5CPKB

Nucleosome containing methylated sat2l dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkB00
1AOIB 3REKB 3LELA 3NQJB 4WU8A 4WZSB 3O62C 4Z66A 4G92C 4KGCA 1ID3A 3AYWC 4KUDD 4KUDB 4H9OA 3B0CW 2YFWA 3MNNC 3LZ1A 3AFAB 4J8VA 3B6FC 3MGQD 5FUGB 5CPIA 1M19A 5B0YC 2IO5C 2JSSA 5DNND 5DNNB 1N1JA 4J8UA 3WKJC 3RELB 3TU4D 3MGPA 3TU4B 3AZMC 5B24A 3C1BC 1KX5C 4R8PC 3W98B 3WTPC 5B1MD 5B1MB 4DRBA 3X1SD 5B40D 4NE6A 3X1SB 5B40B 5GXQA 1HQ3B 2FJ7A 3B0DB 5B2IC 3AZHD 5B2JC 5AVCA 3AZHB 3C1CD 3C1CB 4WU9B 3LJAD 3AZEC 3LJAB 3LELC 5CP6A 4WU8C 3AZKD 1M1AA 3WTPE 1H3OA 4KGCC 1ID3C 5B32G 3LZ1C 4J8VC 1BH8A 3KUYB 5CPIC 1M19C 3UTAA 3REHD 1P3BD 1U35D 1P3BB 3O62D 4J8UC 5AV9A 3MVDD 3O62B 1U35B 3MGPC 5C3IC 4G92B 5B24C 4ZUXD 3AYWB 4ZUXB 3MNND 3MNNB 4X23D 1P3KD 3LZ0A 3WA9D 5DNMA 3MGRA 3B6FB 3WA9B 5F99D 5F99B 2FJ7C 4H9QB 5GSUA 1KX4A 5FUGA 3NQUA 3MGQA 4H9PA 3AZMB 1KX5D 5CP6C 1TZYA 1KX5B 5DNNA 3X1UD 3AZIA 3WTPD 3WAAA 3WTPB 5BNVA 1M1AC 4NE3A 5B2IB 5CPKD 5B2JB 5CPKB 5B1MA 3X1SA 3LELB 3AZNC 4WU8D 1KX3A 4WU8B 1EQZA 5AV9C 3KSYA 4Z66D 4Z66B 1ID3D 1ID3B 3AZKA 4H9OB 4KHAA 2YFWB 3LZ1D 3LZ1B 1F1EA 4J8VB 3LZ0C 5DNMC 3MGRC 5CPID 1M19D 5CPIB 1M19B 5GSUC 1N1JB 1KX4C 4CSRA 3MGQC 3MGPD 1ZLAA 3MGPB 5B24D 5C3IB 5B24B 3REHA 3VH6W 5DNNC 3AZIC 4Z2MG 1U35A 3MVDA 3REJD 3WAAC 1WWIA 5GXQD 4ZUXA 5GXQB 1P3PA 2FJ7B 5AVCD 4X23A 1P3KA 5AVCB 5B1MC 3VH5T 2F8NA 4Z2MH 3WA9A 3X1SC 5F99A 5BO0A 5CP6D 5CP6B 1KX3C 5B33D 5B33B 1EQZC 3LJAC 1H3OB 1B67A 1S32D 1S32B 3X1UA 3AZKC 1BH8B 4UUZA 3UTBD 3UTAD 5B31D 3UTBB 3UTAB 5CPKA 5B31B 5AV9D 5AV9B 5AVBA 2HIOD 2HIOB 1BFMA 3REHC 1P3BC 2RVQC 1U35C 3LZ0D 3MVDC 5DNMD 3LZ0B 3MGRD 4JJNA 5DNMB 3MGRB 4ZUXC 5GSUD 4X23C 5GSUB 1P3KC 1KX4D 1KX4B 