 3X1VD 5CPKA 3VH6T 4NFTA 3REID 5B1LA 5B24C 3X1VB 4G92C 1M1AB 3REIB 2HIOD 3W98A 4KGCA 3TU4B 3AZLA 5C3IC 4J8VA 5AV8D 2PYOC 5BO0B 3B6GA 3EPJA 4LD9C 2Y2PA 4J8UC 4J8XD 1KX5B 4CAYB 5B2JA 1U35D 4J8XB 4R8PC 5GSUB 5B0ZA 1F66C 5AV9A 1P3PA 1HQ3A 1TAFB 2G5IC 5AVBC 4ZBJB 2FJ7C 2NZDD 5B1LD 5CPJC 2XD1A 3AZNA 2DF4C 5F99C 2NZDB 3W96C 3X1TD 2F2AC 1P3MA 5JRGD 1M18C 4KHAA 3B0BA 2UWXA 3KXBD 1KX4D 3B6GD 1KX5C 5JRGB 3RELA 3NQUA 4ZUXC 2Y2NA 3KXBB 5B1MD 3KUYD 3AZKA 1P3LC 2F8NA 5B31C 2JSSA 3KUYB 5B1MB 3VH5T 5AV9D 3REHD 5B32D 3AZID 4ZBJC 5CPID 3REHB 3C1BD 5B32B 3AZIB 5CPIB 4Z5TA 3UTBD 1BH8A 5GT0C 3WAAA 3AYWC 3C1BB 5AV5C 5G49B 1BH9A 3KFUG 3UTBB 2YFWA 4H9RA 1P3MD 4H9SA 4YM6C 4DQYB 4WU8C 3AN2C 3A1KA 5AY8D 3AFAC 3AZFC 3AZJC 3LELC 3LZ1C 3W99B 4YS3D 3RELD 5AY8B 3NQJA 3REJA 1B6WA 4J8WC 3AV1B 5DNNB 3KWQA 1P3GA 2BYKA 4JJND 1M19D 1P3KD 5B33D 4JJNB 3WAAD 1P3KB 3AZGB 1P34A 4XZQA 3LZ0A 5B33B 3MVDD 2NQBA 1P3OA 1JFIB 3REJD 3AZHC 3AZMA 4XUJA 3AV1C 5DNNC 1P3AA 1AOIA 1H3OA 3X1UA 3R45A 1P3BD 3KWQD 4CSRB 1P3BB 5CP6D 4H9PB 1EQZA 5GXQD 3C1CD 2ZY5A 1P3IB 5CP6B 5GXQB 2IO5B 2JCHA 4NE3A 4H9QB 3C1CB 5CHLB 5DNMC 4G91B 4E45A 4X23A 3LJAC 1S32A 3AZED 3WKJC 4XUJD 1AOID 4Z66B 3AZEB 5B24A 1KX3D 1ZLAC 3WA9C 5BS7C 5BT1C 4WU9C 5AVCC 4AWLB 4KUDD 1P3IC 1TZYC 3A6ND 3MGSC 2PYOA 3AV2B 4LD9A 4J8UA 3MGRD 2BYMB 5FUGA 3A6NB 3UT9C 5E5AC 3VH6W 5AV6B 3MGRB 2Y2QA 4QLCD 1F66A 1ID3D 4H9OA 2L5AA 3O62D 3X1SC 5GT3D 5AVBA 4QLCB 2RIQA 4Z66C 3MNND 3W97C 3O62B 2FJ7A 4Z2MG 5BNVB 5GT3B 3V9RA 5KDMA 5CPJA 3MNNB 3B6FB 3VH6A 5F99A 3W96A 3AV2C 3REKD 2PYOD 1M18A 5JA4A 3UTAC 1KX5A 3MGQC 2HIOB 3REKB 5B40D 2F8NG 4ZUXA 3H0RC 5AV6C 5AV8B 1P3LA 4UUZB 5B0YC 1P3FD 5B31A 5B40B 2AROC 5B2ID 3MGPC 3WTPC 1P3FB 1U35B 5B2IB 2Y2OA 2FJ7D 2G5HC 5CPKD 5GT0A 3B0CT 3AYWA 3X1VC 5AV5A 1M1AC 3REIC 1B67A 3TU4C 3W98D 4KGCD 5B1LB 4YM6A 4WU8A 3AZLD 3VH5W 3AN2A 4J8VD 3AFAA 3AZFA 3AZJA 3W98B 3LELA 3LZ1A 2Y2MA 4KGCB 5BNXA 4ZUXD 3X1TB 3AZLB 2F8NK 4J8VB 2CWEA 5B2JD 1KX4B 4J8XC 3B6GB 4J8WA 5GSUC 1U35C 5B0ZD 5B2JB 1P3PD 2DQNC 1HQ3D 1T3UA 5B0ZB 5AV9B 1HQ3B 3AYWD 2NZDC 3AZND 4YM6D 3X1TC 5JRGC 3KXBC 1P3MB 1KX4C 4KHAB 3AZHA 3AV1A 1N1JA 5DNNA 2Y2LA 3H0MC 3KUYC 3AZKD 5B1MC 2F8ND 3RELB 3NQUB 4YS3B 4WNNA 3AZKB 5AV9C 3REHC 2F8NB 2ZM5A 5B32C 3AZIC 2CV5A 5CPIC 4WJ3C 4Z5TD 3C1BC 3A1IA 2JE5A 1M19B 3UTBC 2Y2JA 4Z5TB 1BH8B 3WAAB 5DNMA 2HUEB 1W2EA 3W99C 4DRAA 3EPHA 2YFWB 3LJAA 4H9RB 5AY8C 3WKJA 3AL0C 4YS3C 4H9NA 3MVDB 1Z2CB 1ZLAA 3WA9A 4WV4B 5BS7A 3NQJB 3REJB 5AVCA 4WU9A 1P3GD 2FFFB 2CV5D 1P3IA 1TZYA 3MGSA 4JJNC 2RVQD 1P3KC 1M19C 3KWQB 3AZGC 1P3GB 2BYKB 2W8SA 5B33C 2ZY3A 1P34D 4XZQD 3UT9A 3LZ0D 5E5AA 1P34B 3X1SA 3LJAD 1WWIA 2NQBD 3MVDC 4Z66A 3W97A 3EG5B 1P3OD 3EPKA 3AZMD 1P3AD 2NQBB 4M6BA 3X1UD 2YFVA 4WU9D 4XUJB 1P3BC 1P3AB 3AV2A 1H3OB 1AOIB 3X1UB 3R45B 3UTAA 1KX3B 1EQZD 3MGQA 5CP6C 5GXQC 2IO5C 5B31G 5AV6A 4KUDB 3C1CC 2Y2GA 5B0YA 2AROA 2Y2IA 3MGPA 1WWSA 4G91C 3WTPA 4R8PA 3B0DB 4X23D 1S32D 3W97D 1ID3B 3AZEC 1S32B 3X1VA 5B24D 1M1AA 3REIA 2BG1A 3TU4A 4AWLC 1KX3C 5B24B 3UTAD 5BO0A 3MGQD 4G92B 4NE6A 4KUDC 3A6NC 4LD9D 4J8UD 4CAYA 5C3IB 2PYOB 3MGRC 2AROD 4J8XA 3MGPD 3B0CW 5GSUA 4J8UB 4LD9B 1U35A 4R8PD 1F66D 1TAFA 1ULYA 4QLCC 1ID3C 