5CPKB

Nucleosome containing methylated sat2l dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkB00
3WAAA 4G91B 3KXBC 5GT3B 3UT9A 3KXBD 3AFAC 3W98B 4H9RB 2BYMA 1HQ3B 5CPIA 2AROB 3AFAD 5DNMC 1F66C 5AVCC 1F66D 5DNMD 5AVCD 4ZUXB 5BNXB 4YS3C 4J8UC 2F8ND 4ZBJC 5CP6B 4YS3D 1JFIB 4J8UD 2NQBA 3X1TB 1ZLAA 3C1BB 3AZLB 1P3FB 4NE5A 3W99B 3AV2A 1M18A 4XZQC 4G92B 3WA9B 3A6NB 5AV5C 4XZQD 5B24B 5CPIB 5BS7C 4J8VB 5AV5D 1KX4C 5BO0B 4H9QA 3NQJB 1KX4D 1P3LA 3AZFA 3TU4C 5GSUC 3TU4D 3KUYB 5GSUD 1KX5C 4XUJA 5CPKA 1KX5D 4X23C 4KHAB 1BH9A 2CV5A 4LD9A 4X23D 3X1UB 3O62B 1KX3C 1M19C 3X1VC 5AVBA 4R8PA 1KX3D 4JJNB 3X1VD 5B1LA 5C3IC 4WU9C 4WNNA 4YM6A 5JA4A 3REJC 4CAYB 3UTBB 1P3OB 5FUGA 4H9OB 4WU9D 4G91C 3B6FD 3REJD 5GT3C 1ULYA 4XUJB 3AZMC 2YFVA 5AV6C 3W98C 1EQZC 3AZJC 3AZMD 4CSRB 1HQ3C 5AV6D 1P34C 2HIOC 3AZJD 1EQZD 1WWSA 1P34D 2HIOD 4Z2MH 5G49B 3KXBA 4AWLC 1M1AC 3AFAA 2BYKB 1M1AD 5B1MB 5CP6C 3VH6T 5B31G 5CP6D 3V9RA 3X1TC 2F8NA 1P3FC 3X1TD 4YS3A 4J8UA 1P3FD 3W99C 3LZ0C 4DRAA 1A7WA 4EO5B 3AZHA 4KUDB 3WA9C 3W99D 3LZ0D 3REHA 3NQUA 3VH6W 3WA9D 4M6BA 4J8VC 5CHLB 2NZDB 5B32A 3W96B 5B2IA 3LZ1A 3AZKB 4J8XA 5GXQB 3B0BA 4Z5TB 5B0YC 3KUYC 5B40B 1P3MC 5B2JB 5B0YD 1P3AC 3KUYD 1P3MD 3V9RB 4E45A 3WTPB 2PYOB 1P3AD 3TU4A 1BH8B 5B31B 3MGSC 3UTAD 3WKJC 4Z66B 3MGSD 1KX5A 3REHB 3WKJD 3O62C 1AOIC 4KGCB 4H9NA 5AV9B 3O62D 1AOID 5GT0B 3LZ1B 5DNNC 3MGQC 3B6GB 4J8XB 5DNND 4J8WB 3MGQD 1P3BB 5CPJB 4HGAB 1P3OC 1KX3A 5JRGB 3AV1B 3MGPD 3AZEC 3X1VA 3REIC 4NFTA 1P3OD 3REKB 1ID3B 3AZED 2RVQC 3REID 3B6FA 3LELA 1TAFB 2RVQD 3REJA 3R45B 1P3GA 3X1SA 3AZMA 5AV6A 1EQZA 1Q9CA 3AZJA 3MGRA 1P3KC 1R4VA 5B1MC 3AZIA 1P3KD 5B1MD 3AN2C 1S32C 4NE6A 2FJ7C 5AV8C 3AN2D 1S32D 2FJ7D 5AV8D 3VH5W 1P3IC 4QLCB 3RELA 1P3ID 3WAAB 3MVDA 4NE3A 3W96C 3LZ0A 3C1CA 3UT9B 3AZKC 3W96D 4H9SA 3B0DC 5GXQC 3MGRB 2BYMB 4Z5TC 3AZGC 1TZYC 4WU8A 5B40C 5GXQD 5B2JC 4Z5TD 3AZGD 1TZYD 3AZNC 2HUEB 3KWQC 5B2JD 2PYOC 3AZND 3KWQD 5B31C 2PYOD 3AYWC 5B31D 4Z66C 2NQBB 3AYWD 1P3AA 4Z66D 1U35C 1P3PA 3LJAA 1ZLAB 3UTAA 5AV9C 1U35D 3MGSA 5AY8C 3AV2B 1M18B 3B6GC 3WKJA 3B0CT 5AY8D 4J8WC 3MNNA 3B6GD 3W97C 1AOIA 4J8WD 2LY8A 3W97D 5JRGC 3AV1C 4H9QB 3REKC 2CWEA 5F99A 5JRGD 3MGQA 5E5AA 5B0ZC 3AV1D 1M19D 5B33C 3AZFB 3REKD 1P3LB 3B0CW 5B0ZD 5B33D 3MGPA 5BNVA 3REIA 5CPKB 5GT3D 2AROC 3W98D 1BH9B 2CV5B 4LD9B 1HQ3D 2AROD 4ZUXC 1P3KA 1N1JA 4ZUXD 2YFWA 4UUZA 1F66A 5DNMA 5AVBB 4R8PB 5AVCA 2F8NG 5E5AB 4QLCC 5B1LB 3AN2A 1S32A 4WNNB 2FJ7A 4QLCD 4YM6B 5JA4B 5AV8A 3C1BC 3AZLC 5FUGB 3C1BD 3AZLD 3UT9C 1P3IA 2YFVB 4G92C 5B32G 3A6NC 5CPIC 1B67A 5B24C 3A6ND 5B24D 5CPID 2HUEC 3KXBB 4J8VD 4XZQA 3AFAB 1N1JB 5AV5A 3AZGA 5BS7A 5DNMB 1KX4A 3AZNA 3KWQA 1ZLAC 2F8NB 4Z2MG 1F1EA 5GSUA 4J8UB 4YS3B 1ZLAD 1M18C 4ZBJB 3AZHB 3X1UC 1U35A 3NQUB 3X1UD 4X23A 5B32B 5AY8A 5B2IB 4JJNC 4XZQB 3AZFC 4JJND 3UTBC 3AZFD 3UTBD 1KX4B 1M19A 4XUJC 5B0ZA 4XUJD 5B33A 3TU4B 4WU9A 5GSUB 4LD9C 1KX5B 5GT3A 4LD9D 2IO5B 1HTAA 3W98A 4H9NB 4X23B 1HQ3A 3VH5T 1P34A 2HIOA 4R8PC 5AVBC 5B1LC 5AVBD 4R8PD 5B1LD 1M1AA 5BNXA 1KX3B 3X1VB 4EO5C 5CP6A 1JFIA 4KUDC 3B6FB 3LELB 4KUDD 3X1TA 3C1BA 3REJB 3AZLA 1P3FA 2NZDC 1P3GB 3X1SB 3W99A 2NZDD 3AZMB 5AV6B 3WA9A 3A6NA 1EQZB 3AZJB 3AZKD 5B24A 1P34B 2HIOB 4J8VA 3AZIB 5BO0A 3NQJA 5B40D 4AWLB 3WTPC 1M1AB 3WTPD 5B0YA 3KUYA 3AZHC 1P3MA 3REHC 3AZHD 3RELB 3REHD 3MVDB 4KGCC 4KHAA 5B32C 5B2IC 5GT0C 3LZ1C 4KGCD 3LZ0B 5AV9D 3C1CB 5B32D 5B2ID 5GT0D 3LZ1D 4J8XC 3X1UA 1P3BC 4J8XD 4HGAC 3O62A 5CPJC 4WU8B 1P3BD 5CPJD 1ID3C 5DNNA 4JJNA 1ID3D 3UTBA 1WWIA 4CAYA 1P3OA 4H9OA 5B0YB 1P3MB 3AZEA 1P3AB 1BFMA 2IO5C 1P3PB 3LJAB 3UTAB 2F8NH 4CSRA 3MGSB 3WKJB 5BT1C 5G49A 3MNNB 5BT1D 1AOIB 2BYKA 2L5AA 5B1MA 1KU5A 5DNNB 5F99B 3MGQB 3B6FC 3LELC 3WAAC 2JSSA 3MGPB 3LELD 5BNVB 1P3GC 3WAAD 3X1SC 3AZEB 3REIB 1H3OA 4KUDA 1P3GD 3X1SD 3UT9D 3MGRC 3AZIC 3MGRD 2NZDA 3W96A 3VH6A 3AZID 3AZKA 1P3KB 5GXQA 4Z5TA 4WZSB 1TZYA 2YFWB 4UUZB 5B40A 1F66B 5B2JA 5AVCB 2NQBC 3AN2B 1S32B 3RELC 4WV4B 3WTPA 3KSYA 3MVDC 2FJ7B 5AV8B 2NQBD 2PYOA 1BH8A 3RELD 5B31A 3MVDD 3C1CC 3AYWA 1H3OB 4Z66A 4H9SC 3AV2C 1P3IB 3C1CD 3AV2D 1M18D 4WU8C 4KGCA 5AV9A 4WU8D 5GT0A 3B6GA 3B0DB 1P3LC 4J8WA 1P3BA 3W97A 5AV5B 3AZGB 1TZYB 5CPJA 1P3LD 5JRGA 3AV1A 3AZNB 1ID3A 4H9PA 3KWQB 3REKA 5CPKC 1P3PC 5KDMA 3LJAC 3UTAC 5CPKD 1TAFA 4DRBA 1P3PD 3LJAD 2CV5C 3AYWB 3R45A 2F8NK 3MNNC 2CV5D 1U35B 3MNND 4H9RA 5AY8B 2AROA 5F99C 5E5AC 5F99D 5E5AD 3W97B 4ZUXA 4YM6C 3MGPC 4E44A 1B6WA 4YM6D 1M19B 3WTPE 4H9PB 5KDMB 5B0ZB 4QLCA 5B33B 5C3IB 4WU9B 3VH5A