3WA9C 3MGQB 3NQUB 2F8NK 4H9PB 5F99C 3AZGA 1TZYD 3AZID 1TZYB 3AZIB 3AZJD 3WAAD 4YS3D 3WAAB 4YS3B 2NZDA 1P3AD 5BNVB 1P3AB 1M18D 5GT0A 4E44A 3X1UC 4LD9A 4G91C 3REJA 3W97A 4E45A 5AV8A 1KX3D 5AV5D 1KX3B 5AV5B 5CPKC 1EQZD 1EQZB 5E5AD 5AVBC 4XZQA 3AN2D 3KWQA 3AN2B 3AZKB 4KHAB 5B33A 2PYOA 1HTAA 4AWLB 4Z66C 4JJNC 4NE5A 1S32A 3X1TA 4CSRB 4J8XA 1ZLAD 1ZLAB 3AZGC 3UTBA 5B31A 2RVQD 5AV6D 3REHB 3MVDB 2HIOA 3V9RA 3UT9D 1P3PD 3UT9B 1P3PB 4LD9C 4HGAC 4QLCA 4M6BA 4X23B 3REJC 1P3KB 2F8ND 3W97C 2F8NB 4CAYB 5AV8C 3AZFD 5BO0B 5GXQC 5AVCC 4WV4B 4XZQC 3KWQC 3X1UB 3AZJA 3B6GA 2HUEC 4G91B 5B33C 4YS3A 1P3ID 1P3IB 1P3AA 4UUZB 5B32A 1M18A 1S32C 1P3LD 4XUJD 4XUJB 2LY8A 5AVBD 5AVBB 1P3FD 1P3FB 2NQBD 5AV5A 4H9NA 3UTAC 3UTBC 2NQBB 5B31C 1JFIA 3A6ND 5E5AA 2HIOC 3MGSD 4JJND 4JJNB 3AN2A 5CPJA 2YFVA 4YM6D 3VH6A 4YM6B 3AZGD 3REIA 3AZGB 4ZBJB 5B0ZA 2NZDD 2NZDB 1TZYC 5GT0D 1F66A 4LD9D 5AV6A 5GT0B 3AZJC 3B6GC 4LD9B 4HGAB 4YS3C 3REJB 3W97D 3W97B 5AV8D 1A7WA 3VH5W 5GT3D 5AV8B 5B32C 1P3AC 1M18C 3UT9A 4CAYA 5JRGD 4XZQD 5JRGB 4XZQB 3AZFA 3KWQD 5B1LD 5AV5C 3KWQB 5B1LB 2HUEB 2PYOD 5E5AC 2PYOB 3AN2C 3X1TD 5CPJC 3X1TB 3X1VD 4NFTA 1P3IA 4AWLC 1P34A 4J8XD 4Z5TD 2L5AA 4J8XB 4Z5TB 1P3LA 2AROA 3REIC 4XUJA 5BNXA 5B0ZC 1P3FA 1ZLAC 5B0YA 2NQBA 3V9RB 1F66C 5AV6C 3A6NA 4QLCD 4QLCB 3W99A 3MGSA 3UT9C 1P3PC 3R45A 4YM6A 4H9RB 1P3GD 1P3GB 3AZFC 1P3OD 1P3OB 3B6GD 3AZJB 3B6GB 1B6WA 3B0BA 1AOID 5B32D 5JA4A 5B32B 1M18B 1TAFB 3AZLA 1P3IC 2BYKB 1P34C 5GT3A 1P3LC 2AROC 4EO5B 1BH9A 3AV1A 4H9NB 1P3MD 4XUJC 1P3MB 5G49A 3AFAD 1JFIB 5JRGA 5E5AB 3W96D 1P3FC 3W96B 5CPJD 3B0CT 2NQBC 5B1LA 5CPJB 3AV2A 3A6NC 1ULYA 3W99C 2YFVB 3MGSC 5B31G 3RELD 5AY8D 3REID 5AY8B 3REIB 3X1VA 3W98D 5B0ZD 