5AVBD 3O62C 1F66B 3P5JB 5GT3C 4H9OB 3MNNC 5AVBB 5CPJD 1M1AD 3B6FC 2NZDA 3TU4D 3H0LC 2FJ7B 5F99D 5CPKB 3V9RB 5KDMB 5CPJB 3W96D 1M18D 3X1TA 5F99B 2HIOC 5JRGA 3REKC 3W96B 1KX5D 3KXBA 1KX4A 1M18B 5AV8C 5JA4B 5B40C 5GSUD 3KUYA 1P3LD 5B1MA 5B31D 4ZUXB 1P3FC 5B2IC 1P3LB 4E44A 3REHA 5B31B 5B32A 3AZIA 5CPIA 3VH5A 3C1BA 1P3PB 5G49A 5GT0D 2J8PA 5CPKC 5AV5D 3UTBA 2ZY4A 5B1LC 5GT0B 3IP4C 3AYWB 1A7WA 5AV5B 4WU8D 3W98C 3AN2D 3W99A 4KGCC 3AFAD 4Z2MH 3AZFD 3AZJD 3AZLC 3LELD 3LZ1D 3AZNB 4J8VC 5AY8A 4YM6B 4WU8B 3AN2B 3B6GC 3AFAB 3AZFB 4YS3A 3AZJB 3LELB 3LZ1B 4WZSB 5BNXB 4J8WD 5B2JC 1BFMA 3WTPE 4J8WB 5B0ZC 2F8NH 1P3PC 1HQ3C 4JJNA 1M19A 1P3KA 3FDDA 3AZGA 5B33A 1KU5A 3W99D 3AZNC 1BH9B 1JFIA 1P3MC 3MVDA 3AZHD 1Q9CA 3AV1D 5DNND 3RELC 3AZKC 4CSRA 3AZHB 1N1JB 1P3BA 4DRBA 4H9PA 2ZY2A 4WNNB 3AZGD 5CP6A 5GXQA 2CV5B 4H9QA 3C1CA 4Z5TC 2LY8A 3WAAC 2HUEC 5DNMD 4XZQB 1PZRA 3LZ0B 4H9SC 4NE5A 5DNMB 3WKJD 3AZEA 3LJAB 3WKJB 1ZLAD 1P3OB 3WA9D 3REJC 4H9NB 5BT1D 1KX3A 3AZMB 5AVCD 1ZLAB 1P3ID 1TZYD 3KWQC 1F1EA 3MGSD 1P3GC 3WA9B 4KUDA 2CV5C 4WU9B 5AVCB 2BYMA 2Y2HA 3A6NA 2RVQC 1TZYB 4EO5B 3MGSB 3UT9D 3MGRA 5E5AD 1P34C 1EQZB 4XZQC 3LZ0C 3UT9B 4HGAB 5E5AB 4QLCA 3X1SD 1ID3A 3O62A 4Z66D 5BNVA 5GT3A 3X1SB 2NQBC 3MNNA 1P3OC 4X23B 4UPKA 3B6FA 3W97B 3AZMC 4XUJC 1AOIC 1P3AC 3X1UC 3AV2D 2VQRA 2HIOA 2YFVB 1R4VA 4EO5C 3REKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTA A;  5AV8 A;  1EQZ C;  4UUZ A;  5AV6 D;  3UTA B;  5B40 A;  3MGQ B;  5B0Y D;  4HGA C;  3B0D C;  5B32 G;  1P3F A;  3WTP D;  5B2I A;  5FUG B;  5B0Y B;  2ARO B;  3MGP B;  3WTP B;  4X23 C;  4R8P B;  1S32 C;  3B6F D;  3KSY A;  3X1V D;  5CPK A;  3VH6 T;  4NFT A;  3REI D;  5B1L A;  5B24 C;  3X1V B;  4G92 C;  1M1A B;  3REI B;  2HIO D;  3W98 A;  4KGC A;  3TU4 B;  3AZL A;  5C3I C;  4J8V A;  5AV8 D;  2PYO C;  5BO0 B;  3B6G A;  4LD9 C;  4J8U C;  4J8X D;  1KX5 B;  4CAY B;  5B2J A;  1U35 D;  4J8X B;  4R8P C;  5GSU B;  5B0Z A;  1F66 C;  5AV9 A;  1P3P A;  1HQ3 A;  1TAF B;  5AVB C;  4ZBJ B;  2FJ7 C;  2NZD D;  5B1L D;  5CPJ C;  3AZN A;  5F99 C;  2NZD B;  3W96 C;  3X1T D;  1P3M A;  5JRG D;  1M18 C;  4KHA A;  3B0B A;  3KXB D;  1KX4 D;  3B6G D;  1KX5 C;  5JRG B;  3REL A;  3NQU A;  4ZUX C;  3KUY D;  3KXB B;  5B1M D;  3AZK A;  1P3L C;  2F8N A;  5B31 C;  2JSS A;  3KUY B;  5B1M B;  3VH5 T;  5AV9 D;  3REH D;  5B32 D;  3AZI D;  4ZBJ C;  5CPI D;  3REH B;  3C1B D;  5B32 B;  3AZI B;  5CPI B;  4Z5T A;  3UTB D;  1BH8 A;  5GT0 C;  3WAA A;  3AYW C;  3C1B B;  5AV5 C;  5G49 B;  1BH9 A;  3UTB B;  2YFW A;  4H9R A;  1P3M D;  4H9S A;  4YM6 C;  4WU8 C;  3AN2 C;  5AY8 D;  3AFA C;  3AZF C;  3AZJ C;  3LEL C;  3LZ1 C;  3W99 B;  4YS3 D;  3REL D;  5AY8 B;  3NQJ A;  3REJ A;  1B6W A;  4J8W C;  3AV1 B;  5DNN B;  3KWQ A;  1P3G A;  2BYK A;  4JJN D;  1M19 D;  1P3K D;  5B33 D;  4JJN B;  3WAA D;  1P3K B;  3AZG B;  1P34 A;  4XZQ A;  3LZ0 A;  5B33 B;  3MVD D;  2NQB A;  1P3O A;  1JFI B;  3REJ D;  3AZH C;  3AZM A;  4XUJ A;  3AV1 C;  5DNN C;  1P3A A;  1AOI A;  1H3O A;  3X1U A;  3R45 A;  1P3B D;  3KWQ D;  4CSR B;  1P3B B;  5CP6 D;  4H9P B;  1EQZ A;  5GXQ D;  3C1C D;  1P3I B;  5CP6 B;  5GXQ B;  2IO5 B;  4NE3 A;  4H9Q B;  3C1C