chains in the Genus database with same CATH superfamily
3WAAA 4G91B 3KXBC 5GT3B 3UT9A 3KXBD 3AFAC 3W98B 4H9RB 2BYMA 1T3UA 1HQ3B 2Y2IA 5CPIA 2AROB 3AFAD 5DNMC 1F66C 5AVCC 1F66D 5DNMD 5AVCD 4ZUXB 2Y2JA 5BNXB 4YS3C 4J8UC 2F8ND 4ZBJC 5CP6B 4YS3D 1JFIB 4J8UD 2NQBA 3A1KA 3X1TB 1ZLAA 3C1BB 3AZLB 1P3FB 4NE5A 3W99B 3AV2A 1M18A 4XZQC 4G92B 3WA9B 3A6NB 5AV5C 4XZQD 2DQNC 2J8PA 5B24B 5CPIB 5BS7C 4J8VB 5AV5D 1KX4C 5BO0B 4H9QA 3NQJB 1KX4D 1P3LA 3AZFA 3TU4C 5GSUC 3TU4D 3KUYB 5GSUD 1KX5C 4XUJA 5CPKA 1KX5D 3AL0C 4X23C 4KHAB 1BH9A 2CV5A 4LD9A 4X23D 4UPKA 3X1UB 4DQYB 3O62B 1KX3C 1M19C 3X1VC 5AVBA 4R8PA 1KX3D 4JJNB 3X1VD 5B1LA 5C3IC 4WU9C 4WNNA 4YM6A 5JA4A 3REJC 4CAYB 3UTBB 1P3OB 5FUGA 4H9OB 4WU9D 4G91C 3B6FD 2F2AC 3REJD 5GT3C 1ULYA 4XUJB 3AZMC 2YFVA 5AV6C 3W98C 1EQZC 3AZJC 3AZMD 4CSRB 2ZY3A 1HQ3C 3FDDA 5AV6D 2FFFB 2HIOC 3AZJD 1P34C 1EQZD 1WWSA 2Y2MA 1P34D 2HIOD 4Z2MH 5G49B 3KXBA 4AWLC 1M1AC 3AFAA 2BYKB 3EPHA 1M1AD 5B1MB 5CP6C 3VH6T 5B31G 5CP6D 3V9RA 3X1TC 2F8NA 1P3FC 3X1TD 4YS3A 4J8UA 1P3FD 3W99C 3LZ0C 4DRAA 1A7WA 4EO5B 3AZHA 4KUDB 3A1IA 3W99D 3LZ0D 3REHA 3WA9C 3NQUA 3VH6W 3WA9D 4M6BA 4J8VC 5CHLB 2NZDB 5B32A 3W96B 5B2IA 3LZ1A 3AZKB 4J8XA 5GXQB 3B0BA 4Z5TB 5B0YC 3KUYC 5B40B 1P3MC 5B2JB 3EG5B 5B0YD 1P3AC 3KUYD 1P3MD 3V9RB 4E45A 3WTPB 2PYOB 1P3AD 3TU4A 1BH8B 5B31B 3MGSC 2ZY4A 3UTAD 3WKJC 4Z66B 3MGSD 1KX5A 3REHB 3WKJD 3O62C 1AOIC 4KGCB 4H9NA 5AV9B 3O62D 1AOID 5GT0B 3F6TA 3LZ1B 5DNNC 2UWXA 3MGQC 3B6GB 4J8XB 5DNND 4J8WB 3KFUG 3MGQD 1P3BB 5CPJB 4HGAB 1P3OC 1KX3A 5JRGB 3AV1B 3MGPD 3AZEC 3X1VA 3REIC 4NFTA 1P3OD 3REKB 1ID3B 3EPJA 3AZED 2RVQC 3REID 3B6FA 3LELA 1TAFB 2XD1A 2RVQD 3REJA 3R45B 1P3GA 3X1SA 3AZMA 5AV6A 1EQZA 1Q9CA 3AZJA 3MGRA 1P3KC 1R4VA 5B1MC 3AZIA 1P3KD 5B1MD 3AN2C 1S32C 1PZRA 4NE6A 2FJ7C 5AV8C 3AN2D 1S32D 3H0LC 2FJ7D 5AV8D 3VH5W 1P3IC 4QLCB 3RELA 1P3ID 3WAAB 3MVDA 4NE3A 3W96C 3LZ0A 3C1CA 3UT9B 3AZKC 2Y2LA 4H9SA 3B0DC 3W96D 5GXQC 1Z2CB 3MGRB 2BYMB 4Z5TC 3AZGC 1TZYC 4WU8A 5B40C 5GXQD 5B2JC 4Z5TD 3AZGD 1TZYD 3AZNC 2HUEB 3KWQC 5B2JD 2PYOC 3AZND 3KWQD 5B31C 2PYOD 3AYWC 5B31D 4Z66C 2NQBB 2W8SA 3AYWD 4Z66D 1P3AA 1U35C 1P3PA 3LJAA 1ZLAB 3UTAA 5AV9C 1U35D 3MGSA 5AY8C 3AV2B 1M18B 3B6GC 3WKJA 3B0CT 5AY8D 4J8WC 3MNNA 3B6GD 3W97C 1AOIA 4J8WD 2LY8A 3W97D 5JRGC 3AV1C 4H9QB 3REKC 2CWEA 5F99A 5JRGD 3MGQA 5E5AA 5B0ZC 3AV1D 1M19D 5B33C 3AZFB 3REKD 1P3LB 3B0CW 5B0ZD 5B33D 3MGPA 5BNVA 2Y2NA 3REIA 5CPKB 5GT3D 2DF4C 2AROC 3W98D 1BH9B 2CV5B 4LD9B 1HQ3D 2AROD 4ZUXC 1P3KA 1N1JA 4ZUXD 2YFWA 4UUZA 1F66A 5DNMA 5AVBB 4R8PB 5AVCA 2F8NG 5E5AB 4QLCC 3EPKA 5B1LB 3AN2A 1S32A 4WNNB 2FJ7A 4QLCD 4YM6B 5JA4B 5AV8A 3C1BC 3AZLC 5FUGB 3C1BD 3AZLD 3UT9C 1P3IA 2YFVB 2XD5A 4G92C 5B32G 3A6NC 2Y2PA 5CPIC 1B67A 5B24C 3A6ND 5B24D 5CPID 2HUEC 3KXBB 4J8VD 4XZQA 3AFAB 1N1JB 5AV5A 3AZGA 5BS7A 5DNMB 1KX4A 3AZNA 3KWQA 1ZLAC 2F8NB 4Z2MG 1F1EA 5GSUA 4J8UB 4YS3B 1ZLAD 1M18C 4ZBJB 3AZHB 3X1UC 1U35A 3NQUB 3X1UD 4X23A 5B32B 5AY8A 5B2IB 4JJNC 4XZQB 3AZFC 4JJND 3UTBC 3AZFD 2ZY2A 3UTBD 1KX4B 1M19A 4XUJC 2ZY5A 2G5IC 5B0ZA 4XUJD 5B33A 3TU4B 4WU9A 5GSUB 4LD9C 1KX5B 5GT3A 4LD9D 2IO5B 1HTAA 3W98A 4H9NB 4X23B 1HQ3A 3VH5T 1P34A 2HIOA 4R8PC 2JE5A 5AVBC 2ZM5A 5B1LC 5AVBD 4R8PD 5B1LD 2JCHA 1M1AA 5BNXA 1KX3B 3X1VB 4EO5C 5CP6A 1JFIA 4KUDC 4WJ3C 3B6FB 3LELB 4KUDD 3X1TA 3C1BA 3REJB 3AZLA 1P3FA 2NZDC 1P3GB 3X1SB 3W99A 2NZDD 3AZMB 5AV6B 3WA9A 3A6NA 1EQZB 3AZJB 3AZKD 5B24A 1P34B 2HIOB 4J8VA 3AZIB 5BO0A 3NQJA 5B40D 4AWLB 3WTPC 3EPLA 1M1AB 3H0MC 3WTPD 5B0YA 3KUYA 3AZHC 1P3MA 3REHC 3AZHD 3RELB 3REHD 3MVDB 4KGCC 4KHAA 5B32C 5B2IC 5GT0C 3LZ1C 4KGCD 3LZ0B 5AV9D 3C1CB 5B32D 5B2ID 5GT0D 3LZ1D 4J8XC 3X1UA 1P3BC 4J8XD 4HGAC 3O62A 5CPJC 4WU8B 2Y2QA 1P3BD 5CPJD 2RIQA 1ID3C 5DNNA 4JJNA 1ID3D 3UTBA 1WWIA 4CAYA 1P3OA 4H9OA 5B0YB 1P3MB 3AZEA 1P3AB 1BFMA 2IO5C 1P3PB 3LJAB 3UTAB 2F8NH 4CSRA 3MGSB 2Y2KA 3WKJB 5BT1C 5G49A 3MNNB 5BT1D 1AOIB 2BYKA 2L5AA 5B1MA 1KU5A 5DNNB 5F99B 3MGQB 3B6FC 3LELC 3WAAC 2JSSA 3P5JB 3MGPB 3LELD 5BNVB 1P3GC 3WAAD 3X1SC 3AZEB 3REIB 1H3OA 4KUDA 1P3GD 3X1SD 3UT9D 3MGRC 2Y2GA 3AZIC 3MGRD 2NZDA 3W96A 3VH6A 3AZID 2G5HC 3AZKA 2VQRA 1P3KB 5GXQA 4Z5TA 4WZSB 1TZYA 2YFWB 4UUZB 5B40A 1F66B 5B2JA 5AVCB 2NQBC 3AN2B 1S32B 3RELC 4WV4B 3WTPA 3KSYA 3MVDC 2FJ7B 5AV8B 2NQBD 2PYOA 1BH8A 3RELD 5B31A 3MVDD 3C1CC 3AYWA 1H3OB 4Z66A 4H9SC 3AV2C 1P3IB 3C1CD 3AV2D 1M18D 4WU8C 4KGCA 5AV9A 2Y2HA 4WU8D 5GT0A 3B6GA 3B0DB 1P3LC 4J8WA 1P3BA 3W97A 5AV5B 3AZGB 1TZYB 5CPJA 1P3LD 5JRGA 3AV1A 3IP4C 2BG1A 3AZNB 1ID3A 4H9PA 3KWQB 3REKA 5CPKC 1W2EA 1P3PC 5KDMA 3LJAC 3UTAC 5CPKD 1TAFA 4DRBA 1P3PD 3LJAD 2CV5C 3AYWB 2Y2OA 3R45A 2F8NK 3MNNC 2CV5D 1U35B 3MNND 4H9RA 3H0RC 5AY8B 2AROA 5F99C 5E5AC 5F99D 5E5AD 3W97B 4ZUXA 4YM6C 3MGPC 4E44A 1B6WA 4YM6D 1M19B 3WTPE 4H9PB 5KDMB 5B0ZB 4QLCA 5B33B 5C3IB 4WU9B 3VH5A