5B0ZB 4YM6C 4Z5TA 3KXBA 1HQ3D 2CWEA 1F66D 4ZBJC 4J8WD 1F66B 5AV6B 4J8WB 1Q9CA 5CHLB 2NZDC 4WU9D 5KDMA 5GT0C 2CV5D 3AZLC 2CV5B 5GT3C 3AZFB 3AV1C 4H9RA 1P3GA 5JRGC 4H9SA 3KUYD 1P3OA 3AZNA 5B1LC 3AV2C 1P34D 2PYOC 2BYMB 1P34B 1AOIA 3REKA 1TAFA 3NQJA 2AROD 3X1TC 1P3LB 3AYWD 2AROB 3X1VC 5BT1C 2BYKA 5BNXB 3B6FD 4J8XC 4Z5TC 5B0YD 3KXBC 5B0YB 4KUDA 2IO5B 5BS7A 1P3MA 3AFAA 3A6NB 3W99D 3AZEA 3WKJD 3W99B 3W96A 3MGSB 3WKJB 3AZMD 3C1BD 3C1BB 4R8PD 4R8PB 4QLCC 3R45B 3RELA 3TU4A 5AY8A 3W98A 4WNNB 3VH5A 5B2ID 5B2JD 1P3GC 4H9SC 1WWSA 3AZED 5B40A 3LELD 5JA4B 1HQ3A 4DRAA 3AZEB 1P3OC 4J8WA 2F8NG 3AZLD 3AZLB 3AZHA 3C1CA 4WU9A 3LJAA 5GT3B 3REKC 1AOIC 4KGCD 3AV1D 4KGCB 1BH9B 3AV1B 2CV5A 2F8NH 5G49B 4J8VD 1KU5A 4EO5C 4KUDC 1P3MC 5BS7C 3AV2D 3AFAC 3AV2B 4J8UD 1R4VA 4J8UB 3W96C 3KUYA 5BT1D 3X1VB 1P3BA 2BYMA 3O62A 3RELC 3TU4C 5AY8C 3KXBD 3AYWA 3VH6T 3KXBB 3W98C 2FJ7D 3MNNA 3B6FA 5KDMB 5B40C 1HQ3C 3B0DC 4J8WC 4H9QA 3AZHC 3WKJA 3C1CC 4WU9C 1M1AD 3AZMA 1M1AB 3C1BA 1KX5A 4R8PA 2CV5C 3WTPA 4WNNA 3AZND 3AZNB 5B2IA 5B2JA 3REKD 3KUYC
chains in the Genus database with same CATH superfamily
1AOIB 3REKB 3LELA 3NQJB 4WU8A 4WZSB 3O62C 4Z66A 4G92C 4KGCA 3F6TA 3AYWC 1ID3A 4KUDD 4KUDB 4H9OA 3B0CW 2YFWA 3MNNC 3LZ1A 3H0RC 3AFAB 4J8VA 3B6FC 3MGQD 5FUGB 5CPIA 1M19A 5B0YC 2IO5C 3EPJA 2JSSA 5DNND 5DNNB 1N1JA 4J8UA 3WKJC 3RELB 3TU4D 3MGPA 3TU4B 3AZMC 5B24A 3C1BC 1KX5C 4R8PC 3W98B 3WTPC 5B1MD 5B1MB 4DRBA 3X1SD 5B40D 4NE6A 3X1SB 5B40B 1HQ3B 5GXQA 2FJ7A 3B0DB 5B2IC 3AZHD 2XD1A 5B2JC 5AVCA 3AZHB 3C1CD 3C1CB 4WU9B 3LJAD 3AZEC 3LJAB 3LELC 5CP6A 4WU8C 3AZKD 1PZRA 1M1AA 3WTPE 1H3OA 4KGCC 1ID3C 5B32G 3LZ1C 4J8VC 1BH8A 3KUYB 5CPIC 1M19C 3UTAA 3REHD 1P3BD 1U35D 2Y2QA 