B;  5CHL B;  5DNM C;  4G91 B;  4E45 A;  4X23 A;  3LJA C;  1S32 A;  3AZE D;  3WKJ C;  4XUJ D;  1AOI D;  4Z66 B;  3AZE B;  5B24 A;  1KX3 D;  1ZLA C;  3WA9 C;  5BS7 C;  5BT1 C;  4WU9 C;  5AVC C;  4AWL B;  4KUD D;  1P3I C;  1TZY C;  3A6N D;  3MGS C;  2PYO A;  3AV2 B;  4LD9 A;  4J8U A;  3MGR D;  2BYM B;  5FUG A;  3A6N B;  3UT9 C;  5E5A C;  3VH6 W;  5AV6 B;  3MGR B;  4QLC D;  1F66 A;  1ID3 D;  4H9O A;  2L5A A;  3O62 D;  3X1S C;  5GT3 D;  5AVB A;  4QLC B;  3MNN D;  4Z66 C;  3W97 C;  3O62 B;  2FJ7 A;  4Z2M G;  5BNV B;  5GT3 B;  3V9R A;  5KDM A;  5CPJ A;  3MNN B;  3B6F B;  3VH6 A;  5F99 A;  3W96 A;  3AV2 C;  3REK D;  2PYO D;  1M18 A;  5JA4 A;  3UTA C;  1KX5 A;  3MGQ C;  2HIO B;  3REK B;  5B40 D;  2F8N G;  4ZUX A;  5AV6 C;  5AV8 B;  1P3L A;  4UUZ B;  5B0Y C;  1P3F D;  5B31 A;  5B40 B;  2ARO C;  5B2I D;  3MGP C;  3WTP C;  1P3F B;  1U35 B;  5B2I B;  2FJ7 D;  5CPK D;  5GT0 A;  3B0C T;  3AYW A;  3X1V C;  5AV5 A;  1M1A C;  3REI C;  1B67 A;  3TU4 C;  3W98 D;  4KGC D;  5B1L B;  4YM6 A;  4WU8 A;  3AZL D;  3VH5 W;  3AN2 A;  4J8V D;  3AFA A;  3AZF A;  3AZJ A;  3W98 B;  3LEL A;  3LZ1 A;  4KGC B;  5BNX A;  4ZUX D;  3X1T B;  3AZL B;  2F8N K;  4J8V B;  2CWE A;  5B2J D;  1KX4 B;  4J8X C;  3B6G B;  4J8W A;  5GSU C;  1U35 C;  5B0Z D;  5B2J B;  1P3P D;  1HQ3 D;  5B0Z B;  5AV9 B;  1HQ3 B;  3AYW D;  2NZD C;  3AZN D;  4YM6 D;  3X1T C;  5JRG C;  3KXB C;  1P3M B;  1KX4 C;  4KHA B;  3AZH A;  3AV1 A;  1N1J A;  5DNN A;  3KUY C;  3AZK D;  5B1M C;  2F8N D;  3REL B;  3NQU B;  4YS3 B;  4WNN A;  3AZK B;  5AV9 C;  3REH C;  2F8N B;  5B32 C;  3AZI C;  2CV5 A;  5CPI C;  4Z5T D;  3C1B C;  1M19 B;  3UTB C;  4Z5T B;  1BH8 B;  3WAA B;  5DNM A;  2HUE B;  3W99 C;  4DRA A;  2YFW B;  3LJA A;  4H9R B;  5AY8 C;  3WKJ A;  4YS3 C;  4H9N A;  3MVD B;  1ZLA A;  3WA9 A;  4WV4 B;  5BS7 A;  3NQJ B;  3REJ B;  5AVC A;  4WU9 A;  1P3G D;  2CV5 D;  1P3I A;  1TZY A;  3MGS A;  4JJN C;  2RVQ D;  1P3K C;  1M19 C;  3KWQ B;  3AZG C;  1P3G B;  2BYK B;  5B33 C;  1P34 D;  4XZQ D;  3UT9 A;  3LZ0 D;  5E5A A;  1P34 B;  3X1S A;  3LJA D;  1WWI A;  2NQB D;  3MVD C;  4Z66 A;  3W97 A;  1P3O D;  3AZM D;  1P3A D;  2NQB B;  4M6B A;  3X1U D;  2YFV A;  4WU9 D;  4XUJ B;  1P3B C;  1P3A B;  3AV2 A;  1H3O B;  1AOI B;  3X1U B;  3R45 B;  3UTA A;  1KX3 B;  1EQZ D;  3MGQ A;  5CP6 C;  5GXQ C;  2IO5 C;  5B31 G;  5AV6 A;  4KUD B;  3C1C C;  5B0Y A;  2ARO A;  3MGP A;  1WWS A;  4G91 C;  3WTP A;  4R8P A;  3B0D B;  4X23 D;  1S32 D;  3W97 D;  1ID3 B;  3AZE C;  1S32 B;  3X1V A;  5B24 D;  1M1A A;  3REI A;  3TU4 A;  4AWL C;  1KX3 C;  5B24 B;  3UTA D;  5BO0 A;  3MGQ D;  4G92 B;  4NE6 A;  4KUD C;  3A6N C;  4LD9 D;  4J8U D;  4CAY A;  5C3I B;  2PYO B;  3MGR C;  2ARO D;  4J8X A;  3MGP D;  3B0C W;  5GSU A;  4J8U B;  4LD9 B;  1U35 A;  4R8P D;  1F66 D;  1TAF A;  1ULY A;  4QLC C;  1ID3 C;  5AVB D;  3O62 C;  1F66 B;  5GT3 C;  4H9O B;  3MNN C;  5AVB B;  5CPJ D;  1M1A D;  3B6F C;  2NZD A;  3TU4 D;  2FJ7 B;  5F99 D;  5CPK B;  3V9R B;  5KDM B;  5CPJ B;  3W96 D;  1M18 D;  3X1T A;  5F99 B;  2HIO C;  5JRG A;  3REK C;  3W96 B;  1KX5 D;  3KXB A;  1KX4 A;  1M18 B;  5AV8 C;  5JA4 B;  5B40 C;  5GSU D;  3KUY A;  