chains in the Genus database with same CATH topology
3WAAA 4G91B 3KXBC 5GT3B 3UT9A 3KXBD 3AFAC 3W98B 4H9RB 2BYMA 1T3UA 1HQ3B 2Y2IA 5CPIA 2AROB 3AFAD 5DNMC 1F66C 5AVCC 1F66D 5DNMD 5AVCD 4ZUXB 2Y2JA 5BNXB 4YS3C 4J8UC 2F8ND 4ZBJC 5CP6B 4YS3D 1JFIB 4J8UD 2NQBA 3A1KA 3X1TB 1ZLAA 3C1BB 3AZLB 1P3FB 4NE5A 3W99B 3AV2A 1M18A 4XZQC 4G92B 3WA9B 3A6NB 5AV5C 4XZQD 2DQNC 2J8PA 5B24B 5CPIB 5BS7C 4J8VB 5AV5D 1KX4C 5BO0B 4H9QA 3NQJB 1KX4D 1P3LA 3AZFA 3TU4C 5GSUC 3TU4D 3KUYB 5GSUD 1KX5C 4XUJA 5CPKA 1KX5D 3AL0C 4X23C 4KHAB 1BH9A 2CV5A 4LD9A 4X23D 4UPKA 3X1UB 4DQYB 3O62B 1KX3C 1M19C 3X1VC 5AVBA 4R8PA 1KX3D 4JJNB 3X1VD 5B1LA 5C3IC 4WU9C 4WNNA 4YM6A 5JA4A 3REJC 4CAYB 3UTBB 1P3OB 5FUGA 4H9OB 4WU9D 4G91C 3B6FD 2F2AC 3REJD 5GT3C 1ULYA 4XUJB 3AZMC 2YFVA 5AV6C 3W98C 1EQZC 3AZJC 3AZMD 4CSRB 2ZY3A 1HQ3C 3FDDA 5AV6D 2FFFB 2HIOC 3AZJD 1P34C 1EQZD 1WWSA 2Y2MA 1P34D 2HIOD 4Z2MH 5G49B 3KXBA 4AWLC 1M1AC 3AFAA 2BYKB 3EPHA 1M1AD 5B1MB 5CP6C 3VH6T 5B31G 5CP6D 3V9RA 3X1TC 2F8NA 1P3FC 3X1TD 4YS3A 4J8UA 1P3FD 3W99C 3LZ0C 4DRAA 1A7WA 4EO5B 3AZHA 4KUDB 3A1IA 3W99D 3LZ0D 3REHA 3WA9C 3NQUA 3VH6W 3WA9D 4M6BA 4J8VC 5CHLB 2NZDB 5B32A 3W96B 5B2IA 3LZ1A 3AZKB 4J8XA 5GXQB 3B0BA 4Z5TB 5B0YC 3KUYC 5B40B 1P3MC 5B2JB 3EG5B 5B0YD 1P3AC 3KUYD 1P3MD 3V9RB 4E45A 3WTPB 2PYOB 1P3AD 3TU4A 1BH8B 5B31B 3MGSC 2ZY4A 3UTAD 3WKJC 4Z66B 3MGSD 1KX5A 3REHB 3WKJD 3O62C 1AOIC 4KGCB 4H9NA 5AV9B 3O62D 1AOID 5GT0B 3F6TA 3LZ1B 5DNNC 2UWXA 3MGQC 3B6GB 4J8XB 5DNND 4J8WB 3KFUG 3MGQD 1P3BB 5CPJB 4HGAB 1P3OC 1KX3A 5JRGB 3AV1B 3MGPD 3AZEC 3X1VA 3REIC 4NFTA 1P3OD 3REKB 1ID3B 3EPJA 3AZED 2RVQC 3REID 3B6FA 3LELA 1TAFB 2XD1A 2RVQD 3REJA 3R45B 1P3GA 3X1SA 3AZMA 5AV6A 1EQZA 1Q9CA 3AZJA 3MGRA 1P3KC 1R4VA 5B1MC 3AZIA 1P3KD 5B1MD 3AN2C 1S32C 1PZRA 4NE6A 2FJ7C 5AV8C 3AN2D 1S32D 3H0LC 2FJ7D 5AV8D 3VH5W 1P3IC 4QLCB 3RELA 1P3ID 3WAAB 3MVDA 4NE3A 3W96C 3LZ0A 3C1CA 3UT9B 3AZKC 2Y2LA 4H9SA 3B0DC 3W96D 5GXQC 1Z2CB 3MGRB 2BYMB 4Z5TC 3AZGC 1TZYC 4WU8A 5B40C 5GXQD 5B2JC 4Z5TD 3AZGD 1TZYD 3AZNC 2HUEB 3KWQC 5B2JD 2PYOC 3AZND 3KWQD 5B31C 2PYOD 3AYWC 5B31D 4Z66C 2NQBB 2W8SA 3AYWD 4Z66D 1P3AA 1U35C 1P3PA 3LJAA 1ZLAB 3UTAA 5AV9C 1U35D 3MGSA 5AY8C 3AV2B 1M18B 3B6GC 3WKJA 3B0CT 5AY8D 4J8WC 3MNNA 3B6GD 3W97C 1AOIA 4J8WD 2LY8A 3W97D 5JRGC 3AV1C 4H9QB 3REKC 2CWEA 5F99A 5JRGD 3MGQA 5E5AA 5B0ZC 3AV1D 1M19D 5B33C 3AZFB 3REKD 1P3LB 3B0CW 5B0ZD 5B33D 3MGPA 5BNVA 2Y2NA 3REIA 5CPKB 5GT3D 2DF4C 2AROC 3W98D 1BH9B 2CV5B 4LD9B 1HQ3D 2AROD 4ZUXC 1P3KA 1N1JA 4ZUXD 2YFWA 4UUZA 1F66A 5DNMA 5AVBB 4R8PB 5AVCA 2F8NG 5E5AB 4QLCC 3EPKA 5B1LB 3AN2A 1S32A 4WNNB 2FJ7A 4QLCD 4YM6B 5JA4B 5AV8A 3C1BC 3AZLC 5FUGB 3C1BD 3AZLD 3UT9C 1P3IA 2YFVB 2XD5A 4G92C 5B32G 3A6NC 2Y2PA 5CPIC 1B67A 5B24C 3A6ND 5B24D 5CPID 2HUEC 3KXBB 4J8VD 4XZQA 3AFAB 1N1JB 5AV5A 3AZGA 5BS7A 5DNMB 1KX4A 3AZNA 3KWQA 1ZLAC 2F8NB 4Z2MG 1F1EA 5GSUA 4J8UB 4YS3B 1ZLAD 1M18C 4ZBJB 3AZHB 3X1UC 1U35A 3NQUB 3X1UD 4X23A 5B32B 5AY8A 5B2IB 4JJNC 4XZQB 3AZFC 4JJND 3UTBC 3AZFD 2ZY2A 3UTBD 1KX4B 1M19A 4XUJC 2ZY5A 2G5IC 5B0ZA 4XUJD 5B33A 3TU4B 4WU9A 5GSUB 4LD9C 1KX5B 5GT3A 4LD9D 2IO5B 1HTAA 3W98A 4H9NB 4X23B 1HQ3A 3VH5T 1P34A 2HIOA 4R8PC 2JE5A 5AVBC 2ZM5A 5B1LC 5AVBD 4R8PD 5B1LD 2JCHA 1M1AA 5BNXA 1KX3B 3X1VB 4EO5C 5CP6A 1JFIA 4KUDC 4WJ3C 3B6FB 3LELB 4KUDD 3X1TA 3C1BA 3REJB 3AZLA 1P3FA 2NZDC 1P3GB 3X1SB 3W99A 2NZDD 3AZMB 5AV6B 3WA9A 3A6NA 1EQZB 3AZJB 3AZKD 5B24A 1P34B 2HIOB 4J8VA 3AZIB 5BO0A 3NQJA 5B40D 4AWLB 3WTPC 3EPLA 1M1AB 3H0MC 3WTPD 5B0YA 3KUYA 3AZHC 1P3MA 3REHC 3AZHD 3RELB 3REHD 3MVDB 4KGCC 4KHAA 5B32C 5B2IC 5GT0C 3LZ1C 4KGCD 3LZ0B 5AV9D 3C1CB 5B32D 5B2ID 5GT0D 3LZ1D 4J8XC 3X1UA 1P3BC 4J8XD 4HGAC 3O62A 5CPJC 4WU8B 2Y2QA 1P3BD 5CPJD 2RIQA 1ID3C 5DNNA 4JJNA 1ID3D 3UTBA 1WWIA 4CAYA 1P3OA 4H9OA 5B0YB 1P3MB 3AZEA 1P3AB 1BFMA 2IO5C 1P3PB 3LJAB 3UTAB 2F8NH 4CSRA 3MGSB 2Y2KA 3WKJB 5BT1C 5G49A 3MNNB 