5CPKB

Nucleosome containing methylated sat2l dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkB00
4J8XC 5G49B 5B1LB 3KXBA 3C1BD 3KUYD 1BH8A 1F66A 4WU8B 2CWEA 1AOIC 1P3PC 2BYMB 3KWQD 5BS7C 5AV6B 2NZDD 4H9NA 1M18C 5B24B 1U35D 3VH5A 5F99D 3WA9B 1P3KC 5GT3C 1P3MB 5C3IB 5B40A 3KUYB 5B1MC 1TAFB 3MGPB 1P3IC 3W98C 5B32D 5B31D 4JJNC 3WTPC 2NQBC 3AFAA 5B33A 3AZMD 2NZDB 4LD9A 5DNNA 1KX4D 1U35B 1P3BB 2HUEC 2BYKB 3LJAD 4KHAB 4R8PB 3AZHC 1KX5C 5CPIA 3KXBC 1BH9A 1S32A 5B32B 5B31B 4YM6A 2CV5C 3LELC 4M6BA 1HQ3A 3UTBA 5B0ZA 4QLCC 4WNNA 4CAYA 5JRGD 3W99D 1KX3C 3LJAB 5JA4B 3MNNA 3REHD 1P3LC 3AFAC 5B33C 4H9OA 1EQZD 4WU9B 1Q9CA 5CHLB 3X1TA 3AZND 3W99B 4XUJA 3REKC 4Z66A 2FJ7C 3LZ1D 3REHB 3MGQC 4J8VB 4KGCC 4Z5TA 5AY8A 3WTPE 5AV9A 5BO0A 3AZLC 4WV4B 5DNMB 3RELD 3TU4C 5AVBD 5BNVB 2HIOB 5CPJA 1M1AB 5GXQC 1ZLAD 3AZID 5F99A 3B6FB 1HTAA 4ZBJC 3C1CA 3AZKA 3AZEA 4NFTA 5AV8D 3AZJB 3AV1A 3AV2B 4NE5A 4YS3C 3RELB 3X1UB 2CV5D 3KSYA 3REIB 1B67A 5B2JA 5E5AB 3AYWD 3X1VA 2IO5C 4KUDA 5AV6C 1ZLAB 5B24C 3AZIB 2RVQC 1P3OA 5CPKA 3WA9C 4HGAB 5AV8B 3WAAB 1P3MC 5AY8C 5AV9C 5GT0D 3C1BC 3W97B 3KUYC 3AYWB 3W96A 3AZFD 3B0CT 3KWQC 2NZDC 4H9PA 4H9QB 4E44A 1U35C 5F99C 3MVDD 2AROA 5BNXA 4J8UA 2FJ7D 5B2ID 4R8PC 5KDMB 5B32C 5B31C 3WKJA 5CP6D 3AZMC 1KX4C 4J8XA 4XZQB 4ZUXB 3MGSD 5B0YD 1F66B 3REJD 1AOIA 1P3PA 4EO5B 5BS7A 3B0CW 3LJAC 4H9NB 3B0DB 1M18A 3LZ1A 2F8NB 5CP6B 3B6GD 1P3KA 5GT3A 1N1JB 3O62D 2F8ND 5B40B 5B0YB 5B1MA 5B1LD 1P3IA 4UUZB 3REJB 3W98A 3X1SD 5AVBA 3WTPA 4JJNA 5JRGC 3W99C 4AWLC 4WU8D 4LD9B 3A6NB 1ID3D 5B24D 4CSRA 3REHC 3B6GB 1EQZC 3AZHA 1KX5A 5CPIB 2YFWA 3X1SB 3MGPD 2CV5A 3LELA 3AZNC 3AZGD 1P3GD 3UTBB 5B0ZB 1P3FB 4QLCA 1ID3B 3LZ1C 1M19B 4H9RB 3NQJB 4CAYB 3R45A 1P3BD 1KX3A 3V9RA 4R8PD 3AZJC 4NE3A 3RELC 4G92B 5AVBC 1P3LA 3REIC 3AZFA 5E5AC 3AZGB 1P3GB 1ZLAC 3AZIC 4XUJB 3REKA 4HGAC 5AV8C 2FJ7A 3WAAC 5B2IA 3MGQA 4KGCA 1TZYD 3AYWC 3VH6A 4G91B 5FUGB 4WU9D 5AVCB 5AV5D 5BO0B 3AZLA 3TU4A 1P34B 5GT0C 3VH5W 5GXQA 1TZYB 4J8VD 4X23B 3AZFC 3AZKB 3AZEB 5AV5B 4YS3A 5G49A 4XZQC 5DNMD 3X1VB 5B2JB 3MVDC 2HIOD 2BYMA 5B2IC 5AV6A 1BFMA 1M1AD 1R4VA 5B24A 3LZ0D 4J8WB 1B6WA 3B6FD 5GSUD 5CP6C 3WA9A 3AZJD 3B0BA 3NQUB 3AV2D 1P3MA 3MGSC 3C1BA 5B0YC 3X1UD 3KUYA 1TAFA 3REID 5E5AD 3REJC 4H9SC 3KWQA 3UTAD 2NZDA 3AN2D 4H9PB 1U35A 2PYOD 3LZ0B 3UT9D 5GSUB 3B6GC 4DRAA 4NE6A 1ULYA 4J8UB 2BYKA 3WAAD 3O62C 4KHAA 4R8PA 5B1LC 3W97D 1KU5A 5B32A 5B31A 3X1SC 4WU8C 3UTAB 3AZMA 3AN2B 1KX4A 1ID3C 2PYOB 4J8XB 3UT9B 2L5AA 1M19C 1P3PB 1JFIB 3LJAA 5C3IC 5JA4A 4Z2MG 4DRBA 3MGPC 4G92C 1P3KB 3MGRD 1P3AD 3AZGC 1P3GC 4WU9A 4XZQD 4ZUXD 1F66D 1H3OB 1P3IB 4JJNB 3WTPB 2NQBB 5BT1D 5JRGA 1P3BC 3W99A 4CSRB 3REHA 4J8VA 3MGRB 1P3AB 1EQZA 2HUEB 4WZSB 3AZHB 5B40D 3KXBB 1BH8B 2YFVA 3AZNA 5BNVA 4LD9D 3A6ND 2LY8A 1P34C 5DNND 1M1AA 1TZYC 3B6FA 3R45B 3V9RB 4WU9C 3AZJA 5AV5C 5CPID 3RELA 1S32D 4YM6D 1P3LB 3REIA 3AFAB 4Z2MH 5E5AA 5B33B 1HQ3D 5DNNB 5B0ZD 3UTBD 1P3FD 1ZLAA 4J8VC 3AZIA 1M19D 3REKB 5AV8A 3WAAA 1BH9B 1S32B 3MGQB 4YM6B 3MNND 3W97A 5DNMC 4KGCB 3AYWA 2HIOC 1HQ3B 4WNNB 1M1AC 4H9QA 3AZLB 3X1TD 3LZ0C 3B6FC 5GSUC 4XUJD 3AV2C 5GT0A 5KDMA 3MNNB 5GXQB 3X1UC 4ZBJB 4H9OB 4Z5TD 3VH5T 3UTAC 3AN2C 4E45A 5AVCD 3X1TB 2PYOC 4XZQA 3UT9C 4ZUXA 3MVDA 2IO5B 4Z66B 1P34D 5CPJD 3W97C 4X23D 4Z5TB 5CP6A 3C1CD 3AZKD 3AZED 1N1JA 3AV1D 5AY8B 5AV9B 3MGSA 3C1BB 5B0YA 3X1VD 4UUZA 5B2JD 3REJA 2F8NG 4H9SA 3KWQB 4KUDD 3A6NA 5CPJB 3VH6T 5F99B 4J8WD 1P3OD 3B6GA 3C1CB 5CPKD 3MGRC 1P3AC 3AV1B 3O62A 2F8NA 5B1LA 4ZUXC 1F66C 3W96D 3X1SA 4WU8A 5BT1C 4KUDB 3AZMB 4EO5C 1P3FA 1KX4B 3B0DC 1ID3A 1P3OB 5CPKB 1M19A 2AROD 4H9RA 3NQJA 4J8UD 5B40C 3W96B 3MGPA 3VH6W 3WKJD 3AZGA 1P3GA 4LD9C 3A6NC 5DNNC 5B32G 5B31G 4J8XD 2AROB 5JRGB 4AWLB 1P3BA 1P3PD 5BNXB 1AOID 2F8NH 5CPIC 1M18D 1S32C 4YM6C 3WKJB 2JSSA 1P3KD 5FUGA 1EQZB 5GT3D 1HQ3C 3UTBC 5B0ZC 1P3FC 5AVCA 5B1MD 2YFVB 1P3ID 3W98D 3AZNB 1AOIB 4JJND 3WTPD 4YS3B 2NQBD 1P34A 1M18B 3LZ1B 1F1EA 3MNNC 1TZYA 4X23A 5GT3B 1WWSA 3AZHD 1KX5D 5AV5A 5B1MB 3KXBD 3X1TC 3W98B 5AVBB 3LELD 4XUJC 4Z66C 4QLCD 4J8WA 4G91C 4Z5TC 1KX3D 1KX5B 5AVCC 2YFWB 3NQUA 2CV5B 5DNMA 1WWIA 3LELB 1P3LD 3AFAD 5B33D 2HIOA 4QLCB 5CPJC 3LZ0A 4X23C 1A7WA 5GSUA 1KX3B 3C1CC 3AZKC 3REKD 3AZEC 3AV1C 3AV2A 5GT0B 3MGQD 3X1UA 4KGCD 3X1VC 3AZFB 5B2JC 3UTAA 4KUDC 3AN2A 2PYOA 3AZLD 3UT9A 4J8WC 3TU4D 1P3OC 5CPKC 3MVDB 1JFIA 2FJ7B 5B2IB 5GXQD 3W96C 4YS3D 3MGSB 3TU4B 1H3OA 2AROC 2NQBA 4Z66D 4J8UC 5AV6D 2RVQD 3WKJC 3MGRA 3WA9D 1P3AA 2F8NK 3O62B 1P3MD 5AY8D 5AV9D