1P3L D;  5B1M A;  5B31 D;  4ZUX B;  1P3F C;  5B2I C;  1P3L B;  4E44 A;  3REH A;  5B31 B;  5B32 A;  3AZI A;  5CPI A;  3VH5 A;  3C1B A;  1P3P B;  5G49 A;  5GT0 D;  5CPK C;  5AV5 D;  3UTB A;  5B1L C;  5GT0 B;  3AYW B;  1A7W A;  5AV5 B;  4WU8 D;  3W98 C;  3AN2 D;  3W99 A;  4KGC C;  3AFA D;  4Z2M H;  3AZF D;  3AZJ D;  3AZL C;  3LEL D;  3LZ1 D;  3AZN B;  4J8V C;  5AY8 A;  4YM6 B;  4WU8 B;  3AN2 B;  3B6G C;  3AFA B;  3AZF B;  4YS3 A;  3AZJ B;  3LEL B;  3LZ1 B;  4WZS B;  5BNX B;  4J8W D;  5B2J C;  1BFM A;  3WTP E;  4J8W B;  5B0Z C;  2F8N H;  1P3P C;  1HQ3 C;  4JJN A;  1M19 A;  1P3K A;  3AZG A;  5B33 A;  1KU5 A;  3W99 D;  3AZN C;  1BH9 B;  1JFI A;  1P3M C;  3MVD A;  3AZH D;  1Q9C A;  3AV1 D;  5DNN D;  3REL C;  3AZK C;  4CSR A;  3AZH B;  1N1J B;  1P3B A;  4DRB A;  4H9P A;  4WNN B;  3AZG D;  5CP6 A;  5GXQ A;  2CV5 B;  4H9Q A;  3C1C A;  4Z5T C;  2LY8 A;  3WAA C;  2HUE C;  5DNM D;  4XZQ B;  3LZ0 B;  4H9S C;  4NE5 A;  5DNM B;  3WKJ D;  3AZE A;  3LJA B;  3WKJ B;  1ZLA D;  1P3O B;  3WA9 D;  3REJ C;  4H9N B;  5BT1 D;  1KX3 A;  3AZM B;  5AVC D;  1ZLA B;  1P3I D;  1TZY D;  3KWQ C;  1F1E A;  3MGS D;  1P3G C;  3WA9 B;  4KUD A;  2CV5 C;  4WU9 B;  5AVC B;  2BYM A;  3A6N A;  2RVQ C;  1TZY B;  4EO5 B;  3MGS B;  3UT9 D;  3MGR A;  5E5A D;  1P34 C;  1EQZ B;  4XZQ C;  3LZ0 C;  3UT9 B;  4HGA B;  5E5A B;  4QLC A;  3X1S D;  1ID3 A;  3O62 A;  4Z66 D;  5BNV A;  5GT3 A;  3X1S B;  2NQB C;  3MNN A;  1P3O C;  4X23 B;  3B6F A;  3W97 B;  3AZM C;  4XUJ C;  1AOI C;  1P3A C;  3X1U C;  3AV2 D;  2HIO A;  2YFV B;  1R4V A;  4EO5 C;  3REK A; 
#chains in the Genus database with same CATH topology
 1HTA A;  5AV8 A;  1EQZ C;  4UUZ A;  5AV6 D;  3UTA B;  5B40 A;  3MGQ B;  5B0Y D;  4HGA C;  3B0D C;  5B32 G;  1P3F A;  3WTP D;  3EPL A;  2Y2K A;  5B2I A;  5FUG B;  5B0Y B;  2ARO B;  3MGP B;  3WTP B;  4X23 C;  4R8P B;  1S32 C;  3F6T A;  2XD5 A;  3B6F D;  3KSY A;  3X1V D;  5CPK A;  3VH6 T;  4NFT A;  3REI D;  5B1L A;  5B24 C;  3X1V B;  4G92 C;  1M1A B;  3REI B;  2HIO D;  3W98 A;  4KGC A;  3TU4 B;  3AZL A;  5C3I C;  4J8V A;  5AV8 D;  2PYO C;  5BO0 B;  3B6G A;  3EPJ A;  4LD9 C;  2Y2P A;  4J8U C;  4J8X D;  1KX5 B;  4CAY B;  5B2J A;  1U35 D;  4J8X B;  4R8P C;  5GSU B;  5B0Z A;  1F66 C;  5AV9 A;  1P3P A;  1HQ3 A;  1TAF B;  2G5I C;  5AVB C;  4ZBJ B;  2FJ7 C;  2NZD D;  5B1L D;  5CPJ C;  2XD1 A;  3AZN A;  2DF4 C;  5F99 C;  2NZD B;  3W96 C;  3X1T D;  2F2A C;  1P3M A;  5JRG D;  1M18 C;  4KHA A;  3B0B A;  2UWX A;  3KXB D;  1KX4 D;  3B6G D;  1KX5 C;  5JRG B;  3REL A;  3NQU A;  4ZUX C;  2Y2N A;  3KXB B;  5B1M D;  3KUY D;  3AZK A;  1P3L C;  2F8N A;  5B31 C;  2JSS A;  3KUY B;  5B1M B;  3VH5 T;  5AV9 D;  3REH D;  5B32 D;  3AZI D;  4ZBJ C;  5CPI D;  3REH B;  3C1B D;  5B32 B;  3AZI B;  5CPI B;  4Z5T A;  3UTB D;  1BH8 A;  5GT0 C;  3WAA A;  3AYW C;  3C1B B;  5AV5 C;  5G49 B;  1BH9 A;  3KFU G;  3UTB B;  2YFW A;  4H9R A;  1P3M D;  4H9S A;  4YM6 C;  4DQY B;  4WU8 C;  3AN2 C;  3A1K A;  5AY8 D;  3AFA C;  3AZF C;  3AZJ C;  3LEL C;  3LZ1 C;  3W99 B;  4YS3 D;  3REL D;  5AY8 B;  3NQJ A;  3REJ A;  1B6W A;  4J8W C;  3AV1 B;  5DNN B;  3KWQ A;  1P3G A;  2BYK A;  4JJN D;  