5BT1D 1AOIB 2BYKA 2L5AA 5B1MA 1KU5A 5DNNB 5F99B 3MGQB 3B6FC 3LELC 3WAAC 2JSSA 3P5JB 3MGPB 3LELD 5BNVB 1P3GC 3WAAD 3X1SC 3AZEB 3REIB 1H3OA 4KUDA 1P3GD 3X1SD 3UT9D 3MGRC 2Y2GA 3AZIC 3MGRD 2NZDA 3W96A 3VH6A 3AZID 2G5HC 3AZKA 2VQRA 1P3KB 5GXQA 4Z5TA 4WZSB 1TZYA 2YFWB 4UUZB 5B40A 1F66B 5B2JA 5AVCB 2NQBC 3AN2B 1S32B 3RELC 4WV4B 3WTPA 3KSYA 3MVDC 2FJ7B 5AV8B 2NQBD 2PYOA 1BH8A 3RELD 5B31A 3MVDD 3C1CC 3AYWA 1H3OB 4Z66A 4H9SC 3AV2C 1P3IB 3C1CD 3AV2D 1M18D 4WU8C 4KGCA 5AV9A 2Y2HA 4WU8D 5GT0A 3B6GA 3B0DB 1P3LC 4J8WA 1P3BA 3W97A 5AV5B 3AZGB 1TZYB 5CPJA 1P3LD 5JRGA 3AV1A 3IP4C 2BG1A 3AZNB 1ID3A 4H9PA 3KWQB 3REKA 5CPKC 1W2EA 1P3PC 5KDMA 3LJAC 3UTAC 5CPKD 1TAFA 4DRBA 1P3PD 3LJAD 2CV5C 3AYWB 2Y2OA 3R45A 2F8NK 3MNNC 2CV5D 1U35B 3MNND 4H9RA 3H0RC 5AY8B 2AROA 5F99C 5E5AC 5F99D 5E5AD 3W97B 4ZUXA 4YM6C 3MGPC 4E44A 1B6WA 4YM6D 1M19B 3WTPE 4H9PB 5KDMB 5B0ZB 4QLCA 5B33B 5C3IB 4WU9B 3VH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAA A;  4G91 B;  3KXB C;  5GT3 B;  3UT9 A;  3KXB D;  3AFA C;  3W98 B;  4H9R B;  2BYM A;  1HQ3 B;  5CPI A;  2ARO B;  3AFA D;  5DNM C;  1F66 C;  5AVC C;  1F66 D;  5DNM D;  5AVC D;  4ZUX B;  5BNX B;  4YS3 C;  4J8U C;  2F8N D;  4ZBJ C;  5CP6 B;  4YS3 D;  1JFI B;  4J8U D;  2NQB A;  3X1T B;  1ZLA A;  3C1B B;  3AZL B;  1P3F B;  4NE5 A;  3W99 B;  3AV2 A;  1M18 A;  4XZQ C;  4G92 B;  3WA9 B;  3A6N B;  5AV5 C;  4XZQ D;  5B24 B;  5CPI B;  5BS7 C;  4J8V B;  5AV5 D;  1KX4 C;  5BO0 B;  4H9Q A;  3NQJ B;  1KX4 D;  1P3L A;  3AZF A;  3TU4 C;  5GSU C;  3TU4 D;  3KUY B;  5GSU D;  1KX5 C;  4XUJ A;  5CPK A;  1KX5 D;  4X23 C;  4KHA B;  1BH9 A;  2CV5 A;  4LD9 A;  4X23 D;  3X1U B;  3O62 B;  1KX3 C;  1M19 C;  3X1V C;  5AVB A;  4R8P A;  1KX3 D;  4JJN B;  3X1V D;  5B1L A;  5C3I C;  4WU9 C;  4WNN A;  4YM6 A;  5JA4 A;  3REJ C;  4CAY B;  3UTB B;  1P3O B;  5FUG A;  4H9O B;  4WU9 D;  4G91 C;  3B6F D;  3REJ D;  5GT3 C;  1ULY A;  4XUJ B;  3AZM C;  2YFV A;  5AV6 C;  3W98 C;  1EQZ C;  3AZJ C;  3AZM D;  4CSR B;  1HQ3 C;  5AV6 D;  1P34 C;  2HIO C;  3AZJ D;  1EQZ D;  1WWS A;  1P34 D;  2HIO D;  4Z2M H;  5G49 B;  3KXB A;  4AWL C;  1M1A C;  3AFA A;  2BYK B;  1M1A D;  5B1M B;  5CP6 C;  3VH6 T;  5B31 G;  5CP6 D;  3V9R A;  3X1T C;  2F8N A;  1P3F C;  3X1T D;  4YS3 A;  4J8U A;  1P3F D;  3W99 C;  3LZ0 C;  4DRA A;  1A7W A;  4EO5 B;  3AZH A;  4KUD B;  3WA9 C;  3W99 D;  3LZ0 D;  3REH A;  3NQU A;  3VH6 W;  3WA9 D;  4M6B A;  4J8V C;  5CHL B;  2NZD B;  5B32 A;  3W96 B;  5B2I A;  3LZ1 A;  3AZK B;  4J8X A;  5GXQ B;  3B0B A;  4Z5T B;  5B0Y C;  3KUY C;  5B40 B;  1P3M C;  5B2J B;  5B0Y D;  1P3A C;  3KUY D;  1P3M D;  3V9R B;  4E45 A;  3WTP B;  2PYO B;  1P3A D;  3TU4 A;  1BH8 B;  5B31 B;  3MGS C;  3UTA D;  3WKJ C;  4Z66 B;  3MGS D;  1KX5 A;  3REH B;  3WKJ D;  3O62 C;  1AOI C;  4KGC B;  4H9N A;  5AV9 B;  3O62 D;  1AOI D;  5GT0 B;  3LZ1 B;  5DNN C;  3MGQ C;  3B6G B;  4J8X B;  5DNN D;  4J8W B;  3MGQ D;  1P3B B;  5CPJ B;  4HGA B;  1P3O C;  1KX3 A;  5JRG B;  3AV1 B;  3MGP D;  3AZE C;  3X1V A;  3REI C;  4NFT A;  1P3O D;  3REK B;  1ID3 B;  3AZE D;  2RVQ C;  3REI D;  3B6F A;  3LEL A;  1TAF B;  2RVQ D;  3REJ A;  3R45 B;  1P3G A;  3X1S A;  3AZM A;  5AV6 A;  1EQZ A;  1Q9C A;  3AZJ A;  3MGR A;  1P3K C;  1R4V A;  5B1M C;  3AZI A;  1P3K D;  5B1M D;  3AN2 C;  1S32 C;  4NE6 A;  2FJ7 C;  5AV8 C;  3AN2 D;  1S32 D;  2FJ7 D;  5AV8 D;  3VH5 W;  1P3I C;  4QLC B;  3REL A;  1P3I D;  3WAA B;  3MVD A;  4NE3 A;  3W96 C;  3LZ0 A;  3C1C A;  3UT9 B;  3AZK C;  3W96 D;  4H9S A;  3B0D C;  5GXQ C;  3MGR B;  2BYM B;  4Z5T C;  3AZG C;  1TZY C;  4WU8 A;  5B40 C;  5GXQ D;  5B2J C;  4Z5T D;  3AZG D;  1TZY D;  3AZN C;  2HUE B;  3KWQ C;  5B2J D;  2PYO C;  3AZN D;  3KWQ D;  5B31 C;  2PYO D;  3AYW C;  5B31 D;  4Z66 C;  2NQB B;  3AYW D;  1P3A A;  4Z66 D;  1U35 C;  1P3P A;  3LJA A;  1ZLA B;  3UTA A;  5AV9 C;  1U35 D;  3MGS A;  5AY8 C;  3AV2 B;  1M18 B;  3B6G C;  3WKJ A;  3B0C T;  5AY8 D;  4J8W C;  3MNN A;  3B6G D;  3W97 C;  1AOI A;  4J8W D;  2LY8 A;  3W97 D;  5JRG C;  3AV1 C;  4H9Q B;  3REK C;  2CWE A;  5F99 A;  5JRG D;  3MGQ A;  5E5A A;  5B0Z C;  3AV1 D;  1M19 D;  5B33 C;  3AZF B;  3REK D;  1P3L B;  3B0C W;  5B0Z D;  5B33 D;  3MGP A;  5BNV A;  3REI A;  5CPK B;  5GT3 D;  2ARO C;  3W98 D;  1BH9 B;  2CV5 B;  4LD9 B;  1HQ3 D;  2ARO D;  4ZUX C;  1P3K A;  1N1J A;  4ZUX D;  2YFW A;  4UUZ A;  