1P3BB 3O62D 4J8UC 5AV9A 3MVDD 3O62B 1U35B 3MGPC 5C3IC 4G92B 5B24C 4ZUXD 3AYWB 4ZUXB 3MNND 3MNNB 4X23D 1P3KD 3LZ0A 3WA9D 5DNMA 3MGRA 3B6FB 3WA9B 5F99D 5F99B 2FJ7C 4H9QB 5GSUA 1KX4A 5FUGA 3NQUA 4UPKA 3MGQA 4H9PA 3AZMB 1KX5D 5CP6C 1TZYA 1KX5B 5DNNA 3X1UD 3AZIA 3WTPD 3WAAA 3WTPB 5BNVA 1M1AC 4NE3A 5B2IB 2Y2PA 5CPKD 5B2JB 5CPKB 5B1MA 3X1SA 3A1IA 3LELB 3AZNC 4WU8D 1KX3A 4WU8B 3H0LC 1T3UA 1EQZA 5AV9C 3KSYA 3FDDA 4Z66D 4Z66B 1ID3D 1ID3B 3AZKA 4H9OB 4KHAA 2YFWB 3LZ1D 3LZ1B 1F1EA 4J8VB 3LZ0C 5DNMC 3MGRC 5CPID 1M19D 5CPIB 1M19B 3EPKA 5GSUC 1N1JB 1KX4C 4CSRA 3MGQC 3MGPD 3P5JB 1ZLAA 3MGPB 5B24D 5C3IB 5B24B 3REHA 3VH6W 5DNNC 3AZIC 4Z2MG 1U35A 2Y2IA 3MVDA 3REJD 3WAAC 1WWIA 5GXQD 4ZUXA 5GXQB 1P3PA 2FJ7B 5AVCD 4X23A 1P3KA 5AVCB 5B1MC 3VH5T 2F8NA 4Z2MH 3WA9A 3X1SC 5F99A 5BO0A 2Y2HA 5CP6D 5CP6B 1KX3C 5B33D 5B33B 2F2AC 1EQZC 3LJAC 1H3OB 1B67A 1S32D 1S32B 3X1UA 3AZKC 1BH8B 4UUZA 2ZY3A 3EPLA 3UTBD 3UTAD 5B31D 3UTBB 3UTAB 5CPKA 5B31B 5AV9D 5AV9B 5AVBA 2HIOD 2HIOB 1BFMA 3REHC 1P3BC 2UWXA 2RVQC 1U35C 3LZ0D 3MVDC 5DNMD 3LZ0B 3MGRD 4JJNA 5DNMB 3MGRB 4ZUXC 5GSUD 4X23C 5GSUB 1W2EA 1P3KC 1KX4D 1KX4B 3WA9C 3MGQB 3NQUB 2Y2GA 2F8NK 4H9PB 5F99C 3AZGA 1TZYD 3AZID 1TZYB 3AZIB 3AZJD 3WAAD 4YS3D 2XD5A 3WAAB 4YS3B 2NZDA 3KFUG 1P3AD 5BNVB 1P3AB 1M18D 5GT0A 4E44A 3X1UC 4LD9A 4G91C 3REJA 3W97A 3A1KA 4E45A 5AV8A 2ZY4A 1KX3D 5AV5D 1KX3B 5AV5B 5CPKC 1EQZD 1EQZB 5E5AD 5AVBC 4XZQA 3AN2D 3KWQA 3AN2B 3AZKB 4KHAB 5B33A 2PYOA 1HTAA 4AWLB 4Z66C 4JJNC 4NE5A 1S32A 3X1TA 4CSRB 4J8XA 1ZLAD 1ZLAB 3AZGC 3UTBA 5B31A 2RVQD 5AV6D 3REHB 3MVDB 2HIOA 3V9RA 3UT9D 1P3PD 3UT9B 1P3PB 4LD9C 4HGAC 4QLCA 4M6BA 4X23B 3REJC 1P3KB 2Y2LA 2ZY2A 2F8ND 3W97C 2F8NB 4CAYB 5AV8C 