1M19 D;  1P3K D;  5B33 D;  4JJN B;  3WAA D;  1P3K B;  3AZG B;  1P34 A;  4XZQ A;  3LZ0 A;  5B33 B;  3MVD D;  2NQB A;  1P3O A;  1JFI B;  3REJ D;  3AZH C;  3AZM A;  4XUJ A;  3AV1 C;  5DNN C;  1P3A A;  1AOI A;  1H3O A;  3X1U A;  3R45 A;  1P3B D;  3KWQ D;  4CSR B;  1P3B B;  5CP6 D;  4H9P B;  1EQZ A;  5GXQ D;  3C1C D;  2ZY5 A;  1P3I B;  5CP6 B;  5GXQ B;  2IO5 B;  2JCH A;  4NE3 A;  4H9Q B;  3C1C B;  5CHL B;  5DNM C;  4G91 B;  4E45 A;  4X23 A;  3LJA C;  1S32 A;  3AZE D;  3WKJ C;  4XUJ D;  1AOI D;  4Z66 B;  3AZE B;  5B24 A;  1KX3 D;  1ZLA C;  3WA9 C;  5BS7 C;  5BT1 C;  4WU9 C;  5AVC C;  4AWL B;  4KUD D;  1P3I C;  1TZY C;  3A6N D;  3MGS C;  2PYO A;  3AV2 B;  4LD9 A;  4J8U A;  3MGR D;  2BYM B;  5FUG A;  3A6N B;  3UT9 C;  5E5A C;  3VH6 W;  5AV6 B;  3MGR B;  2Y2Q A;  4QLC D;  1F66 A;  1ID3 D;  4H9O A;  2L5A A;  3O62 D;  3X1S C;  5GT3 D;  5AVB A;  4QLC B;  2RIQ A;  4Z66 C;  3MNN D;  3W97 C;  3O62 B;  2FJ7 A;  4Z2M G;  5BNV B;  5GT3 B;  3V9R A;  5KDM A;  5CPJ A;  3MNN B;  3B6F B;  3VH6 A;  5F99 A;  3W96 A;  3AV2 C;  3REK D;  2PYO D;  1M18 A;  5JA4 A;  3UTA C;  1KX5 A;  3MGQ C;  2HIO B;  3REK B;  5B40 D;  2F8N G;  4ZUX A;  3H0R C;  5AV6 C;  5AV8 B;  1P3L A;  4UUZ B;  5B0Y C;  1P3F D;  5B31 A;  5B40 B;  2ARO C;  5B2I D;  3MGP C;  3WTP C;  1P3F B;  1U35 B;  5B2I B;  2Y2O A;  2FJ7 D;  2G5H C;  5CPK D;  5GT0 A;  3B0C T;  3AYW A;  3X1V C;  5AV5 A;  1M1A C;  3REI C;  1B67 A;  3TU4 C;  3W98 D;  4KGC D;  5B1L B;  4YM6 A;  4WU8 A;  3AZL D;  3VH5 W;  3AN2 A;  4J8V D;  3AFA A;  3AZF A;  3AZJ A;  3W98 B;  3LEL A;  3LZ1 A;  2Y2M A;  4KGC B;  5BNX A;  4ZUX D;  3X1T B;  3AZL B;  2F8N K;  4J8V B;  2CWE A;  5B2J D;  1KX4 B;  4J8X C;  3B6G B;  4J8W A;  5GSU C;  1U35 C;  5B0Z D;  5B2J B;  1P3P D;  2DQN C;  1HQ3 D;  1T3U A;  5B0Z B;  5AV9 B;  1HQ3 B;  3AYW D;  2NZD C;  3AZN D;  4YM6 D;  3X1T C;  5JRG C;  3KXB C;  1P3M B;  1KX4 C;  4KHA B;  3AZH A;  3AV1 A;  1N1J A;  5DNN A;  2Y2L A;  3H0M C;  3KUY C;  3AZK D;  5B1M C;  2F8N D;  3REL B;  3NQU B;  4YS3 B;  4WNN A;  3AZK B;  5AV9 C;  3REH C;  2F8N B;  2ZM5 A;  5B32 C;  3AZI C;  2CV5 A;  5CPI C;  4WJ3 C;  4Z5T D;  3C1B C;  3A1I A;  2JE5 A;  1M19 B;  3UTB C;  2Y2J A;  4Z5T B;  1BH8 B;  3WAA B;  5DNM A;  2HUE B;  1W2E A;  3W99 C;  4DRA A;  3EPH A;  2YFW B;  3LJA A;  4H9R B;  5AY8 C;  3WKJ A;  3AL0 C;  4YS3 C;  4H9N A;  3MVD B;  1Z2C B;  1ZLA A;  3WA9 A;  4WV4 B;  5BS7 A;  3NQJ B;  3REJ B;  5AVC A;  4WU9 A;  1P3G D;  2FFF B;  2CV5 D;  1P3I A;  1TZY A;  3MGS A;  4JJN C;  2RVQ D;  1P3K C;  1M19 C;  3KWQ B;  3AZG C;  1P3G B;  2BYK B;  2W8S A;  5B33 C;  2ZY3 A;  1P34 D;  4XZQ D;  3UT9 A;  3LZ0 D;  5E5A A;  1P34 B;  3X1S A;  3LJA D;  1WWI A;  2NQB D;  3MVD C;  4Z66 A;  3W97 A;  3EG5 B;  1P3O D;  3EPK A;  3AZM D;  1P3A D;  2NQB B;  4M6B A;  3X1U D;  2YFV A;  4WU9 D;  4XUJ B;  1P3B C;  1P3A B;  3AV2 A;  1H3O B;  1AOI B;  3X1U B;  3R45 B;  3UTA A;  1KX3 B;  1EQZ D;  3MGQ A;  5CP6 C;  5GXQ C;  2IO5 C;  5B31 G;  5AV6 A;  4KUD B;  3C1C C;  2Y2G A;  5B0Y A;  2ARO A;  2Y2I A;  3MGP A;  1WWS A;  4G91 C;  3WTP A;  4R8P A;  3B0D B;  4X23 D;  1S32 D;  3W97 D;  1ID3 B;  3AZE C;  1S32 B;  3X1V