chains in the Genus database with same CATH superfamily
4J8XC 5G49B 5B1LB 3KXBA 3C1BD 3KUYD 1BH8A 1F66A 4WU8B 2CWEA 1AOIC 1P3PC 2BYMB 3KWQD 5BS7C 5AV6B 2NZDD 3EPHA 4H9NA 1M18C 5B24B 1U35D 3VH5A 5F99D 3WA9B 1P3KC 5GT3C 2Y2KA 1P3MB 5C3IB 2DQNC 5B40A 3KUYB 5B1MC 1TAFB 3MGPB 1P3IC 3W98C 5B32D 5B31D 4JJNC 3WTPC 2NQBC 3AFAA 5B33A 3AZMD 2NZDB 4LD9A 5DNNA 1KX4D 1U35B 2Y2HA 1P3BB 2HUEC 2BYKB 3LJAD 4KHAB 4R8PB 3AZHC 1KX5C 5CPIA 3KXBC 1BH9A 1S32A 5B32B 5B31B 4YM6A 2CV5C 3LELC 4M6BA 1HQ3A 2VQRA 5B0ZA 3UTBA 4QLCC 4WNNA 4CAYA 5JRGD 3W99D 1KX3C 3LJAB 5JA4B 3MNNA 3REHD 2Y2GA 1P3LC 3AFAC 5B33C 4H9OA 1EQZD 4WU9B 1Q9CA 5CHLB 2XD5A 3X1TA 3AZND 3W99B 4XUJA 3REKC 2Y2NA 4Z66A 2FJ7C 3LZ1D 3REHB 3MGQC 4J8VB 4KGCC 4Z5TA 5AY8A 5AV9A 5BO0A 3WTPE 3AZLC 4WV4B 5DNMB 3RELD 3TU4C 5AVBD 5BNVB 2HIOB 5CPJA 1M1AB 5GXQC 1ZLAD 3AZID 5F99A 3B6FB 1HTAA 4ZBJC 3C1CA 3AZKA 3AZEA 4NFTA 5AV8D 3AZJB 3AV1A 3AV2B 4NE5A 4YS3C 2BG1A 3RELB 3X1UB 2CV5D 3KSYA 3REIB 1B67A 5B2JA 5E5AB 3AYWD 3X1VA 2IO5C 4KUDA 5AV6C 1ZLAB 5B24C 3AZIB 2RVQC 1P3OA 5CPKA 3WA9C 4HGAB 5AV8B 3WAAB 1P3MC 5AY8C 5AV9C 5GT0D 3C1BC 3W97B 3KUYC 3AYWB 3W96A 3AZFD 3B0CT 3KWQC 2NZDC 4H9PA 4H9QB 4E44A 1U35C 5F99C 3MVDD 2AROA 5BNXA 4J8UA 2FJ7D 5B2ID 4R8PC 5KDMB 3EG5B 5B32C 5B31C 3WKJA 5CP6D 3AZMC 1KX4C 2F2AC 4J8XA 4XZQB 4ZUXB 3MGSD 5B0YD 1F66B 3REJD 1AOIA 1P3PA 4EO5B 5BS7A 3B0CW 3LJAC 4H9NB 3B0DB 1M18A 3LZ1A 2F8NB 5CP6B 3B6GD 2Y2QA 1P3KA 5GT3A 1N1JB 3EPLA 3O62D 2F8ND 5B40B 5B0YB 5B1MA 5B1LD 1P3IA 4UUZB 3REJB 3W98A 3X1SD 5AVBA 3WTPA 4JJNA 5JRGC 3W99C 4AWLC 4WU8D 4LD9B 3A6NB 2ZY3A 1ID3D 5B24D 4CSRA 3REHC 3B6GB 1EQZC 3AZHA 1KX5A 5CPIB 2YFWA 3X1SB 3MGPD 2CV5A 3LELA 3AZNC 2Y2JA 3AZGD 1P3GD 3UTBB 5B0ZB 1P3FB 4QLCA 1ID3B 3LZ1C 1M19B 4H9RB 3NQJB 4CAYB 3R45A 1P3BD 1KX3A 3V9RA 4R8PD 3AZJC 4NE3A 3RELC 4G92B 5AVBC 1P3LA 3REIC 3AZFA 5E5AC 3AZGB 1P3GB 1ZLAC 3AZIC 4XUJB 3REKA 4HGAC 2ZY4A 5AV8C 2FJ7A 3WAAC 5B2IA 3MGQA 4KGCA 1TZYD 3AYWC 3VH6A 4G91B 5FUGB 2Y2MA 3EPKA 4WU9D 5AVCB 5AV5D 5BO0B 3AZLA 3TU4A 1P34B 3AL0C 5GT0C 3VH5W 5GXQA 1TZYB 4J8VD 4X23B 3AZFC 3AZKB 3AZEB 5AV5B 4YS3A 5G49A 4XZQC 5DNMD 3X1VB 5B2JB 3MVDC 2HIOD 2BYMA 5B2IC 5AV6A 1BFMA 1M1AD 1R4VA 5B24A 3LZ0D 4J8WB 1B6WA 3B6FD 5GSUD 5CP6C 3WA9A 3AZJD 3B0BA 3NQUB 2ZM5A 3AV2D 1P3MA 3MGSC 3C1BA 5B0YC 3X1UD 3KUYA 1TAFA 3REID 5E5AD 3REJC 4H9SC 3KWQA 3UTAD 2NZDA 3AN2D 4H9PB 1U35A 2PYOD 3LZ0B 3UT9D 5GSUB 3B6GC 4DRAA 3FDDA 4NE6A 1ULYA 4J8UB 2BYKA 3WAAD 3O62C 4KHAA 4R8PA 5B1LC 3W97D 1KU5A 2UWXA 5B32A 5B31A 3X1SC 4WU8C 3UTAB 3AZMA 2G5IC 3AN2B 1KX4A 1ID3C 2PYOB 4J8XB 3UT9B 2L5AA 1M19C 1P3PB 1JFIB 3LJAA 5C3IC 5JA4A 4Z2MG 4DRBA 3MGPC 4G92C 1P3KB 3MGRD 1P3AD 3AZGC 2Y2IA 1P3GC 4WU9A 4DQYB 4XZQD 4ZUXD 1F66D 1H3OB 1P3IB 4JJNB 3WTPB 2NQBB 5BT1D 5JRGA 1P3BC 3W99A 4CSRB 3REHA 4J8VA 3MGRB 1P3AB 1EQZA 2HUEB 4WZSB 3AZHB 5B40D 3KXBB 1BH8B 2YFVA 3AZNA 5BNVA 2Y2LA 4LD9D 3A6ND 2LY8A 1P34C 5DNND 1M1AA 1TZYC 3B6FA 3R45B 3V9RB 4WU9C 3AZJA 5AV5C 5CPID 3RELA 1S32D 4YM6D 3A1KA 1P3LB 3REIA 3AFAB 4Z2MH 5E5AA 5B33B 2JE5A 1HQ3D 2G5HC 5DNNB 5B0ZD 3UTBD 1P3FD 1ZLAA 4J8VC 3AZIA 1M19D 3REKB 5AV8A 3WAAA 1PZRA 1BH9B 1S32B 3MGQB 4YM6B 3MNND 3W97A 5DNMC 4KGCB 3AYWA 2HIOC 1HQ3B 4WNNB 1M1AC 4H9QA 3AZLB 3X1TD 3LZ0C 3B6FC 5GSUC 4XUJD 3AV2C 5GT0A 5KDMA 3MNNB 5GXQB 3X1UC 4ZBJB 4H9OB 4Z5TD 3H0MC 3VH5T 3UTAC 3AN2C 4E45A 5AVCD 3X1TB 2PYOC 4XZQA 3UT9C 4ZUXA 3MVDA 2IO5B 4Z66B 1P34D 5CPJD 1T3UA 3W97C 4X23D 2FFFB 4Z5TB 5CP6A 3C1CD 3AZKD 3AZED 1N1JA 3AV1D 5AY8B 5AV9B 3MGSA 1W2EA 5B0YA 3C1BB 3X1VD 4UUZA 5B2JD 3REJA 2F8NG 4H9SA 3KWQB 4KUDD 3A6NA 5CPJB 3VH6T 5F99B 4J8WD 1P3OD 3B6GA 3P5JB 3C1CB 5CPKD 3MGRC 1P3AC 2XD1A 3AV1B 3O62A 2F8NA 5B1LA 4ZUXC 1F66C 2Y2OA 3W96D 3X1SA 4WU8A 5BT1C 4KUDB 3AZMB 4EO5C 2DF4C 1P3FA 1KX4B 3B0DC 1ID3A 1P3OB 5CPKB 1M19A 2AROD 4H9RA 3NQJA 3EPJA 4J8UD 5B40C 3W96B 3MGPA 3VH6W 3WKJD 3AZGA 1P3GA 4LD9C 3A6NC 5DNNC 5B32G 5B31G 4J8XD 4UPKA 2AROB 5JRGB 4AWLB 1P3BA 1P3PD 5BNXB 1AOID 2F8NH 5CPIC 1M18D 1S32C 2ZY5A 4YM6C 3WKJB 2JSSA 2W8SA 1P3KD 5FUGA 1EQZB 5GT3D 1HQ3C 3UTBC 5B0ZC 1P3FC 2JCHA 5AVCA 5B1MD 2YFVB 1P3ID 3W98D 3AZNB 1AOIB 4JJND 3WTPD 4YS3B 2NQBD 1P34A 3IP4C 3LZ1B 1F1EA 1M18B 3MNNC 1TZYA 4X23A 3F6TA 5GT3B 1WWSA 3AZHD 1KX5D 5AV5A 5B1MB 3A1IA 3KXBD 3H0RC 2Y2PA 3X1TC 3W98B 5AVBB 3LELD 4XUJC 4Z66C 4QLCD 4WJ3C 3KFUG 4J8WA 4G91C 4Z5TC 1KX3D 1KX5B 5AVCC 2YFWB 3NQUA 2RIQA 5DNMA 1WWIA 3LELB 2CV5B 1P3LD 2J8PA 5B33D 3AFAD 2HIOA 4QLCB 2ZY2A 5CPJC 3LZ0A 4X23C 3H0LC 1A7WA 5GSUA 1KX3B 3C1CC 3AZKC 3REKD 3AZEC 3AV1C 3AV2A 5GT0B 1Z2CB 3MGQD 3X1UA 4KGCD 3X1VC 3AZFB 5B2JC 3UTAA 4KUDC 3AN2A 2PYOA 3AZLD 3UT9A 4J8WC 3TU4D 1P3OC 5CPKC 3MVDB 1JFIA 2FJ7B 5B2IB 5GXQD 3W96C 4YS3D 3MGSB 3TU4B 1H3OA 2AROC 2NQBA 4Z66D 4J8UC 5AV6D 2RVQD 3WKJC 3MGRA 3WA9D 1P3AA 2F8NK 3O62B 1P3MD 5AY8D 5AV9D