1F66 A;  5DNM A;  5AVB B;  4R8P B;  5AVC A;  2F8N G;  5E5A B;  4QLC C;  5B1L B;  3AN2 A;  1S32 A;  4WNN B;  2FJ7 A;  4QLC D;  4YM6 B;  5JA4 B;  5AV8 A;  3C1B C;  3AZL C;  5FUG B;  3C1B D;  3AZL D;  3UT9 C;  1P3I A;  2YFV B;  4G92 C;  5B32 G;  3A6N C;  5CPI C;  1B67 A;  5B24 C;  3A6N D;  5B24 D;  5CPI D;  2HUE C;  3KXB B;  4J8V D;  4XZQ A;  3AFA B;  1N1J B;  5AV5 A;  3AZG A;  5BS7 A;  5DNM B;  1KX4 A;  3AZN A;  3KWQ A;  1ZLA C;  2F8N B;  4Z2M G;  1F1E A;  5GSU A;  4J8U B;  4YS3 B;  1ZLA D;  1M18 C;  4ZBJ B;  3AZH B;  3X1U C;  1U35 A;  3NQU B;  3X1U D;  4X23 A;  5B32 B;  5AY8 A;  5B2I B;  4JJN C;  4XZQ B;  3AZF C;  4JJN D;  3UTB C;  3AZF D;  3UTB D;  1KX4 B;  1M19 A;  4XUJ C;  5B0Z A;  4XUJ D;  5B33 A;  3TU4 B;  4WU9 A;  5GSU B;  4LD9 C;  1KX5 B;  5GT3 A;  4LD9 D;  2IO5 B;  1HTA A;  3W98 A;  4H9N B;  4X23 B;  1HQ3 A;  3VH5 T;  1P34 A;  2HIO A;  4R8P C;  5AVB C;  5B1L C;  5AVB D;  4R8P D;  5B1L D;  1M1A A;  5BNX A;  1KX3 B;  3X1V B;  4EO5 C;  5CP6 A;  1JFI A;  4KUD C;  3B6F B;  3LEL B;  4KUD D;  3X1T A;  3C1B A;  3REJ B;  3AZL A;  1P3F A;  2NZD C;  1P3G B;  3X1S B;  3W99 A;  2NZD D;  3AZM B;  5AV6 B;  3WA9 A;  3A6N A;  1EQZ B;  3AZJ B;  3AZK D;  5B24 A;  1P34 B;  2HIO B;  4J8V A;  3AZI B;  5BO0 A;  3NQJ A;  5B40 D;  4AWL B;  3WTP C;  1M1A B;  3WTP D;  5B0Y A;  3KUY A;  3AZH C;  1P3M A;  3REH C;  3AZH D;  3REL B;  3REH D;  3MVD B;  4KGC C;  4KHA A;  5B32 C;  5B2I C;  5GT0 C;  3LZ1 C;  4KGC D;  3LZ0 B;  5AV9 D;  3C1C B;  5B32 D;  5B2I D;  5GT0 D;  3LZ1 D;  4J8X C;  3X1U A;  1P3B C;  4J8X D;  4HGA C;  3O62 A;  5CPJ C;  4WU8 B;  1P3B D;  5CPJ D;  1ID3 C;  5DNN A;  4JJN A;  1ID3 D;  3UTB A;  1WWI A;  4CAY A;  1P3O A;  4H9O A;  5B0Y B;  1P3M B;  3AZE A;  1P3A B;  1BFM A;  2IO5 C;  1P3P B;  3LJA B;  3UTA B;  2F8N H;  4CSR A;  3MGS B;  3WKJ B;  5BT1 C;  5G49 A;  3MNN B;  5BT1 D;  1AOI B;  2BYK A;  2L5A A;  5B1M A;  1KU5 A;  5DNN B;  5F99 B;  3MGQ B;  3B6F C;  3LEL C;  3WAA C;  2JSS A;  3MGP B;  3LEL D;  5BNV B;  1P3G C;  3WAA D;  3X1S C;  3AZE B;  3REI B;  1H3O A;  4KUD A;  1P3G D;  3X1S D;  3UT9 D;  3MGR C;  3AZI C;  3MGR D;  2NZD A;  3W96 A;  3VH6 A;  3AZI D;  3AZK A;  1P3K B;  5GXQ A;  4Z5T A;  4WZS B;  1TZY A;  2YFW B;  4UUZ B;  5B40 A;  1F66 B;  5B2J A;  5AVC B;  2NQB C;  3AN2 B;  1S32 B;  3REL C;  4WV4 B;  3WTP A;  3KSY A;  3MVD C;  2FJ7 B;  5AV8 B;  2NQB D;  2PYO A;  1BH8 A;  3REL D;  5B31 A;  3MVD D;  3C1C C;  3AYW A;  1H3O B;  4Z66 A;  4H9S C;  3AV2 C;  1P3I B;  3C1C D;  3AV2 D;  1M18 D;  4WU8 C;  4KGC A;  5AV9 A;  4WU8 D;  5GT0 A;  3B6G A;  3B0D B;  1P3L C;  4J8W A;  1P3B A;  3W97 A;  5AV5 B;  3AZG B;  1TZY B;  5CPJ A;  1P3L D;  5JRG A;  3AV1 A;  3AZN B;  1ID3 A;  4H9P A;  3KWQ B;  3REK A;  5CPK C;  1P3P C;  5KDM A;  3LJA C;  3UTA C;  5CPK D;  1TAF A;  4DRB A;  1P3P D;  3LJA D;  2CV5 C;  3AYW B;  3R45 A;  2F8N K;  3MNN C;  2CV5 D;  1U35 B;  3MNN D;  4H9R A;  5AY8 B;  2ARO A;  5F99 C;  5E5A C;  5F99 D;  5E5A D;  3W97 B;  4ZUX A;  4YM6 C;  3MGP C;  4E44 A;  1B6W A;  4YM6 D;  1M19 B;  3WTP E;  4H9P B;  5KDM B;  5B0Z B;  4QLC A;  5B33 B;  5C3I B;  4WU9 B;  3VH5 A; 
#chains in the Genus database with same CATH topology
 3WAA A;  4G91 B;  3KXB C;  5GT3 B;  3UT9 A;  3KXB D;  3AFA C;  3W98 B;  4H9R B;  2BYM A;  1T3U A;  1HQ3 B;  2Y2I A;  5CPI A;  2ARO B;  3AFA D;  5DNM C;  1F66 C;  5AVC C;  1F66 D;  5DNM D;  5AVC D;  4ZUX B;  2Y2J A;  5BNX B;  4YS3 C;  4J8U C;  2F8N D;  4ZBJ C;  5CP6 B;  4YS3 D;  1JFI B;  4J8U D;  2NQB A;  3A1K A;  3X1T B;  1ZLA A;  3C1B B;  3AZL B;  1P3F B;  4NE5 A;  3W99 B;  3AV2 A;  1M18 A;  4XZQ C;  4G92 B;  3WA9 B;  3A6N B;  5AV5 C;  4XZQ D;  2DQN C;  2J8P A;  5B24 B;  5CPI B;  5BS7 C;  4J8V B;  5AV5 D;  1KX4 C;  5BO0 B;  4H9Q A;  3NQJ B;  1KX4 D;  1P3L A;  3AZF A;  3TU4 C;  5GSU C;  3TU4 D;  3KUY B;  5GSU D;  1KX5 C;  4XUJ A;  5CPK A;  1KX5 D;  3AL0 C;  4X23 C;  4KHA B;  1BH9 A;  2CV5 A;  4LD9 A;  4X23 D;  4UPK A;  3X1U B;  4DQY B;  3O62 B;  1KX3 C;  1M19 C;  3X1V C;  5AVB A;  4R8P A;  1KX3 D;  4JJN B;  3X1V D;  5B1L A;  5C3I C;  4WU9 C;  4WNN A;  4YM6 A;  5JA4 A;  3REJ C;  4CAY B;  3UTB B;  1P3O B;  5FUG A;  4H9O B;  4WU9 D;  4G91 C;  3B6F D;  2F2A C;  3REJ D;  5GT3 C;  1ULY A;  4XUJ B;  3AZM C;  2YFV A;  5AV6 C;  3W98 C;  1EQZ C;  3AZJ C;  3AZM D;  4CSR B;  2ZY3 A;  1HQ3 C;  