A;  5B24 D;  1M1A A;  3REI A;  2BG1 A;  3TU4 A;  4AWL C;  1KX3 C;  5B24 B;  3UTA D;  5BO0 A;  3MGQ D;  4G92 B;  4NE6 A;  4KUD C;  3A6N C;  4LD9 D;  4J8U D;  4CAY A;  5C3I B;  2PYO B;  3MGR C;  2ARO D;  4J8X A;  3MGP D;  3B0C W;  5GSU A;  4J8U B;  4LD9 B;  1U35 A;  4R8P D;  1F66 D;  1TAF A;  1ULY A;  4QLC C;  1ID3 C;  5AVB D;  3O62 C;  1F66 B;  3P5J B;  5GT3 C;  4H9O B;  3MNN C;  5AVB B;  5CPJ D;  1M1A D;  3B6F C;  2NZD A;  3TU4 D;  3H0L C;  2FJ7 B;  5F99 D;  5CPK B;  3V9R B;  5KDM B;  5CPJ B;  3W96 D;  1M18 D;  3X1T A;  5F99 B;  2HIO C;  5JRG A;  3REK C;  3W96 B;  1KX5 D;  3KXB A;  1KX4 A;  1M18 B;  5AV8 C;  5JA4 B;  5B40 C;  5GSU D;  3KUY A;  1P3L D;  5B1M A;  5B31 D;  4ZUX B;  1P3F C;  5B2I C;  1P3L B;  4E44 A;  3REH A;  5B31 B;  5B32 A;  3AZI A;  5CPI A;  3VH5 A;  3C1B A;  1P3P B;  5G49 A;  5GT0 D;  2J8P A;  5CPK C;  5AV5 D;  3UTB A;  2ZY4 A;  5B1L C;  5GT0 B;  3IP4 C;  3AYW B;  1A7W A;  5AV5 B;  4WU8 D;  3W98 C;  3AN2 D;  3W99 A;  4KGC C;  3AFA D;  4Z2M H;  3AZF D;  3AZJ D;  3AZL C;  3LEL D;  3LZ1 D;  3AZN B;  4J8V C;  5AY8 A;  4YM6 B;  4WU8 B;  3AN2 B;  3B6G C;  3AFA B;  3AZF B;  4YS3 A;  3AZJ B;  3LEL B;  3LZ1 B;  4WZS B;  5BNX B;  4J8W D;  5B2J C;  1BFM A;  3WTP E;  4J8W B;  5B0Z C;  2F8N H;  1P3P C;  1HQ3 C;  4JJN A;  1M19 A;  1P3K A;  3FDD A;  3AZG A;  5B33 A;  1KU5 A;  3W99 D;  3AZN C;  1BH9 B;  1JFI A;  1P3M C;  3MVD A;  3AZH D;  1Q9C A;  3AV1 D;  5DNN D;  3REL C;  3AZK C;  4CSR A;  3AZH B;  1N1J B;  1P3B A;  4DRB A;  4H9P A;  2ZY2 A;  4WNN B;  3AZG D;  5CP6 A;  5GXQ A;  2CV5 B;  4H9Q A;  3C1C A;  4Z5T C;  2LY8 A;  3WAA C;  2HUE C;  5DNM D;  4XZQ B;  1PZR A;  3LZ0 B;  4H9S C;  4NE5 A;  5DNM B;  3WKJ D;  3AZE A;  3LJA B;  3WKJ B;  1ZLA D;  1P3O B;  3WA9 D;  3REJ C;  4H9N B;  5BT1 D;  1KX3 A;  3AZM B;  5AVC D;  1ZLA B;  1P3I D;  1TZY D;  3KWQ C;  1F1E A;  3MGS D;  1P3G C;  3WA9 B;  4KUD A;  2CV5 C;  4WU9 B;  5AVC B;  2BYM A;  2Y2H A;  3A6N A;  2RVQ C;  1TZY B;  4EO5 B;  3MGS B;  3UT9 D;  3MGR A;  5E5A D;  1P34 C;  1EQZ B;  4XZQ C;  3LZ0 C;  3UT9 B;  4HGA B;  5E5A B;  4QLC A;  3X1S D;  1ID3 A;  3O62 A;  4Z66 D;  5BNV A;  5GT3 A;  3X1S B;  2NQB C;  3MNN A;  1P3O C;  4X23 B;  4UPK A;  3B6F A;  3W97 B;  3AZM C;  4XUJ C;  1AOI C;  1P3A C;  3X1U C;  3AV2 D;  2VQR A;  2HIO A;  2YFV B;  1R4V A;  4EO5 C;  3REK A; 
#chains in the Genus database with same CATH homology
 1HTA A;  5AV8 A;  1EQZ C;  4UUZ A;  5AV6 D;  3UTA B;  5B40 A;  3MGQ B;  5B0Y D;  4HGA C;  3B0D C;  5B32 G;  1P3F A;  3WTP D;  3EPL A;  2Y2K A;  5B2I A;  5FUG B;  5B0Y B;  2ARO B;  3MGP B;  3WTP B;  4X23 C;  4R8P B;  1S32 C;  3F6T A;  2XD5 A;  3B6F D;  3KSY A;  3X1V D;  5CPK A;  3VH6 T;  4NFT A;  3REI D;  5B1L A;  5B24 C;  3X1V B;  4G92 C;  1M1A B;  3REI B;  2HIO D;  3W98 A;  4KGC A;  3TU4 B;  3AZL A;  5C3I C;  4J8V A;  5AV8 D;  2PYO C;  5BO0 B;  3B6G A;  3EPJ A;  4LD9 C;  2Y2P A;  4J8U C;  4J8X D;  1KX5 B;  4CAY B;  5B2J A;  1U35 D;  4J8X B;  4R8P C;  5GSU B;  5B0Z A;  1F66 C;  5AV9 A;  1P3P A;  1HQ3 A;  1TAF B;  2G5I C;  5AVB C;  4ZBJ B;  2FJ7 C;  2NZD D;  5B1L D;  5CPJ C;  2XD1 A;  3AZN A;  2DF4 C;  5F99 C;  2NZD B;  