chains in the Genus database with same CATH topology
4J8XC 5G49B 5B1LB 3KXBA 3C1BD 3KUYD 1BH8A 1F66A 4WU8B 2CWEA 1AOIC 1P3PC 2BYMB 3KWQD 5BS7C 5AV6B 2NZDD 3EPHA 4H9NA 1M18C 5B24B 1U35D 3VH5A 5F99D 3WA9B 1P3KC 5GT3C 2Y2KA 1P3MB 5C3IB 2DQNC 5B40A 3KUYB 5B1MC 1TAFB 3MGPB 1P3IC 3W98C 5B32D 5B31D 4JJNC 3WTPC 2NQBC 3AFAA 5B33A 3AZMD 2NZDB 4LD9A 5DNNA 1KX4D 1U35B 2Y2HA 1P3BB 2HUEC 2BYKB 3LJAD 4KHAB 4R8PB 3AZHC 1KX5C 5CPIA 3KXBC 1BH9A 1S32A 5B32B 5B31B 4YM6A 2CV5C 3LELC 4M6BA 1HQ3A 2VQRA 5B0ZA 3UTBA 4QLCC 4WNNA 4CAYA 5JRGD 3W99D 1KX3C 3LJAB 5JA4B 3MNNA 3REHD 2Y2GA 1P3LC 3AFAC 5B33C 4H9OA 1EQZD 4WU9B 1Q9CA 5CHLB 2XD5A 3X1TA 3AZND 3W99B 4XUJA 3REKC 2Y2NA 4Z66A 2FJ7C 3LZ1D 3REHB 3MGQC 4J8VB 4KGCC 4Z5TA 5AY8A 5AV9A 5BO0A 3WTPE 3AZLC 4WV4B 5DNMB 3RELD 3TU4C 5AVBD 5BNVB 2HIOB 5CPJA 1M1AB 5GXQC 1ZLAD 3AZID 5F99A 3B6FB 1HTAA 4ZBJC 3C1CA 3AZKA 3AZEA 4NFTA 5AV8D 3AZJB 3AV1A 3AV2B 4NE5A 4YS3C 2BG1A 3RELB 3X1UB 2CV5D 3KSYA 3REIB 1B67A 5B2JA 5E5AB 3AYWD 3X1VA 2IO5C 4KUDA 5AV6C 1ZLAB 5B24C 3AZIB 2RVQC 1P3OA 5CPKA 3WA9C 4HGAB 5AV8B 3WAAB 1P3MC 5AY8C 5AV9C 5GT0D 3C1BC 3W97B 3KUYC 3AYWB 3W96A 3AZFD 3B0CT 3KWQC 2NZDC 4H9PA 4H9QB 4E44A 1U35C 5F99C 3MVDD 2AROA 5BNXA 4J8UA 2FJ7D 5B2ID 4R8PC 5KDMB 3EG5B 5B32C 5B31C 3WKJA 5CP6D 3AZMC 1KX4C 2F2AC 4J8XA 4XZQB 4ZUXB 3MGSD 5B0YD 1F66B 3REJD 1AOIA 1P3PA 4EO5B 5BS7A 3B0CW 3LJAC 4H9NB 3B0DB 1M18A 3LZ1A 2F8NB 5CP6B 3B6GD 2Y2QA 1P3KA 5GT3A 1N1JB 3EPLA 3O62D 2F8ND 5B40B 5B0YB 5B1MA 5B1LD 1P3IA 4UUZB 3REJB 3W98A 3X1SD 5AVBA 3WTPA 4JJNA 5JRGC 3W99C 4AWLC 4WU8D 4LD9B 3A6NB 2ZY3A 1ID3D 5B24D 4CSRA 3REHC 3B6GB 1EQZC 3AZHA 1KX5A 5CPIB 2YFWA 3X1SB 3MGPD 2CV5A 3LELA 3AZNC 2Y2JA 3AZGD 1P3GD 3UTBB 5B0ZB 1P3FB 4QLCA 1ID3B 3LZ1C 1M19B 4H9RB 3NQJB 4CAYB 3R45A 1P3BD 1KX3A 3V9RA 4R8PD 3AZJC 4NE3A 3RELC 4G92B 5AVBC 1P3LA 3REIC 3AZFA 5E5AC 3AZGB 1P3GB 1ZLAC 3AZIC 4XUJB 3REKA 4HGAC 2ZY4A 5AV8C 2FJ7A 3WAAC 5B2IA 3MGQA 4KGCA 1TZYD 3AYWC 3VH6A 4G91B 5FUGB 2Y2MA 3EPKA 4WU9D 5AVCB 5AV5D 5BO0B 3AZLA 3TU4A 1P34B 3AL0C 5GT0C 3VH5W 5GXQA 1TZYB 4J8VD 4X23B 3AZFC 3AZKB 3AZEB 5AV5B 4YS3A 5G49A 4XZQC 5DNMD 3X1VB 5B2JB 3MVDC 2HIOD 2BYMA 5B2IC 5AV6A 1BFMA 1M1AD 1R4VA 5B24A 3LZ0D 4J8WB 1B6WA 3B6FD 5GSUD 5CP6C 3WA9A 3AZJD 3B0BA 3NQUB 2ZM5A 3AV2D 1P3MA 3MGSC 3C1BA 5B0YC 3X1UD 3KUYA 1TAFA 3REID 5E5AD 3REJC 4H9SC 3KWQA 3UTAD 2NZDA 3AN2D 4H9PB 1U35A 2PYOD 3LZ0B 3UT9D 5GSUB 3B6GC 4DRAA 3FDDA 4NE6A 1ULYA 4J8UB 2BYKA 3WAAD 3O62C 4KHAA 4R8PA 5B1LC 3W97D 1KU5A 2UWXA 5B32A 5B31A 3X1SC 4WU8C 3UTAB 3AZMA 2G5IC 3AN2B 1KX4A 1ID3C 2PYOB 4J8XB 3UT9B 2L5AA 1M19C 1P3PB 1JFIB 3LJAA 5C3IC 5JA4A 4Z2MG 4DRBA 3MGPC 4G92C 1P3KB 3MGRD 1P3AD 3AZGC 2Y2IA 1P3GC 4WU9A 4DQYB 4XZQD 4ZUXD 1F66D 1H3OB 1P3IB 4JJNB 3WTPB 2NQBB 5BT1D 5JRGA 1P3BC 3W99A 4CSRB 3REHA 4J8VA 3MGRB 1P3AB 1EQZA 2HUEB 4WZSB 3AZHB 5B40D 3KXBB 1BH8B 2YFVA 3AZNA 5BNVA 2Y2LA 4LD9D 3A6ND 2LY8A 1P34C 5DNND 1M1AA 1TZYC 3B6FA 3R45B 3V9RB 4WU9C 3AZJA 5AV5C 5CPID 3RELA 1S32D 4YM6D 3A1KA 1P3LB 3REIA 3AFAB 4Z2MH 5E5AA 5B33B 2JE5A 1HQ3D 2G5HC 5DNNB 5B0ZD 3UTBD 1P3FD 1ZLAA 4J8VC 3AZIA 1M19D 3REKB 5AV8A 3WAAA 1PZRA 1BH9B 1S32B 3MGQB 4YM6B 3MNND 3W97A 5DNMC 4KGCB 3AYWA 2HIOC 1HQ3B 4WNNB 1M1AC 4H9QA 3AZLB 3X1TD 3LZ0C 3B6FC 5GSUC 4XUJD 3AV2C 5GT0A 5KDMA 3MNNB 5GXQB 3X1UC 4ZBJB 4H9OB 4Z5TD 3H0MC 3VH5T 3UTAC 3AN2C 4E45A 5AVCD 3X1TB 2PYOC 4XZQA 3UT9C 4ZUXA 3MVDA 2IO5B 4Z66B 1P34D 5CPJD 1T3UA 3W97C 4X23D 2FFFB 4Z5TB 5CP6A 3C1CD 3AZKD 3AZED 1N1JA 3AV1D 5AY8B 5AV9B 3MGSA 1W2EA 5B0YA 3C1BB 3X1VD 4UUZA 5B2JD 3REJA 2F8NG 4H9SA 3KWQB 4KUDD 3A6NA 5CPJB 3VH6T 5F99B 4J8WD 1P3OD 3B6GA 3P5JB 3C1CB 5CPKD 3MGRC 1P3AC 2XD1A 3AV1B 3O62A 2F8NA 5B1LA 4ZUXC 1F66C 2Y2OA 3W96D 3X1SA 4WU8A 5BT1C 4KUDB 3AZMB 4EO5C 2DF4C 1P3FA 1KX4B 3B0DC 1ID3A 1P3OB 5CPKB 1M19A 2AROD 4H9RA 3NQJA 3EPJA 4J8UD 5B40C 3W96B 3MGPA 3VH6W 3WKJD 3AZGA 1P3GA 4LD9C 