3FDD A;  5AV6 D;  2FFF B;  2HIO C;  3AZJ D;  1P34 C;  1EQZ D;  1WWS A;  2Y2M A;  1P34 D;  2HIO D;  4Z2M H;  5G49 B;  3KXB A;  4AWL C;  1M1A C;  3AFA A;  2BYK B;  3EPH A;  1M1A D;  5B1M B;  5CP6 C;  3VH6 T;  5B31 G;  5CP6 D;  3V9R A;  3X1T C;  2F8N A;  1P3F C;  3X1T D;  4YS3 A;  4J8U A;  1P3F D;  3W99 C;  3LZ0 C;  4DRA A;  1A7W A;  4EO5 B;  3AZH A;  4KUD B;  3A1I A;  3W99 D;  3LZ0 D;  3REH A;  3WA9 C;  3NQU A;  3VH6 W;  3WA9 D;  4M6B A;  4J8V C;  5CHL B;  2NZD B;  5B32 A;  3W96 B;  5B2I A;  3LZ1 A;  3AZK B;  4J8X A;  5GXQ B;  3B0B A;  4Z5T B;  5B0Y C;  3KUY C;  5B40 B;  1P3M C;  5B2J B;  3EG5 B;  5B0Y D;  1P3A C;  3KUY D;  1P3M D;  3V9R B;  4E45 A;  3WTP B;  2PYO B;  1P3A D;  3TU4 A;  1BH8 B;  5B31 B;  3MGS C;  2ZY4 A;  3UTA D;  3WKJ C;  4Z66 B;  3MGS D;  1KX5 A;  3REH B;  3WKJ D;  3O62 C;  1AOI C;  4KGC B;  4H9N A;  5AV9 B;  3O62 D;  1AOI D;  5GT0 B;  3F6T A;  3LZ1 B;  5DNN C;  2UWX A;  3MGQ C;  3B6G B;  4J8X B;  5DNN D;  4J8W B;  3KFU G;  3MGQ D;  1P3B B;  5CPJ B;  4HGA B;  1P3O C;  1KX3 A;  5JRG B;  3AV1 B;  3MGP D;  3AZE C;  3X1V A;  3REI C;  4NFT A;  1P3O D;  3REK B;  1ID3 B;  3EPJ A;  3AZE D;  2RVQ C;  3REI D;  3B6F A;  3LEL A;  1TAF B;  2XD1 A;  2RVQ D;  3REJ A;  3R45 B;  1P3G A;  3X1S A;  3AZM A;  5AV6 A;  1EQZ A;  1Q9C A;  3AZJ A;  3MGR A;  1P3K C;  1R4V A;  5B1M C;  3AZI A;  1P3K D;  5B1M D;  3AN2 C;  1S32 C;  1PZR A;  4NE6 A;  2FJ7 C;  5AV8 C;  3AN2 D;  1S32 D;  3H0L C;  2FJ7 D;  5AV8 D;  3VH5 W;  1P3I C;  4QLC B;  3REL A;  1P3I D;  3WAA B;  3MVD A;  4NE3 A;  3W96 C;  3LZ0 A;  3C1C A;  3UT9 B;  3AZK C;  2Y2L A;  4H9S A;  3B0D C;  3W96 D;  5GXQ C;  1Z2C B;  3MGR B;  2BYM B;  4Z5T C;  3AZG C;  1TZY C;  4WU8 A;  5B40 C;  5GXQ D;  5B2J C;  4Z5T D;  3AZG D;  1TZY D;  3AZN C;  2HUE B;  3KWQ C;  5B2J D;  2PYO C;  3AZN D;  3KWQ D;  5B31 C;  2PYO D;  3AYW C;  5B31 D;  4Z66 C;  2NQB B;  2W8S A;  3AYW D;  4Z66 D;  1P3A A;  1U35 C;  1P3P A;  3LJA A;  1ZLA B;  3UTA A;  5AV9 C;  1U35 D;  3MGS A;  5AY8 C;  3AV2 B;  1M18 B;  3B6G C;  3WKJ A;  3B0C T;  5AY8 D;  4J8W C;  3MNN A;  3B6G D;  3W97 C;  1AOI A;  4J8W D;  2LY8 A;  3W97 D;  5JRG C;  3AV1 C;  4H9Q B;  3REK C;  2CWE A;  5F99 A;  5JRG D;  3MGQ A;  5E5A A;  5B0Z C;  3AV1 D;  1M19 D;  5B33 C;  3AZF B;  3REK D;  1P3L B;  3B0C W;  5B0Z D;  5B33 D;  3MGP A;  5BNV A;  2Y2N A;  3REI A;  5CPK B;  5GT3 D;  2DF4 C;  2ARO C;  3W98 D;  1BH9 B;  2CV5 B;  4LD9 B;  1HQ3 D;  2ARO D;  4ZUX C;  1P3K A;  1N1J A;  4ZUX D;  2YFW A;  4UUZ A;  1F66 A;  5DNM A;  5AVB B;  4R8P B;  5AVC A;  2F8N G;  5E5A B;  4QLC C;  3EPK A;  5B1L B;  3AN2 A;  1S32 A;  4WNN B;  2FJ7 A;  4QLC D;  4YM6 B;  5JA4 B;  5AV8 A;  3C1B C;  3AZL C;  5FUG B;  3C1B D;  3AZL D;  3UT9 C;  1P3I A;  2YFV B;  2XD5 A;  4G92 C;  5B32 G;  3A6N C;  2Y2P A;  5CPI C;  1B67 A;  5B24 C;  3A6N D;  5B24 D;  5CPI D;  2HUE C;  3KXB B;  4J8V D;  4XZQ A;  3AFA B;  1N1J B;  5AV5 A;  3AZG A;  5BS7 A;  5DNM B;  1KX4 A;  3AZN A;  3KWQ A;  1ZLA C;  2F8N B;  4Z2M G;  1F1E A;  5GSU A;  4J8U B;  4YS3 B;  1ZLA D;  1M18 C;  4ZBJ B;  3AZH B;  3X1U C;  1U35 A;  3NQU B;  3X1U D;  4X23 A;  5B32 B;  5AY8 A;  5B2I B;  4JJN C;  4XZQ B;  3AZF C;  4JJN D;  3UTB C;  3AZF D;  2ZY2 A;  3UTB D;  1KX4 B;  1M19 A;  4XUJ C;  2ZY5 A;  2G5I C;  5B0Z A;  4XUJ D;  5B33 A;  3TU4 B;  4WU9 A;  5GSU B;  4LD9 C;  1KX5 B;  5GT3 A;  4LD9 D;  2IO5 B;  1HTA A;  3W98 A;  4H9N B;  4X23 B;  1HQ3 A;  3VH5 T;  1P34 A;  2HIO A;  4R8P C;  2JE5 A;  5AVB C;  2ZM5 A;  5B1L C;  5AVB D;  4R8P D;  5B1L D;  2JCH A;  1M1A A;  5BNX A;  1KX3 B;  3X1V B;  4EO5 C;  5CP6 A;  1JFI A;  4KUD C;  4WJ3 C;  3B6F B;  3LEL B;  4KUD D;  3X1T A;  3C1B A;  3REJ B;  3AZL A;  1P3F A;  2NZD C;  1P3G B;  3X1S B;  3W99 A;  2NZD D;  3AZM B;  5AV6 B;  3WA9 A;  3A6N A;  1EQZ B;  3AZJ B;  3AZK D;  5B24 A;  1P34 B;  2HIO B;  4J8V A;  3AZI B;  5BO0 A;  3NQJ A;  5B40 D;  4AWL B;  3WTP C;  3EPL A;  1M1A B;  3H0M C;  3WTP D;  5B0Y A;  3KUY A;  3AZH C;  1P3M A;  3REH C;  3AZH D;  3REL B;  3REH D;  3MVD B;  4KGC C;  4KHA A;  5B32 C;  5B2I C;  5GT0 C;  3LZ1 C;  4KGC D;  3LZ0 B;  5AV9 D;  3C1C B;  5B32 D;  5B2I D;  5GT0 D;  3LZ1 D;  4J8X C;  3X1U A;  1P3B C;  4J8X D;  4HGA C;  3O62 A;  5CPJ C;  4WU8 B;  2Y2Q A;  1P3B D;  5CPJ D;  2RIQ A;  1ID3 C;  5DNN A;  4JJN A;  1ID3 D;  3UTB A;  1WWI A;  4CAY A;  1P3O