3W96 C;  3X1T D;  2F2A C;  1P3M A;  5JRG D;  1M18 C;  4KHA A;  3B0B A;  2UWX A;  3KXB D;  1KX4 D;  3B6G D;  1KX5 C;  5JRG B;  3REL A;  3NQU A;  4ZUX C;  2Y2N A;  3KXB B;  5B1M D;  3KUY D;  3AZK A;  1P3L C;  2F8N A;  5B31 C;  2JSS A;  3KUY B;  5B1M B;  3VH5 T;  5AV9 D;  3REH D;  5B32 D;  3AZI D;  4ZBJ C;  5CPI D;  3REH B;  3C1B D;  5B32 B;  3AZI B;  5CPI B;  4Z5T A;  3UTB D;  1BH8 A;  5GT0 C;  3WAA A;  3AYW C;  3C1B B;  5AV5 C;  5G49 B;  1BH9 A;  3KFU G;  3UTB B;  2YFW A;  4H9R A;  1P3M D;  4H9S A;  4YM6 C;  4DQY B;  4WU8 C;  3AN2 C;  3A1K A;  5AY8 D;  3AFA C;  3AZF C;  3AZJ C;  3LEL C;  3LZ1 C;  3W99 B;  4YS3 D;  3REL D;  5AY8 B;  3NQJ A;  3REJ A;  1B6W A;  4J8W C;  3AV1 B;  5DNN B;  3KWQ A;  1P3G A;  2BYK A;  4JJN D;  1M19 D;  1P3K D;  5B33 D;  4JJN B;  3WAA D;  1P3K B;  3AZG B;  1P34 A;  4XZQ A;  3LZ0 A;  5B33 B;  3MVD D;  2NQB A;  1P3O A;  1JFI B;  3REJ D;  3AZH C;  3AZM A;  4XUJ A;  3AV1 C;  5DNN C;  1P3A A;  1AOI A;  1H3O A;  3X1U A;  3R45 A;  1P3B D;  3KWQ D;  4CSR B;  1P3B B;  5CP6 D;  4H9P B;  1EQZ A;  5GXQ D;  3C1C D;  2ZY5 A;  1P3I B;  5CP6 B;  5GXQ B;  2IO5 B;  2JCH A;  4NE3 A;  4H9Q B;  3C1C B;  5CHL B;  5DNM C;  4G91 B;  4E45 A;  4X23 A;  3LJA C;  1S32 A;  3AZE D;  3WKJ C;  4XUJ D;  1AOI D;  4Z66 B;  3AZE B;  5B24 A;  1KX3 D;  1ZLA C;  3WA9 C;  5BS7 C;  5BT1 C;  4WU9 C;  5AVC C;  4AWL B;  4KUD D;  1P3I C;  1TZY C;  3A6N D;  3MGS C;  2PYO A;  3AV2 B;  4LD9 A;  4J8U A;  3MGR D;  2BYM B;  5FUG A;  3A6N B;  3UT9 C;  5E5A C;  3VH6 W;  5AV6 B;  3MGR B;  2Y2Q A;  4QLC D;  1F66 A;  1ID3 D;  4H9O A;  2L5A A;  3O62 D;  3X1S C;  5GT3 D;  5AVB A;  4QLC B;  2RIQ A;  4Z66 C;  3MNN D;  3W97 C;  3O62 B;  2FJ7 A;  4Z2M G;  5BNV B;  5GT3 B;  3V9R A;  5KDM A;  5CPJ A;  3MNN B;  3B6F B;  3VH6 A;  5F99 A;  3W96 A;  3AV2 C;  3REK D;  2PYO D;  1M18 A;  5JA4 A;  3UTA C;  1KX5 A;  3MGQ C;  2HIO B;  3REK B;  5B40 D;  2F8N G;  4ZUX A;  3H0R C;  5AV6 C;  5AV8 B;  1P3L A;  4UUZ B;  5B0Y C;  1P3F D;  5B31 A;  5B40 B;  2ARO C;  5B2I D;  3MGP C;  3WTP C;  1P3F B;  1U35 B;  5B2I B;  2Y2O A;  2FJ7 D;  2G5H C;  5CPK D;  5GT0 A;  3B0C T;  3AYW A;  3X1V C;  5AV5 A;  1M1A C;  3REI C;  1B67 A;  3TU4 C;  3W98 D;  4KGC D;  5B1L B;  4YM6 A;  4WU8 A;  3AZL D;  3VH5 W;  3AN2 A;  4J8V D;  3AFA A;  3AZF A;  3AZJ A;  3W98 B;  3LEL A;  3LZ1 A;  2Y2M A;  4KGC B;  5BNX A;  4ZUX D;  3X1T B;  3AZL B;  2F8N K;  4J8V B;  2CWE A;  5B2J D;  1KX4 B;  4J8X C;  3B6G B;  4J8W A;  5GSU C;  1U35 C;  5B0Z D;  5B2J B;  1P3P D;  2DQN C;  1HQ3 D;  1T3U A;  5B0Z B;  5AV9 B;  1HQ3 B;  3AYW D;  2NZD C;  3AZN D;  4YM6 D;  3X1T C;  5JRG C;  3KXB C;  1P3M B;  1KX4 C;  4KHA B;  3AZH A;  3AV1 A;  1N1J A;  5DNN A;  2Y2L A;  3H0M C;  3KUY C;  3AZK D;  5B1M C;  2F8N D;  3REL B;  3NQU B;  4YS3 B;  4WNN A;  3AZK B;  5AV9 C;  3REH C;  2F8N B;  2ZM5 A;  5B32 C;  3AZI C;  2CV5 A;  5CPI C;  4WJ3 C;  4Z5T D;  3C1B C;  3A1I A;  2JE5 A;  1M19 B;  3UTB C;  2Y2J A;  4Z5T B;  1BH8 B;  3WAA B;  5DNM A;  2HUE B;  1W2E A;  3W99 C;  4DRA A;  3EPH A;  2YFW B;  3LJA A;  4H9R B;  5AY8 C;  3WKJ A;  3AL0 C;  4YS3 C;  4H9N A;  3MVD B;  1Z2C B;  1ZLA A;  3WA9 A;  