3A6NC 5DNNC 5B32G 5B31G 4J8XD 4UPKA 2AROB 5JRGB 4AWLB 1P3BA 1P3PD 5BNXB 1AOID 2F8NH 5CPIC 1M18D 1S32C 2ZY5A 4YM6C 3WKJB 2JSSA 2W8SA 1P3KD 5FUGA 1EQZB 5GT3D 1HQ3C 3UTBC 5B0ZC 1P3FC 2JCHA 5AVCA 5B1MD 2YFVB 1P3ID 3W98D 3AZNB 1AOIB 4JJND 3WTPD 4YS3B 2NQBD 1P34A 3IP4C 3LZ1B 1F1EA 1M18B 3MNNC 1TZYA 4X23A 3F6TA 5GT3B 1WWSA 3AZHD 1KX5D 5AV5A 5B1MB 3A1IA 3KXBD 3H0RC 2Y2PA 3X1TC 3W98B 5AVBB 3LELD 4XUJC 4Z66C 4QLCD 4WJ3C 3KFUG 4J8WA 4G91C 4Z5TC 1KX3D 1KX5B 5AVCC 2YFWB 3NQUA 2RIQA 5DNMA 1WWIA 3LELB 2CV5B 1P3LD 2J8PA 5B33D 3AFAD 2HIOA 4QLCB 2ZY2A 5CPJC 3LZ0A 4X23C 3H0LC 1A7WA 5GSUA 1KX3B 3C1CC 3AZKC 3REKD 3AZEC 3AV1C 3AV2A 5GT0B 1Z2CB 3MGQD 3X1UA 4KGCD 3X1VC 3AZFB 5B2JC 3UTAA 4KUDC 3AN2A 2PYOA 3AZLD 3UT9A 4J8WC 3TU4D 1P3OC 5CPKC 3MVDB 1JFIA 2FJ7B 5B2IB 5GXQD 3W96C 4YS3D 3MGSB 3TU4B 1H3OA 2AROC 2NQBA 4Z66D 4J8UC 5AV6D 2RVQD 3WKJC 3MGRA 3WA9D 1P3AA 2F8NK 3O62B 1P3MD 5AY8D 5AV9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X C;  5G49 B;  5B1L B;  3KXB A;  3C1B D;  3KUY D;  1BH8 A;  1F66 A;  4WU8 B;  2CWE A;  1AOI C;  1P3P C;  2BYM B;  3KWQ D;  5BS7 C;  5AV6 B;  2NZD D;  4H9N A;  1M18 C;  5B24 B;  1U35 D;  3VH5 A;  5F99 D;  3WA9 B;  1P3K C;  5GT3 C;  1P3M B;  5C3I B;  5B40 A;  3KUY B;  5B1M C;  1TAF B;  3MGP B;  1P3I C;  3W98 C;  5B32 D;  5B31 D;  4JJN C;  3WTP C;  2NQB C;  3AFA A;  5B33 A;  3AZM D;  2NZD B;  4LD9 A;  5DNN A;  1KX4 D;  1U35 B;  1P3B B;  2HUE C;  2BYK B;  3LJA D;  4KHA B;  4R8P B;  3AZH C;  1KX5 C;  5CPI A;  3KXB C;  1BH9 A;  1S32 A;  5B32 B;  5B31 B;  4YM6 A;  2CV5 C;  3LEL C;  4M6B A;  1HQ3 A;  3UTB A;  5B0Z A;  4QLC C;  4WNN A;  4CAY A;  5JRG D;  3W99 D;  1KX3 C;  3LJA B;  5JA4 B;  3MNN A;  3REH D;  1P3L C;  3AFA C;  5B33 C;  4H9O A;  1EQZ D;  4WU9 B;  1Q9C A;  5CHL B;  3X1T A;  3AZN D;  3W99 B;  4XUJ A;  3REK C;  4Z66 A;  2FJ7 C;  3LZ1 D;  3REH B;  3MGQ C;  4J8V B;  4KGC C;  4Z5T A;  5AY8 A;  3WTP E;  5AV9 A;  5BO0 A;  3AZL C;  4WV4 B;  5DNM B;  3REL D;  3TU4 C;  5AVB D;  5BNV B;  2HIO B;  5CPJ A;  1M1A B;  5GXQ C;  1ZLA D;  3AZI D;  5F99 A;  3B6F B;  1HTA A;  4ZBJ C;  3C1C A;  3AZK A;  3AZE A;  4NFT A;  5AV8 D;  3AZJ B;  3AV1 A;  3AV2 B;  4NE5 A;  4YS3 C;  3REL B;  3X1U B;  2CV5 D;  3KSY A;  3REI B;  1B67 A;  5B2J A;  5E5A B;  3AYW D;  3X1V A;  2IO5 C;  4KUD A;  5AV6 C;  1ZLA B;  5B24 C;  3AZI B;  2RVQ C;  1P3O A;  5CPK A;  3WA9 C;  4HGA B;  5AV8 B;  3WAA B;  1P3M C;  5AY8 C;  5AV9 C;  5GT0 D;  3C1B C;  3W97 B;  3KUY C;  3AYW B;  3W96 A;  3AZF D;  3B0C T;  3KWQ C;  2NZD C;  4H9P A;  4H9Q B;  4E44 A;  1U35 C;  5F99 C;  3MVD D;  2ARO A;  5BNX A;  4J8U A;  2FJ7 D;  5B2I D;  4R8P C;  5KDM B;  5B32 C;  5B31 C;  3WKJ A;  5CP6 D;  3AZM C;  1KX4 C;  4J8X A;  4XZQ B;  4ZUX B;  3MGS D;  5B0Y D;  1F66 B;  3REJ D;  1AOI A;  1P3P A;  4EO5 B;  5BS7 A;  3B0C W;  3LJA C;  4H9N B;  3B0D B;  1M18 A;  3LZ1 A;  2F8N B;  5CP6 B;  3B6G D;  1P3K A;  5GT3 A;  1N1J B;  3O62 D;  2F8N D;  5B40 B;  5B0Y B;  5B1M A;  5B1L D;  1P3I A;  4UUZ B;  3REJ B;  3W98 A;  3X1S D;  5AVB A;  3WTP A;  4JJN A;  5JRG C;  3W99 C;  4AWL C;  4WU8 D;  4LD9 B;  3A6N B;  1ID3 D;  5B24 D;  4CSR A;  3REH C;  3B6G B;  1EQZ C;  3AZH A;  1KX5 A;  5CPI B;  2YFW A;  3X1S B;  3MGP D;  2CV5 A;  3LEL A;  3AZN C;  3AZG D;  1P3G D;  3UTB B;  5B0Z B;  1P3F B;  4QLC A;  1ID3 B;  3LZ1 C;  1M19 B;  4H9R B;  3NQJ B;  4CAY B;  3R45 A;  1P3B D;  1KX3 A;  3V9R A;  4R8P D;  3AZJ C;  4NE3 A;  3REL C;  4G92 B;  5AVB C;  1P3L A;  3REI C;  3AZF A;  5E5A C;  3AZG B;  1P3G B;  1ZLA C;  3AZI C;  4XUJ B;  3REK A;  4HGA C;  5AV8 C;  2FJ7 A;  3WAA C;  5B2I A;  3MGQ A;  4KGC A;  1TZY D;  3AYW C;  3VH6 A;  4G91 B;  5FUG B;  4WU9 D;  5AVC B;  5AV5 D;  5BO0 B;  3AZL A;  3TU4 A;  1P34 B;  5GT0 C;  3VH5 W;  5GXQ A;  1TZY B;  4J8V D;  4X23 B;  3AZF C;  3AZK B;  3AZE B;  5AV5 B;  4YS3 A;  5G49 A;  4XZQ C;  5DNM D;  3X1V B;  5B2J B;  3MVD C;  2HIO D;  2BYM A;  5B2I C;  5AV6 A;  1BFM A;  1M1A D;  1R4V A;  5B24 A;  3LZ0 D;  4J8W B;  1B6W A;  3B6F D;  5GSU D;  5CP6 C;  3WA9 A;  3AZJ D;  3B0B A;  3NQU B;  3AV2 D;  1P3M A;  3MGS C;  3C1B A;  5B0Y C;  3X1U D;  3KUY A;  1TAF A;  3REI D;  5E5A D;  3REJ C;  4H9S C;  3KWQ A;  3UTA D;  2NZD A;  3AN2 D;  4H9P B;  1U35 A;  2PYO D;  3LZ0 B;  3UT9 D;  5GSU B;  3B6G C;  4DRA A;  4NE6 A;  1ULY A;  4J8U B;  2BYK A;  3WAA D;  3O62 C;  