A;  4H9O A;  5B0Y B;  1P3M B;  3AZE A;  1P3A B;  1BFM A;  2IO5 C;  1P3P B;  3LJA B;  3UTA B;  2F8N H;  4CSR A;  3MGS B;  2Y2K A;  3WKJ B;  5BT1 C;  5G49 A;  3MNN B;  5BT1 D;  1AOI B;  2BYK A;  2L5A A;  5B1M A;  1KU5 A;  5DNN B;  5F99 B;  3MGQ B;  3B6F C;  3LEL C;  3WAA C;  2JSS A;  3P5J B;  3MGP B;  3LEL D;  5BNV B;  1P3G C;  3WAA D;  3X1S C;  3AZE B;  3REI B;  1H3O A;  4KUD A;  1P3G D;  3X1S D;  3UT9 D;  3MGR C;  2Y2G A;  3AZI C;  3MGR D;  2NZD A;  3W96 A;  3VH6 A;  3AZI D;  2G5H C;  3AZK A;  2VQR A;  1P3K B;  5GXQ A;  4Z5T A;  4WZS B;  1TZY A;  2YFW B;  4UUZ B;  5B40 A;  1F66 B;  5B2J A;  5AVC B;  2NQB C;  3AN2 B;  1S32 B;  3REL C;  4WV4 B;  3WTP A;  3KSY A;  3MVD C;  2FJ7 B;  5AV8 B;  2NQB D;  2PYO A;  1BH8 A;  3REL D;  5B31 A;  3MVD D;  3C1C C;  3AYW A;  1H3O B;  4Z66 A;  4H9S C;  3AV2 C;  1P3I B;  3C1C D;  3AV2 D;  1M18 D;  4WU8 C;  4KGC A;  5AV9 A;  2Y2H A;  4WU8 D;  5GT0 A;  3B6G A;  3B0D B;  1P3L C;  4J8W A;  1P3B A;  3W97 A;  5AV5 B;  3AZG B;  1TZY B;  5CPJ A;  1P3L D;  5JRG A;  3AV1 A;  3IP4 C;  2BG1 A;  3AZN B;  1ID3 A;  4H9P A;  3KWQ B;  3REK A;  5CPK C;  1W2E A;  1P3P C;  5KDM A;  3LJA C;  3UTA C;  5CPK D;  1TAF A;  4DRB A;  1P3P D;  3LJA D;  2CV5 C;  3AYW B;  2Y2O A;  3R45 A;  2F8N K;  3MNN C;  2CV5 D;  1U35 B;  3MNN D;  4H9R A;  3H0R C;  5AY8 B;  2ARO A;  5F99 C;  5E5A C;  5F99 D;  5E5A D;  3W97 B;  4ZUX A;  4YM6 C;  3MGP C;  4E44 A;  1B6W A;  4YM6 D;  1M19 B;  3WTP E;  4H9P B;  5KDM B;  5B0Z B;  4QLC A;  5B33 B;  5C3I B;  4WU9 B;  3VH5 A; 
#chains in the Genus database with same CATH homology
 3WAA A;  4G91 B;  3KXB C;  5GT3 B;  3UT9 A;  3KXB D;  3AFA C;  3W98 B;  4H9R B;  2BYM A;  1T3U A;  1HQ3 B;  2Y2I A;  5CPI A;  2ARO B;  3AFA D;  5DNM C;  1F66 C;  5AVC C;  1F66 D;  5DNM D;  5AVC D;  4ZUX B;  2Y2J A;  5BNX B;  4YS3 C;  4J8U C;  2F8N D;  4ZBJ C;  5CP6 B;  4YS3 D;  1JFI B;  4J8U D;  2NQB A;  3A1K A;  3X1T B;  1ZLA A;  3C1B B;  3AZL B;  1P3F B;  4NE5 A;  3W99 B;  3AV2 A;  1M18 A;  4XZQ C;  4G92 B;  3WA9 B;  3A6N B;  5AV5 C;  4XZQ D;  2DQN C;  2J8P A;  5B24 B;  5CPI B;  5BS7 C;  4J8V B;  5AV5 D;  1KX4 C;  5BO0 B;  4H9Q A;  3NQJ B;  1KX4 D;  1P3L A;  3AZF A;  3TU4 C;  5GSU C;  3TU4 D;  3KUY B;  5GSU D;  1KX5 C;  4XUJ A;  5CPK A;  1KX5 D;  3AL0 C;  4X23 C;  4KHA B;  1BH9 A;  2CV5 A;  4LD9 A;  4X23 D;  4UPK A;  3X1U B;  4DQY B;  3O62 B;  1KX3 C;  1M19 C;  3X1V C;  5AVB A;  4R8P A;  1KX3 D;  4JJN B;  3X1V D;  5B1L A;  5C3I C;  4WU9 C;  4WNN A;  4YM6 A;  5JA4 A;  3REJ C;  4CAY B;  3UTB B;  1P3O B;  5FUG A;  4H9O B;  4WU9 D;  4G91 C;  3B6F D;  2F2A C;  3REJ D;  5GT3 C;  1ULY A;  4XUJ B;  3AZM C;  2YFV A;  5AV6 C;  3W98 C;  1EQZ C;  3AZJ C;  3AZM D;  4CSR B;  2ZY3 A;  1HQ3 C;  3FDD A;  5AV6 D;  2FFF B;  2HIO C;  3AZJ D;  1P34 C;  1EQZ D;  1WWS A;  2Y2M A;  1P34 D;  2HIO D;  4Z2M H;  5G49 B;  3KXB A;  4AWL C;  1M1A C;  3AFA A;  2BYK B;  3EPH A;  1M1A D;  5B1M B;  5CP6 C;  3VH6 T;  5B31 G;  5CP6 D;  3V9R A;  3X1T C;  2F8N A;  1P3F C;  3X1T D;  4YS3 A;  4J8U A;  1P3F D;  3W99 C;  3LZ0 C;  4DRA A;  1A7W A;  4EO5 B;  3AZH A;  4KUD B;  3A1I A;  3W99 D;  3LZ0 D;  3REH A;  3WA9 C;  3NQU A;  3VH6 W;  3WA9 D;  4M6B A;  4J8V C;  5CHL B;  2NZD B;  5B32 A;  3W96 B;  5B2I A;  3LZ1 A;  3AZK B;  4J8X A;  5GXQ B;  3B0B A;  4Z5T B;  5B0Y C;  3KUY C;  5B40 B;  1P3M C;  5B2J B;  3EG5 B;  5B0Y D;  1P3A C;  3KUY D;  1P3M D;  3V9R B;  4E45 A;  3WTP B;  2PYO B;  1P3A D;  3TU4 A;  1BH8 B;  5B31 B;  3MGS C;  2ZY4 A;  3UTA D;  3WKJ C;  4Z66 B;  3MGS D;  1KX5 A;  3REH B;  3WKJ D;  3O62 C;  1AOI C;  4KGC B;  4H9N A;  5AV9 B;  3O62 D;  1AOI D;  5GT0 B;  3F6T A;  3LZ1 B;  5DNN C;  2UWX A;  3MGQ C;  3B6G B;  4J8X B;  5DNN D;  4J8W B;  3KFU G;  3MGQ D;  1P3B B;  5CPJ B;  4HGA B;  1P3O C;  1KX3 A;  5JRG B;  3AV1 B;  3MGP D;  3AZE C;  3X1V A;  3REI C;  4NFT A;  1P3O D;  3REK B;  1ID3 B;  3EPJ A;  3AZE D;  2RVQ C;  3REI D;  3B6F A;  3LEL A;  1TAF B;  2XD1 A;  2RVQ D;  3REJ A;  3R45 B;  1P3G A;  3X1S A;  3AZM A;  5AV6 A;  1EQZ A;  1Q9C A;  3AZJ A;  3MGR A;  1P3K C;  1R4V A;  5B1M C;  3AZI A;  1P3K D;  5B1M D;  3AN2 C;  1S32 C;  1PZR A;  4NE6 A;  2FJ7 C;  5AV8 C;  3AN2 D;  1S32 D;  3H0L C;  2FJ7 D;  5AV8 D;  3VH5 W;  1P3I C;  4QLC B;  3REL A;  1P3I D;  3WAA B;  3MVD A;  4NE3 A;  3W96 C;  3LZ0 A;  3C1C A;  3UT9 B;  3AZK