4WV4 B;  5BS7 A;  3NQJ B;  3REJ B;  5AVC A;  4WU9 A;  1P3G D;  2FFF B;  2CV5 D;  1P3I A;  1TZY A;  3MGS A;  4JJN C;  2RVQ D;  1P3K C;  1M19 C;  3KWQ B;  3AZG C;  1P3G B;  2BYK B;  2W8S A;  5B33 C;  2ZY3 A;  1P34 D;  4XZQ D;  3UT9 A;  3LZ0 D;  5E5A A;  1P34 B;  3X1S A;  3LJA D;  1WWI A;  2NQB D;  3MVD C;  4Z66 A;  3W97 A;  3EG5 B;  1P3O D;  3EPK A;  3AZM D;  1P3A D;  2NQB B;  4M6B A;  3X1U D;  2YFV A;  4WU9 D;  4XUJ B;  1P3B C;  1P3A B;  3AV2 A;  1H3O B;  1AOI B;  3X1U B;  3R45 B;  3UTA A;  1KX3 B;  1EQZ D;  3MGQ A;  5CP6 C;  5GXQ C;  2IO5 C;  5B31 G;  5AV6 A;  4KUD B;  3C1C C;  2Y2G A;  5B0Y A;  2ARO A;  2Y2I A;  3MGP A;  1WWS A;  4G91 C;  3WTP A;  4R8P A;  3B0D B;  4X23 D;  1S32 D;  3W97 D;  1ID3 B;  3AZE C;  1S32 B;  3X1V A;  5B24 D;  1M1A A;  3REI A;  2BG1 A;  3TU4 A;  4AWL C;  1KX3 C;  5B24 B;  3UTA D;  5BO0 A;  3MGQ D;  4G92 B;  4NE6 A;  4KUD C;  3A6N C;  4LD9 D;  4J8U D;  4CAY A;  5C3I B;  2PYO B;  3MGR C;  2ARO D;  4J8X A;  3MGP D;  3B0C W;  5GSU A;  4J8U B;  4LD9 B;  1U35 A;  4R8P D;  1F66 D;  1TAF A;  1ULY A;  4QLC C;  1ID3 C;  5AVB D;  3O62 C;  1F66 B;  3P5J B;  5GT3 C;  4H9O B;  3MNN C;  5AVB B;  5CPJ D;  1M1A D;  3B6F C;  2NZD A;  3TU4 D;  3H0L C;  2FJ7 B;  5F99 D;  5CPK B;  3V9R B;  5KDM B;  5CPJ B;  3W96 D;  1M18 D;  3X1T A;  5F99 B;  2HIO C;  5JRG A;  3REK C;  3W96 B;  1KX5 D;  3KXB A;  1KX4 A;  1M18 B;  5AV8 C;  5JA4 B;  5B40 C;  5GSU D;  3KUY A;  1P3L D;  5B1M A;  5B31 D;  4ZUX B;  1P3F C;  5B2I C;  1P3L B;  4E44 A;  3REH A;  5B31 B;  5B32 A;  3AZI A;  5CPI A;  3VH5 A;  3C1B A;  1P3P B;  5G49 A;  5GT0 D;  2J8P A;  5CPK C;  5AV5 D;  3UTB A;  2ZY4 A;  5B1L C;  5GT0 B;  3IP4 C;  3AYW B;  1A7W A;  5AV5 B;  4WU8 D;  3W98 C;  3AN2 D;  3W99 A;  4KGC C;  3AFA D;  4Z2M H;  3AZF D;  3AZJ D;  3AZL C;  3LEL D;  3LZ1 D;  3AZN B;  4J8V C;  5AY8 A;  4YM6 B;  4WU8 B;  3AN2 B;  3B6G C;  3AFA B;  3AZF B;  4YS3 A;  3AZJ B;  3LEL B;  3LZ1 B;  4WZS B;  5BNX B;  4J8W D;  5B2J C;  1BFM A;  3WTP E;  4J8W B;  5B0Z C;  2F8N H;  1P3P C;  1HQ3 C;  4JJN A;  1M19 A;  1P3K A;  3FDD A;  3AZG A;  5B33 A;  1KU5 A;  3W99 D;  3AZN C;  1BH9 B;  1JFI A;  1P3M C;  3MVD A;  3AZH D;  1Q9C A;  3AV1 D;  5DNN D;  3REL C;  3AZK C;  4CSR A;  3AZH B;  1N1J B;  1P3B A;  4DRB A;  4H9P A;  2ZY2 A;  4WNN B;  3AZG D;  5CP6 A;  5GXQ A;  2CV5 B;  4H9Q A;  3C1C A;  4Z5T C;  2LY8 A;  3WAA C;  2HUE C;  5DNM D;  4XZQ B;  1PZR A;  3LZ0 B;  4H9S C;  4NE5 A;  5DNM B;  3WKJ D;  3AZE A;  3LJA B;  3WKJ B;  1ZLA D;  1P3O B;  3WA9 D;  3REJ C;  4H9N B;  5BT1 D;  1KX3 A;  3AZM B;  5AVC D;  1ZLA B;  1P3I D;  1TZY D;  3KWQ C;  1F1E A;  3MGS D;  1P3G C;  3WA9 B;  4KUD A;  2CV5 C;  4WU9 B;  5AVC B;  2BYM A;  2Y2H A;  3A6N A;  2RVQ C;  1TZY B;  4EO5 B;  3MGS B;  3UT9 D;  3MGR A;  5E5A D;  1P34 C;  1EQZ B;  4XZQ C;  3LZ0 C;  3UT9 B;  4HGA B;  5E5A B;  4QLC A;  3X1S D;  1ID3 A;  3O62 A;  4Z66 D;  5BNV A;  5GT3 A;  3X1S B;  2NQB C;  3MNN A;  1P3O C;  4X23 B;  4UPK A;  3B6F A;  3W97 B;  3AZM C;  4XUJ C;  1AOI C;  1P3A C;  3X1U C;  3AV2 D;  2VQR A;  2HIO A;  2YFV B;  1R4V A;  4EO5 C;  3REK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...