4KHA A;  4R8P A;  5B1L C;  3W97 D;  1KU5 A;  5B32 A;  5B31 A;  3X1S C;  4WU8 C;  3UTA B;  3AZM A;  3AN2 B;  1KX4 A;  1ID3 C;  2PYO B;  4J8X B;  3UT9 B;  2L5A A;  1M19 C;  1P3P B;  1JFI B;  3LJA A;  5C3I C;  5JA4 A;  4Z2M G;  4DRB A;  3MGP C;  4G92 C;  1P3K B;  3MGR D;  1P3A D;  3AZG C;  1P3G C;  4WU9 A;  4XZQ D;  4ZUX D;  1F66 D;  1H3O B;  1P3I B;  4JJN B;  3WTP B;  2NQB B;  5BT1 D;  5JRG A;  1P3B C;  3W99 A;  4CSR B;  3REH A;  4J8V A;  3MGR B;  1P3A B;  1EQZ A;  2HUE B;  4WZS B;  3AZH B;  5B40 D;  3KXB B;  1BH8 B;  2YFV A;  3AZN A;  5BNV A;  4LD9 D;  3A6N D;  2LY8 A;  1P34 C;  5DNN D;  1M1A A;  1TZY C;  3B6F A;  3R45 B;  3V9R B;  4WU9 C;  3AZJ A;  5AV5 C;  5CPI D;  3REL A;  1S32 D;  4YM6 D;  1P3L B;  3REI A;  3AFA B;  4Z2M H;  5E5A A;  5B33 B;  1HQ3 D;  5DNN B;  5B0Z D;  3UTB D;  1P3F D;  1ZLA A;  4J8V C;  3AZI A;  1M19 D;  3REK B;  5AV8 A;  3WAA A;  1BH9 B;  1S32 B;  3MGQ B;  4YM6 B;  3MNN D;  3W97 A;  5DNM C;  4KGC B;  3AYW A;  2HIO C;  1HQ3 B;  4WNN B;  1M1A C;  4H9Q A;  3AZL B;  3X1T D;  3LZ0 C;  3B6F C;  5GSU C;  4XUJ D;  3AV2 C;  5GT0 A;  5KDM A;  3MNN B;  5GXQ B;  3X1U C;  4ZBJ B;  4H9O B;  4Z5T D;  3VH5 T;  3UTA C;  3AN2 C;  4E45 A;  5AVC D;  3X1T B;  2PYO C;  4XZQ A;  3UT9 C;  4ZUX A;  3MVD A;  2IO5 B;  4Z66 B;  1P34 D;  5CPJ D;  3W97 C;  4X23 D;  4Z5T B;  5CP6 A;  3C1C D;  3AZK D;  3AZE D;  1N1J A;  3AV1 D;  5AY8 B;  5AV9 B;  3MGS A;  3C1B B;  5B0Y A;  3X1V D;  4UUZ A;  5B2J D;  3REJ A;  2F8N G;  4H9S A;  3KWQ B;  4KUD D;  3A6N A;  5CPJ B;  3VH6 T;  5F99 B;  4J8W D;  1P3O D;  3B6G A;  3C1C B;  5CPK D;  3MGR C;  1P3A C;  3AV1 B;  3O62 A;  2F8N A;  5B1L A;  4ZUX C;  1F66 C;  3W96 D;  3X1S A;  4WU8 A;  5BT1 C;  4KUD B;  3AZM B;  4EO5 C;  1P3F A;  1KX4 B;  3B0D C;  1ID3 A;  1P3O B;  5CPK B;  1M19 A;  2ARO D;  4H9R A;  3NQJ A;  4J8U D;  5B40 C;  3W96 B;  3MGP A;  3VH6 W;  3WKJ D;  3AZG A;  1P3G A;  4LD9 C;  3A6N C;  5DNN C;  5B32 G;  5B31 G;  4J8X D;  2ARO B;  5JRG B;  4AWL B;  1P3B A;  1P3P D;  5BNX B;  1AOI D;  2F8N H;  5CPI C;  1M18 D;  1S32 C;  4YM6 C;  3WKJ B;  2JSS A;  1P3K D;  5FUG A;  1EQZ B;  5GT3 D;  1HQ3 C;  3UTB C;  5B0Z C;  1P3F C;  5AVC A;  5B1M D;  2YFV B;  1P3I D;  3W98 D;  3AZN B;  1AOI B;  4JJN D;  3WTP D;  4YS3 B;  2NQB D;  1P34 A;  1M18 B;  3LZ1 B;  1F1E A;  3MNN C;  1TZY A;  4X23 A;  5GT3 B;  1WWS A;  3AZH D;  1KX5 D;  5AV5 A;  5B1M B;  3KXB D;  3X1T C;  3W98 B;  5AVB B;  3LEL D;  4XUJ C;  4Z66 C;  4QLC D;  4J8W A;  4G91 C;  4Z5T C;  1KX3 D;  1KX5 B;  5AVC C;  2YFW B;  3NQU A;  2CV5 B;  5DNM A;  1WWI A;  3LEL B;  1P3L D;  3AFA D;  5B33 D;  2HIO A;  4QLC B;  5CPJ C;  3LZ0 A;  4X23 C;  1A7W A;  5GSU A;  1KX3 B;  3C1C C;  3AZK C;  3REK D;  3AZE C;  3AV1 C;  3AV2 A;  5GT0 B;  3MGQ D;  3X1U A;  4KGC D;  3X1V C;  3AZF B;  5B2J C;  3UTA A;  4KUD C;  3AN2 A;  2PYO A;  3AZL D;  3UT9 A;  4J8W C;  3TU4 D;  1P3O C;  5CPK C;  3MVD B;  1JFI A;  2FJ7 B;  5B2I B;  5GXQ D;  3W96 C;  4YS3 D;  3MGS B;  3TU4 B;  1H3O A;  2ARO C;  2NQB A;  4Z66 D;  4J8U C;  5AV6 D;  2RVQ D;  3WKJ C;  3MGR A;  3WA9 D;  1P3A A;  2F8N K;  3O62 B;  1P3M D;  5AY8 D;  5AV9 D; 
#chains in the Genus database with same CATH topology
 4J8X C;  5G49 B;  5B1L B;  3KXB A;  3C1B D;  3KUY D;  1BH8 A;  1F66 A;  4WU8 B;  2CWE A;  1AOI C;  1P3P C;  2BYM B;  3KWQ D;  5BS7 C;  5AV6 B;  2NZD D;  3EPH A;  4H9N A;  1M18 C;  5B24 B;  1U35 D;  3VH5 A;  5F99 D;  3WA9 B;  1P3K C;  5GT3 C;  2Y2K A;  1P3M B;  5C3I B;  2DQN C;  5B40 A;  3KUY B;  5B1M C;  1TAF B;  3MGP B;  1P3I C;  3W98 C;  5B32 D;  5B31 D;  4JJN C;  3WTP C;  2NQB C;  3AFA A;  5B33 A;  3AZM D;  2NZD B;  4LD9 A;  5DNN A;  1KX4 D;  1U35 B;  2Y2H A;  1P3B B;  2HUE C;  2BYK B;  3LJA D;  4KHA B;  4R8P B;  3AZH C;  1KX5 C;  5CPI A;  3KXB C;  1BH9 A;  1S32 A;  5B32 B;  5B31 B;  4YM6 A;  2CV5 C;  3LEL C;  4M6B A;  1HQ3 A;  2VQR A;  5B0Z A;  3UTB A;  4QLC C;  4WNN A;  4CAY A;  5JRG D;  3W99 D;  1KX3 C;  3LJA B;  5JA4 B;  3MNN A;  3REH D;  2Y2G A;  1P3L C;  3AFA C;  5B33 C;  4H9O A;  1EQZ D;  4WU9 B;  1Q9C A;  5CHL B;  2XD5 A;  3X1T A;  3AZN D;  3W99 B;  4XUJ A;  3REK C;  2Y2N A;  4Z66 A;  2FJ7 C;  3LZ1 D;  3REH B;  3MGQ C;  4J8V B;  4KGC C;  4Z5T A;  5AY8 A;  5AV9 A;  5BO0 A;  3WTP E;  3AZL C;  4WV4 B;  5DNM B;  3REL D;  3TU4 C;  5AVB D;  5BNV B;  2HIO B;  5CPJ A;  1M1A B;  