3AZFD 5BO0B 5GXQC 4DQYB 5AVCC 4WV4B 4XZQC 3KWQC 3X1UB 3AZJA 3B6GA 2HUEC 4G91B 5B33C 2Y2MA 4YS3A 1P3ID 1P3IB 1P3AA 4UUZB 5B32A 1M18A 1S32C 1P3LD 2Y2KA 4XUJD 4XUJB 2LY8A 5AVBD 5AVBB 1P3FD 1P3FB 2NQBD 5AV5A 4H9NA 3UTAC 3UTBC 2NQBB 5B31C 1JFIA 3A6ND 5E5AA 2HIOC 3MGSD 4JJND 4JJNB 3AN2A 5CPJA 2YFVA 4YM6D 3VH6A 4YM6B 3AZGD 3REIA 3AZGB 2Y2OA 2Y2NA 4ZBJB 5B0ZA 2NZDD 2NZDB 1TZYC 5GT0D 1F66A 4LD9D 5AV6A 5GT0B 3AZJC 3B6GC 4LD9B 4HGAB 4YS3C 3REJB 3W97D 3W97B 5AV8D 1A7WA 3VH5W 5GT3D 5AV8B 5B32C 1P3AC 1M18C 3UT9A 2G5HC 4CAYA 5JRGD 4XZQD 3EPHA 5JRGB 4XZQB 3AZFA 3KWQD 5B1LD 5AV5C 3KWQB 5B1LB 3AL0C 2HUEB 2PYOD 5E5AC 2PYOB 3AN2C 3X1TD 5CPJC 3X1TB 3X1VD 4NFTA 1P3IA 4AWLC 1P34A 4J8XD 4Z5TD 2L5AA 4J8XB 4Z5TB 1P3LA 2AROA 3REIC 4XUJA 5BNXA 1Z2CB 5B0ZC 1P3FA 1ZLAC 5B0YA 2NQBA 3H0MC 3V9RB 1F66C 5AV6C 3A6NA 4QLCD 4QLCB 3IP4C 3MGSA 2ZM5A 3W99A 2G5IC 2Y2JA 3UT9C 1P3PC 3R45A 4YM6A 4H9RB 1P3GD 1P3GB 3AZFC 1P3OD 1P3OB 3B6GD 2ZY5A 3AZJB 1B6WA 3B6GB 3B0BA 1AOID 5B32D 5JA4A 5B32B 1M18B 1TAFB 3AZLA 1P3IC 2BYKB 1P34C 5GT3A 1P3LC 2AROC 4EO5B 1BH9A 3AV1A 4H9NB 1P3MD 4XUJC 1P3MB 5G49A 3AFAD 1JFIB 5JRGA 5E5AB 3W96D 1P3FC 3W96B 2BG1A 5CPJD 3B0CT 2NQBC 5B1LA 5CPJB 3AV2A 3A6NC 1ULYA 3W99C 2YFVB 3MGSC 5B31G 3RELD 5AY8D 3REID 5AY8B 3REIB 3X1VA 3W98D 5B0ZD 5B0ZB 4YM6C 4Z5TA 3KXBA 1HQ3D 2CWEA 1F66D 4ZBJC 4J8WD 1F66B 5AV6B 4J8WB 1Q9CA 5CHLB 2NZDC 4WU9D 5KDMA 2RIQA 5GT0C 2CV5D 3AZLC 2CV5B 5GT3C 3AZFB 3AV1C 4H9RA 1P3GA 4WJ3C 5JRGC 4H9SA 3KUYD 1P3OA 3AZNA 2FFFB 5B1LC 3AV2C 1P34D 2PYOC 2BYMB 1P34B 1AOIA 3REKA 1TAFA 2JCHA 2AROD 3NQJA 3X1TC 3AYWD 2AROB 3X1VC 1P3LB 5BT1C 2BYKA 5BNXB 3B6FD 4J8XC 4Z5TC 5B0YD 3KXBC 5B0YB 4KUDA 2IO5B 5BS7A 1P3MA 3AFAA 3A6NB 3W99D 