C;  2Y2L A;  4H9S A;  3B0D C;  3W96 D;  5GXQ C;  1Z2C B;  3MGR B;  2BYM B;  4Z5T C;  3AZG C;  1TZY C;  4WU8 A;  5B40 C;  5GXQ D;  5B2J C;  4Z5T D;  3AZG D;  1TZY D;  3AZN C;  2HUE B;  3KWQ C;  5B2J D;  2PYO C;  3AZN D;  3KWQ D;  5B31 C;  2PYO D;  3AYW C;  5B31 D;  4Z66 C;  2NQB B;  2W8S A;  3AYW D;  4Z66 D;  1P3A A;  1U35 C;  1P3P A;  3LJA A;  1ZLA B;  3UTA A;  5AV9 C;  1U35 D;  3MGS A;  5AY8 C;  3AV2 B;  1M18 B;  3B6G C;  3WKJ A;  3B0C T;  5AY8 D;  4J8W C;  3MNN A;  3B6G D;  3W97 C;  1AOI A;  4J8W D;  2LY8 A;  3W97 D;  5JRG C;  3AV1 C;  4H9Q B;  3REK C;  2CWE A;  5F99 A;  5JRG D;  3MGQ A;  5E5A A;  5B0Z C;  3AV1 D;  1M19 D;  5B33 C;  3AZF B;  3REK D;  1P3L B;  3B0C W;  5B0Z D;  5B33 D;  3MGP A;  5BNV A;  2Y2N A;  3REI A;  5CPK B;  5GT3 D;  2DF4 C;  2ARO C;  3W98 D;  1BH9 B;  2CV5 B;  4LD9 B;  1HQ3 D;  2ARO D;  4ZUX C;  1P3K A;  1N1J A;  4ZUX D;  2YFW A;  4UUZ A;  1F66 A;  5DNM A;  5AVB B;  4R8P B;  5AVC A;  2F8N G;  5E5A B;  4QLC C;  3EPK A;  5B1L B;  3AN2 A;  1S32 A;  4WNN B;  2FJ7 A;  4QLC D;  4YM6 B;  5JA4 B;  5AV8 A;  3C1B C;  3AZL C;  5FUG B;  3C1B D;  3AZL D;  3UT9 C;  1P3I A;  2YFV B;  2XD5 A;  4G92 C;  5B32 G;  3A6N C;  2Y2P A;  5CPI C;  1B67 A;  5B24 C;  3A6N D;  5B24 D;  5CPI D;  2HUE C;  3KXB B;  4J8V D;  4XZQ A;  3AFA B;  1N1J B;  5AV5 A;  3AZG A;  5BS7 A;  5DNM B;  1KX4 A;  3AZN A;  3KWQ A;  1ZLA C;  2F8N B;  4Z2M G;  1F1E A;  5GSU A;  4J8U B;  4YS3 B;  1ZLA D;  1M18 C;  4ZBJ B;  3AZH B;  3X1U C;  1U35 A;  3NQU B;  3X1U D;  4X23 A;  5B32 B;  5AY8 A;  5B2I B;  4JJN C;  4XZQ B;  3AZF C;  4JJN D;  3UTB C;  3AZF D;  2ZY2 A;  3UTB D;  1KX4 B;  1M19 A;  4XUJ C;  2ZY5 A;  2G5I C;  5B0Z A;  4XUJ D;  5B33 A;  3TU4 B;  4WU9 A;  5GSU B;  4LD9 C;  1KX5 B;  5GT3 A;  4LD9 D;  2IO5 B;  1HTA A;  3W98 A;  4H9N B;  4X23 B;  1HQ3 A;  3VH5 T;  1P34 A;  2HIO A;  4R8P C;  2JE5 A;  5AVB C;  2ZM5 A;  5B1L C;  5AVB D;  4R8P D;  5B1L D;  2JCH A;  1M1A A;  5BNX A;  1KX3 B;  3X1V B;  4EO5 C;  5CP6 A;  1JFI A;  4KUD C;  4WJ3 C;  3B6F B;  3LEL B;  4KUD D;  3X1T A;  3C1B A;  3REJ B;  3AZL A;  1P3F A;  2NZD C;  1P3G B;  3X1S B;  3W99 A;  2NZD D;  3AZM B;  5AV6 B;  3WA9 A;  3A6N A;  1EQZ B;  3AZJ B;  3AZK D;  5B24 A;  1P34 B;  2HIO B;  4J8V A;  3AZI B;  5BO0 A;  3NQJ A;  5B40 D;  4AWL B;  3WTP C;  3EPL A;  1M1A B;  3H0M C;  3WTP D;  5B0Y A;  3KUY A;  3AZH C;  1P3M A;  3REH C;  3AZH D;  3REL B;  3REH D;  3MVD B;  4KGC C;  4KHA A;  5B32 C;  5B2I C;  5GT0 C;  3LZ1 C;  4KGC D;  3LZ0 B;  5AV9 D;  3C1C B;  5B32 D;  5B2I D;  5GT0 D;  3LZ1 D;  4J8X C;  3X1U A;  1P3B C;  4J8X D;  4HGA C;  3O62 A;  5CPJ C;  4WU8 B;  2Y2Q A;  1P3B D;  5CPJ D;  2RIQ A;  1ID3 C;  5DNN A;  4JJN A;  1ID3 D;  3UTB A;  1WWI A;  4CAY A;  1P3O A;  4H9O A;  5B0Y B;  1P3M B;  3AZE A;  1P3A B;  1BFM A;  2IO5 C;  1P3P B;  3LJA B;  3UTA B;  2F8N H;  4CSR A;  3MGS B;  2Y2K A;  3WKJ B;  5BT1 C;  5G49 A;  3MNN B;  5BT1 D;  1AOI B;  2BYK A;  2L5A A;  5B1M A;  1KU5 A;  5DNN B;  5F99 B;  3MGQ B;  3B6F C;  3LEL C;  3WAA C;  2JSS A;  3P5J B;  3MGP B;  3LEL D;  5BNV B;  1P3G C;  3WAA D;  3X1S C;  3AZE B;  3REI B;  1H3O A;  4KUD A;  1P3G D;  3X1S D;  3UT9 D;  3MGR C;  2Y2G A;  3AZI C;  3MGR D;  2NZD A;  3W96 A;  3VH6 A;  3AZI D;  2G5H C;  3AZK A;  2VQR A;  1P3K B;  5GXQ A;  4Z5T A;  4WZS B;  1TZY A;  2YFW B;  4UUZ B;  5B40 A;  1F66 B;  5B2J A;  5AVC B;  2NQB C;  3AN2 B;  1S32 B;  3REL C;  4WV4 B;  3WTP A;  3KSY A;  3MVD C;  2FJ7 B;  5AV8 B;  2NQB D;  2PYO A;  1BH8 A;  3REL D;  5B31 A;  3MVD D;  3C1C C;  3AYW A;  1H3O B;  4Z66 A;  4H9S C;  3AV2 C;  1P3I B;  3C1C D;  3AV2 D;  1M18 D;  4WU8 C;  4KGC A;  5AV9 A;  2Y2H A;  4WU8 D;  5GT0 A;  3B6G A;  3B0D B;  1P3L C;  4J8W A;  1P3B A;  3W97 A;  5AV5 B;  3AZG B;  1TZY B;  5CPJ A;  1P3L D;  5JRG A;  3AV1 A;  3IP4 C;  2BG1 A;  3AZN B;  1ID3 A;  4H9P A;  3KWQ B;  3REK A;  5CPK C;  1W2E A;  1P3P C;  5KDM A;  3LJA C;  3UTA C;  5CPK D;  1TAF A;  4DRB A;  1P3P D;  3LJA D;  2CV5 C;  3AYW B;  2Y2O A;  3R45 A;  2F8N K;  3MNN C;  2CV5 D;  1U35 B;  3MNN D;  4H9R A;  3H0R C;  5AY8 B;  2ARO A;  5F99 C;  5E5A C;  5F99 D;  5E5A D;  3W97 B;  4ZUX A;  4YM6 C;  3MGP C;  4E44 A;  1B6W A;  4YM6 D;  1M19 B;  3WTP E;  4H9P B;  5KDM B;  5B0Z B;  4QLC A;  5B33 B;  5C3I B;  4WU9 B;  3VH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...