5GXQ C;  1ZLA D;  3AZI D;  5F99 A;  3B6F B;  1HTA A;  4ZBJ C;  3C1C A;  3AZK A;  3AZE A;  4NFT A;  5AV8 D;  3AZJ B;  3AV1 A;  3AV2 B;  4NE5 A;  4YS3 C;  2BG1 A;  3REL B;  3X1U B;  2CV5 D;  3KSY A;  3REI B;  1B67 A;  5B2J A;  5E5A B;  3AYW D;  3X1V A;  2IO5 C;  4KUD A;  5AV6 C;  1ZLA B;  5B24 C;  3AZI B;  2RVQ C;  1P3O A;  5CPK A;  3WA9 C;  4HGA B;  5AV8 B;  3WAA B;  1P3M C;  5AY8 C;  5AV9 C;  5GT0 D;  3C1B C;  3W97 B;  3KUY C;  3AYW B;  3W96 A;  3AZF D;  3B0C T;  3KWQ C;  2NZD C;  4H9P A;  4H9Q B;  4E44 A;  1U35 C;  5F99 C;  3MVD D;  2ARO A;  5BNX A;  4J8U A;  2FJ7 D;  5B2I D;  4R8P C;  5KDM B;  3EG5 B;  5B32 C;  5B31 C;  3WKJ A;  5CP6 D;  3AZM C;  1KX4 C;  2F2A C;  4J8X A;  4XZQ B;  4ZUX B;  3MGS D;  5B0Y D;  1F66 B;  3REJ D;  1AOI A;  1P3P A;  4EO5 B;  5BS7 A;  3B0C W;  3LJA C;  4H9N B;  3B0D B;  1M18 A;  3LZ1 A;  2F8N B;  5CP6 B;  3B6G D;  2Y2Q A;  1P3K A;  5GT3 A;  1N1J B;  3EPL A;  3O62 D;  2F8N D;  5B40 B;  5B0Y B;  5B1M A;  5B1L D;  1P3I A;  4UUZ B;  3REJ B;  3W98 A;  3X1S D;  5AVB A;  3WTP A;  4JJN A;  5JRG C;  3W99 C;  4AWL C;  4WU8 D;  4LD9 B;  3A6N B;  2ZY3 A;  1ID3 D;  5B24 D;  4CSR A;  3REH C;  3B6G B;  1EQZ C;  3AZH A;  1KX5 A;  5CPI B;  2YFW A;  3X1S B;  3MGP D;  2CV5 A;  3LEL A;  3AZN C;  2Y2J A;  3AZG D;  1P3G D;  3UTB B;  5B0Z B;  1P3F B;  4QLC A;  1ID3 B;  3LZ1 C;  1M19 B;  4H9R B;  3NQJ B;  4CAY B;  3R45 A;  1P3B D;  1KX3 A;  3V9R A;  4R8P D;  3AZJ C;  4NE3 A;  3REL C;  4G92 B;  5AVB C;  1P3L A;  3REI C;  3AZF A;  5E5A C;  3AZG B;  1P3G B;  1ZLA C;  3AZI C;  4XUJ B;  3REK A;  4HGA C;  2ZY4 A;  5AV8 C;  2FJ7 A;  3WAA C;  5B2I A;  3MGQ A;  4KGC A;  1TZY D;  3AYW C;  3VH6 A;  4G91 B;  5FUG B;  2Y2M A;  3EPK A;  4WU9 D;  5AVC B;  5AV5 D;  5BO0 B;  3AZL A;  3TU4 A;  1P34 B;  3AL0 C;  5GT0 C;  3VH5 W;  5GXQ A;  1TZY B;  4J8V D;  4X23 B;  3AZF C;  3AZK B;  3AZE B;  5AV5 B;  4YS3 A;  5G49 A;  4XZQ C;  5DNM D;  3X1V B;  5B2J B;  3MVD C;  2HIO D;  2BYM A;  5B2I C;  5AV6 A;  1BFM A;  1M1A D;  1R4V A;  5B24 A;  3LZ0 D;  4J8W B;  1B6W A;  3B6F D;  5GSU D;  5CP6 C;  3WA9 A;  3AZJ D;  3B0B A;  3NQU B;  2ZM5 A;  3AV2 D;  1P3M A;  3MGS C;  3C1B A;  5B0Y C;  3X1U D;  3KUY A;  1TAF A;  3REI D;  5E5A D;  3REJ C;  4H9S C;  3KWQ A;  3UTA D;  2NZD A;  3AN2 D;  4H9P B;  1U35 A;  2PYO D;  3LZ0 B;  3UT9 D;  5GSU B;  3B6G C;  4DRA A;  3FDD A;  4NE6 A;  1ULY A;  4J8U B;  2BYK A;  3WAA D;  3O62 C;  4KHA A;  4R8P A;  5B1L C;  3W97 D;  1KU5 A;  2UWX A;  5B32 A;  5B31 A;  3X1S C;  4WU8 C;  3UTA B;  3AZM A;  2G5I C;  3AN2 B;  1KX4 A;  1ID3 C;  2PYO B;  4J8X B;  3UT9 B;  2L5A A;  1M19 C;  1P3P B;  1JFI B;  3LJA A;  5C3I C;  5JA4 A;  4Z2M G;  4DRB A;  3MGP C;  4G92 C;  1P3K B;  3MGR D;  1P3A D;  3AZG C;  2Y2I A;  1P3G C;  4WU9 A;  4DQY B;  4XZQ D;  4ZUX D;  1F66 D;  1H3O B;  1P3I B;  4JJN B;  3WTP B;  2NQB B;  5BT1 D;  5JRG A;  1P3B C;  3W99 A;  4CSR B;  3REH A;  4J8V A;  3MGR B;  1P3A B;  1EQZ A;  2HUE B;  4WZS B;  3AZH B;  5B40 D;  3KXB B;  1BH8 B;  2YFV A;  3AZN A;  5BNV A;  2Y2L A;  4LD9 D;  3A6N D;  2LY8 A;  1P34 C;  5DNN D;  1M1A A;  1TZY C;  3B6F A;  3R45 B;  3V9R B;  4WU9 C;  3AZJ A;  5AV5 C;  5CPI D;  3REL A;  1S32 D;  4YM6 D;  3A1K A;  1P3L B;  3REI A;  3AFA B;  4Z2M H;  5E5A A;  5B33 B;  2JE5 A;  1HQ3 D;  2G5H C;  5DNN B;  5B0Z D;  3UTB D;  1P3F D;  1ZLA A;  4J8V C;  3AZI A;  1M19 D;  3REK B;  5AV8 A;  3WAA A;  1PZR A;  1BH9 B;  1S32 B;  3MGQ B;  4YM6 B;  3MNN D;  3W97 A;  5DNM C;  4KGC B;  3AYW A;  2HIO C;  1HQ3 B;  4WNN B;  1M1A C;  4H9Q A;  3AZL B;  3X1T D;  3LZ0 C;  3B6F C;  5GSU C;  4XUJ D;  3AV2 C;  5GT0 A;  5KDM A;  3MNN B;  5GXQ B;  3X1U C;  4ZBJ B;  4H9O B;  4Z5T D;  3H0M C;  3VH5 T;  3UTA C;  3AN2 C;  4E45 A;  5AVC D;  3X1T B;  2PYO C;  4XZQ A;  3UT9 C;  4ZUX A;  3MVD A;  2IO5 B;  4Z66 B;  1P34 D;  5CPJ D;  1T3U A;  3W97 C;  4X23 D;  2FFF B;  4Z5T B;  5CP6 A;  3C1C D;  3AZK D;  3AZE D;  1N1J A;  3AV1 D;  5AY8 B;  5AV9 B;  3MGS A;  1W2E A;  5B0Y A;  3C1B B;  3X1V D;  4UUZ A;  5B2J D;  3REJ A;  2F8N G;  4H9S A;  3KWQ B;  4KUD D;  3A6N A;  5CPJ B;  3VH6 T;  5F99 B;  4J8W D;  1P3O D;  3B6G A;  3P5J B;  3C1C B;  5CPK D;  3MGR C;  1P3A C;  2XD1 A;  3AV1 B;  3O62 A;  2F8N A;  5B1L A;  4ZUX C;  1F66 C;  2Y2O A;  3W96 D;  3X1S A;  4WU8 A;  5BT1 C;  4KUD B;  3AZM B;  4EO5 C;  2DF4 C;  1P3F A;  1KX4 B;  3B0D C;  1ID3 A;  1P3O B;  5CPK B;  1M19 A;  2ARO D;  4H9R A;  3NQJ A;  3EPJ A;  4J8U D;  5B40 C;  3W96 B;  3MGP A;  3VH6 W;  3WKJ D;  3AZG A;  1P3G A;  4LD9 C;  3A6N C;  5DNN C;  5B32 G;  5B31 G;  4J8X D;  4UPK A;  2ARO B;  5JRG B;  4AWL B;  1P3B A;  1P3P D;  5BNX B;  1AOI D;  2F8N H;  5CPI C;  1M18 D;  1S32 C;  2ZY5 A;  4YM6 C;  3WKJ B;  2JSS A;  2W8S A;  1P3K D;  5FUG A;  1EQZ B;  5GT3 D;  1HQ3 C;  3UTB C;  5B0Z C;  1P3F C;  2JCH A;  5AVC A;  5B1M D;  2YFV B;  1P3I D;  3W98 D;  3AZN B;  1AOI B;  4JJN D;  3WTP D;  4YS3 B;  2NQB D;  1P34 A;  3IP4 C;  3LZ1 B;  1F1E A;  1M18 B;  3MNN C;  1TZY A;  4X23 A;  3F6T A;  5GT3 B;  1WWS A;  3AZH D;  1KX5 D;  5AV5 A;  5B1M B;  3A1I A;  3KXB D;  3H0R C;  2Y2P A;  3X1T C;  3W98 B;  5AVB B;  3LEL D;  4XUJ C;  4Z66 C;  4QLC D;  4WJ3 C;  3KFU G;  4J8W A;  4G91 C;  4Z5T C;  1KX3 D;  1KX5 B;  5AVC C;  2YFW B;  3NQU A;  2RIQ A;  5DNM A;  1WWI A;  3LEL B;  2CV5 B;  1P3L D;  2J8P A;  5B33 D;  3AFA D;  2HIO A;  4QLC B;  2ZY2 A;  5CPJ C;  3LZ0 A;  4X23 C;  3H0L C;  1A7W A;  5GSU A;  1KX3 B;  3C1C C;  3AZK C;  3REK D;  3AZE C;  3AV1 C;  3AV2 A;  5GT0 B;  1Z2C B;  3MGQ D;  3X1U A;  4KGC D;  3X1V C;  3AZF B;  5B2J C;  3UTA A;  4KUD C;  3AN2 A;  2PYO A;  3AZL D;  3UT9 A;  4J8W C;  3TU4 D;  1P3O C;  5CPK C;  3MVD B;  1JFI A;  2FJ7 B;  5B2I B;  5GXQ D;  3W96 C;  4YS3 D;  3MGS B;  3TU4 B;  1H3O A;  2ARO C;  2NQB A;  4Z66 D;  4J8U C;  5AV6 D;  2RVQ D;  3WKJ C;  3MGR A;  3WA9 D;  1P3A A;  2F8N K;  3O62 B;  1P3M D;  5AY8 D;  5AV9 D; 
#chains in the Genus database with same CATH homology
 4J8X C;  5G49 B;  5B1L B;  3KXB A;  3C1B D;  3KUY D;  1BH8 A;  1F66 A;  4WU8 B;  2CWE A;  1AOI C;  1P3P C;  2BYM B;  3KWQ D;  5BS7 C;  5AV6 B;  2NZD D;  3EPH A;  4H9N A;  1M18 C;  5B24 B;  1U35 D;  3VH5 A;  5F99 D;  3WA9 B;  1P3K C;  5GT3 C;  2Y2K A;  1P3M B;  5C3I B;  2DQN C;  5B40 A;  3KUY B;  5B1M C;  1TAF B;  3MGP B;  1P3I C;  3W98 C;  5B32 D;  5B31 D;  4JJN C;  3WTP C;  2NQB C;  3AFA A;  5B33 A;  3AZM D;  2NZD B;  4LD9 A;  5DNN A;  1KX4 D;  1U35 B;  2Y2H A;  1P3B B;  2HUE C;  2BYK B;  3LJA D;  4KHA B;  4R8P B;  3AZH C;  1KX5 C;  5CPI A;  3KXB C;  1BH9 A;  1S32 A;  5B32 B;  5B31 B;  4YM6 A;  2CV5 C;  3LEL C;  4M6B A;  1HQ3 A;  2VQR A;  5B0Z A;  3UTB A;  4QLC C;  4WNN A;  4CAY A;  5JRG D;  3W99 D;  1KX3 C;  3LJA B;  5JA4 B;  3MNN A;  3REH D;  2Y2G A;  1P3L C;  3AFA C;  5B33 C;  4H9O A;  1EQZ D;  4WU9 B;  1Q9C A;  5CHL B;  2XD5 A;  3X1T A;  3AZN D;  3W99 B;  4XUJ A;  3REK C;  2Y2N A;  4Z66 A;  2FJ7 C;  3LZ1 D;  3REH B;  3MGQ C;  4J8V B;  4KGC C;  4Z5T A;  5AY8 A;  5AV9 A;  5BO0 A;  3WTP E;  3AZL C;  4WV4 B;  5DNM B;  3REL D;  3TU4 C;  5AVB D;  5BNV B;  2HIO B;  5CPJ A;  1M1A B;  5GXQ C;  1ZLA D;  3AZI D;  5F99 A;  3B6F B;  1HTA A;  4ZBJ C;  3C1C A;  3AZK A;  3AZE A;  4NFT A;  5AV8 D;  3AZJ B;  3AV1 A;  3AV2 B;  4NE5 A;  4YS3 C;  2BG1 A;  3REL B;  3X1U B;  2CV5 D;  3KSY A;  3REI B;  1B67 A;  5B2J A;  5E5A B;  3AYW D;  3X1V A;  2IO5 C;  4KUD A;  5AV6 C;  1ZLA B;  5B24 C;  3AZI B;  2RVQ C;  1P3O A;  5CPK A;  3WA9 C;  4HGA B;  5AV8 B;  3WAA B;  1P3M C;  5AY8 C;  5AV9 C;  5GT0 D;  3C1B C;  3W97 B;  3KUY C;  3AYW B;  3W96 A;  3AZF D;  3B0C T;  3KWQ C;  2NZD C;  4H9P A;  4H9Q B;  4E44 A;  1U35 C;  5F99 C;  3MVD D;  2ARO A;  5BNX A;  4J8U A;  2FJ7 D;  5B2I D;  4R8P C;  5KDM B;  3EG5 B;  5B32 C;  5B31 C;  3WKJ A;  5CP6 D;  3AZM C;  1KX4 C;  2F2A C;  4J8X A;  4XZQ B;  4ZUX B;  3MGS D;  5B0Y D;  1F66 B;  3REJ D;  1AOI A;  1P3P A;  4EO5 B;  5BS7 A;  3B0C W;  3LJA C;  4H9N B;  3B0D B;  1M18 A;  3LZ1 A;  2F8N B;  5CP6 B;  3B6G D;  2Y2Q A;  1P3K A;  5GT3 A;  1N1J B;  3EPL A;  3O62 D;  2F8N D;  5B40 B;  5B0Y B;  5B1M A;  5B1L D;  1P3I A;  4UUZ B;  3REJ B;  3W98 A;  3X1S D;  5AVB A;  3WTP A;  4JJN A;  5JRG C;  3W99 C;  4AWL C;  4WU8 D;  4LD9 B;  3A6N B;  2ZY3 A;  1ID3 D;  5B24 D;  4CSR A;  3REH C;  3B6G B;  1EQZ C;  3AZH A;  1KX5 A;  5CPI B;  2YFW A;  3X1S B;  3MGP D;  2CV5 A;  3LEL A;  3AZN C;  2Y2J A;  3AZG D;  1P3G D;  3UTB B;  5B0Z B;  1P3F B;  4QLC A;  1ID3 B;  3LZ1 C;  1M19 B;  4H9R B;  3NQJ B;  4CAY B;  3R45 A;  1P3B D;  1KX3 A;  3V9R A;  4R8P D;  3AZJ C;  4NE3 A;  3REL C;  4G92 B;  5AVB C;  1P3L A;  3REI C;  3AZF A;  5E5A C;  3AZG B;  1P3G B;  1ZLA C;  3AZI C;  4XUJ B;  3REK A;  4HGA C;  2ZY4 A;  5AV8 C;  2FJ7 A;  3WAA C;  5B2I A;  3MGQ A;  4KGC A;  1TZY D;  3AYW C;  3VH6 A;  4G91 B;  5FUG B;  2Y2M A;  3EPK A;  4WU9 D;  5AVC B;  5AV5 D;  5BO0 B;  3AZL A;  3TU4 A;  1P34 B;  3AL0 C;  5GT0 C;  3VH5 W;  5GXQ A;  1TZY B;  4J8V D;  4X23 B;  3AZF C;  3AZK B;  3AZE B;  5AV5 B;  4YS3 A;  5G49 A;  4XZQ C;  5DNM D;  3X1V B;  5B2J B;  3MVD C;  2HIO D;  2BYM A;  5B2I C;  5AV6 A;  1BFM A;  1M1A D;  1R4V A;  5B24 A;  3LZ0 D;  4J8W B;  1B6W A;  3B6F D;  5GSU D;  5CP6 C;  3WA9 A;  3AZJ D;  3B0B A;  3NQU B;  2ZM5 A;  3AV2 D;  1P3M A;  3MGS C;  3C1B A;  5B0Y C;  3X1U D;  3KUY A;  1TAF A;  3REI D;  5E5A D;  3REJ C;  4H9S C;  3KWQ A;  3UTA D;  2NZD A;  3AN2 D;  4H9P B;  1U35 A;  2PYO D;  3LZ0 B;  3UT9 D;  5GSU B;  3B6G C;  4DRA A;  3FDD A;  4NE6 A;  1ULY A;  4J8U B;  2BYK A;  3WAA D;  3O62 C;  4KHA A;  4R8P A;  5B1L C;  3W97 D;  1KU5 A;  2UWX A;  5B32 A;  5B31 A;  3X1S C;  4WU8 C;  3UTA B;  3AZM A;  2G5I C;  3AN2 B;  1KX4 A;  1ID3 C;  2PYO B;  4J8X B;  3UT9 B;  2L5A A;  1M19 C;  1P3P B;  1JFI B;  3LJA A;  5C3I C;  5JA4 A;  4Z2M G;  4DRB A;  3MGP C;  4G92 C;  1P3K B;  3MGR D;  1P3A D;  3AZG C;  2Y2I A;  1P3G C;  4WU9 A;  4DQY B;  4XZQ D;  4ZUX D;  1F66 D;  1H3O B;  1P3I B;  4JJN B;  3WTP B;  2NQB B;  5BT1 D;  5JRG A;  1P3B C;  3W99 A;  4CSR B;  3REH A;  4J8V A;  3MGR B;  1P3A B;  1EQZ A;  2HUE B;  4WZS B;  3AZH B;  5B40 D;  3KXB B;  1BH8 B;  2YFV A;  3AZN A;  5BNV A;  2Y2L A;  4LD9 D;  3A6N D;  2LY8 A;  1P34 C;  5DNN D;  1M1A A;  1TZY C;  3B6F A;  3R45 B;  3V9R B;  4WU9 C;  3AZJ A;  5AV5 C;  5CPI D;  3REL A;  1S32 D;  4YM6 D;  3A1K A;  1P3L B;  3REI A;  3AFA B;  4Z2M H;  5E5A A;  5B33 B;  2JE5 A;  1HQ3 D;  2G5H C;  5DNN B;  5B0Z D;  3UTB D;  1P3F D;  1ZLA A;  4J8V C;  3AZI A;  1M19 D;  3REK B;  5AV8 A;  3WAA A;  1PZR A;  1BH9 B;  1S32 B;  3MGQ B;  4YM6 B;  3MNN D;  3W97 A;  5DNM C;  4KGC B;  3AYW A;  2HIO C;  1HQ3 B;  4WNN B;  1M1A C;  4H9Q A;  3AZL B;  3X1T D;  3LZ0 C;  3B6F C;  5GSU C;  4XUJ D;  3AV2 C;  5GT0 A;  5KDM A;  3MNN B;  5GXQ B;  3X1U C;  4ZBJ B;  4H9O B;  4Z5T D;  3H0M C;  3VH5 T;  3UTA C;  3AN2 C;  4E45 A;  5AVC D;  3X1T B;  2PYO C;  4XZQ A;  3UT9 C;  4ZUX A;  3MVD A;  2IO5 B;  4Z66 B;  1P34 D;  5CPJ D;  1T3U A;  3W97 C;  4X23 D;  2FFF B;  4Z5T B;  5CP6 A;  3C1C D;  3AZK D;  3AZE D;  1N1J A;  3AV1 D;  5AY8 B;  5AV9 B;  3MGS A;  1W2E A;  5B0Y A;  3C1B B;  3X1V D;  4UUZ A;  5B2J D;  3REJ A;  2F8N G;  4H9S A;  3KWQ B;  4KUD D;  3A6N A;  5CPJ B;  3VH6 T;  5F99 B;  4J8W D;  1P3O D;  3B6G A;  3P5J B;  3C1C B;  5CPK D;  3MGR C;  1P3A C;  2XD1 A;  3AV1 B;  3O62 A;  2F8N A;  5B1L A;  4ZUX C;  1F66 C;  2Y2O A;  3W96 D;  3X1S A;  4WU8 A;  5BT1 C;  4KUD B;  3AZM B;  4EO5 C;  2DF4 C;  1P3F A;  1KX4 B;  3B0D C;  1ID3 A;  1P3O B;  5CPK B;  1M19 A;  2ARO D;  4H9R A;  3NQJ A;  3EPJ A;  4J8U D;  5B40 C;  3W96 B;  3MGP A;  3VH6 W;  3WKJ D;  3AZG A;  1P3G A;  4LD9 C;  3A6N C;  5DNN C;  5B32 G;  5B31 G;  4J8X D;  4UPK A;  2ARO B;  5JRG B;  4AWL B;  1P3B A;  1P3P D;  5BNX B;  1AOI D;  2F8N H;  5CPI C;  1M18 D;  1S32 C;  2ZY5 A;  4YM6 C;  3WKJ B;  2JSS A;  2W8S A;  1P3K D;  5FUG A;  1EQZ B;  5GT3 D;  1HQ3 C;  3UTB C;  5B0Z C;  1P3F C;  2JCH A;  5AVC A;  5B1M D;  2YFV B;  1P3I D;  3W98 D;  3AZN B;  1AOI B;  4JJN D;  3WTP D;  4YS3 B;  2NQB D;  1P34 A;  3IP4 C;  3LZ1 B;  1F1E A;  1M18 B;  3MNN C;  1TZY A;  4X23 A;  3F6T A;  5GT3 B;  1WWS A;  3AZH D;  1KX5 D;  5AV5 A;  5B1M B;  3A1I A;  3KXB D;  3H0R C;  2Y2P A;  3X1T C;  3W98 B;  5AVB B;  3LEL D;  4XUJ C;  4Z66 C;  4QLC D;  4WJ3 C;  3KFU G;  4J8W A;  4G91 C;  4Z5T C;  1KX3 D;  1KX5 B;  5AVC C;  2YFW B;  3NQU A;  2RIQ A;  5DNM A;  1WWI A;  3LEL B;  2CV5 B;  1P3L D;  2J8P A;  5B33 D;  3AFA D;  2HIO A;  4QLC B;  2ZY2 A;  5CPJ C;  3LZ0 A;  4X23 C;  3H0L C;  1A7W A;  5GSU A;  1KX3 B;  3C1C C;  3AZK C;  3REK D;  3AZE C;  3AV1 C;  3AV2 A;  5GT0 B;  1Z2C B;  3MGQ D;  3X1U A;  4KGC D;  3X1V C;  3AZF B;  5B2J C;  3UTA A;  4KUD C;  3AN2 A;  2PYO A;  3AZL D;  3UT9 A;  4J8W C;  3TU4 D;  1P3O C;  5CPK C;  3MVD B;  1JFI A;  2FJ7 B;  5B2I B;  5GXQ D;  3W96 C;  4YS3 D;  3MGS B;  3TU4 B;  1H3O A;  2ARO C;  2NQB A;  4Z66 D;  4J8U C;  5AV6 D;  2RVQ D;  3WKJ C;  3MGR A;  3WA9 D;  1P3A A;  2F8N K;  3O62 B;  1P3M D;  5AY8 D;  5AV9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...