3AZEA 3WKJD 3W99B 3W96A 3MGSB 3WKJB 3EG5B 3AZMD 3C1BD 3C1BB 4R8PD 4R8PB 4QLCC 3R45B 2W8SA 3RELA 3TU4A 5AY8A 3W98A 4WNNB 3VH5A 5B2ID 5B2JD 1P3GC 4H9SC 1WWSA 3AZED 5B40A 3LELD 5JA4B 1HQ3A 2VQRA 4DRAA 3AZEB 4J8WA 1P3OC 2F8NG 3AZLD 3AZLB 3AZHA 3C1CA 4WU9A 2DQNC 3LJAA 5GT3B 3REKC 1AOIC 4KGCD 2JE5A 3AV1D 4KGCB 1BH9B 3AV1B 2CV5A 2F8NH 5G49B 4J8VD 1KU5A 4EO5C 4KUDC 1P3MC 5BS7C 3AV2D 3AFAC 3AV2B 4J8UD 1R4VA 4J8UB 3W96C 3KUYA 5BT1D 3X1VB 1P3BA 2BYMA 3O62A 3RELC 3TU4C 5AY8C 3KXBD 3AYWA 3VH6T 3KXBB 3W98C 2FJ7D 3MNNA 3B6FA 5KDMB 5B40C 1HQ3C 3B0DC 4J8WC 4H9QA 2DF4C 3AZHC 3WKJA 3C1CC 4WU9C 1M1AD 3AZMA 1M1AB 3C1BA 1KX5A 4R8PA 2J8PA 2CV5C 3WTPA 4WNNA 3AZND 3AZNB 5B2IA 5B2JA 3REKD 3KUYC
chains in the Genus database with same CATH topology
1AOIB 3REKB 3LELA 3NQJB 4WU8A 4WZSB 3O62C 4Z66A 4G92C 4KGCA 3F6TA 3AYWC 1ID3A 4KUDD 4KUDB 4H9OA 3B0CW 2YFWA 3MNNC 3LZ1A 3H0RC 3AFAB 4J8VA 3B6FC 3MGQD 5FUGB 5CPIA 1M19A 5B0YC 2IO5C 3EPJA 2JSSA 5DNND 5DNNB 1N1JA 4J8UA 3WKJC 3RELB 3TU4D 3MGPA 3TU4B 3AZMC 5B24A 3C1BC 1KX5C 4R8PC 3W98B 3WTPC 5B1MD 5B1MB 4DRBA 3X1SD 5B40D 4NE6A 3X1SB 5B40B 1HQ3B 5GXQA 2FJ7A 3B0DB 5B2IC 3AZHD 2XD1A 5B2JC 5AVCA 3AZHB 3C1CD 3C1CB 4WU9B 3LJAD 3AZEC 3LJAB 3LELC 5CP6A 4WU8C 3AZKD 1PZRA 1M1AA 3WTPE 1H3OA 4KGCC 1ID3C 5B32G 3LZ1C 4J8VC 1BH8A 3KUYB 5CPIC 1M19C 3UTAA 3REHD 1P3BD 1U35D 2Y2QA 1P3BB 3O62D 4J8UC 5AV9A 3MVDD 3O62B 1U35B 3MGPC 5C3IC 4G92B 5B24C 4ZUXD 3AYWB 4ZUXB 3MNND 3MNNB 4X23D 1P3KD 3LZ0A 3WA9D 5DNMA 3MGRA 3B6FB 3WA9B 5F99D 5F99B 2FJ7C 4H9QB 5GSUA 1KX4A 5FUGA 3NQUA 4UPKA 3MGQA 4H9PA 3AZMB 1KX5D 5CP6C 1TZYA 1KX5B 5DNNA 3X1UD 3AZIA 3WTPD 3WAAA 3WTPB 5BNVA 1M1AC 4NE3A 5B2IB 2Y2PA 5CPKD 5B2JB 5CPKB 5B1MA 3X1SA 3A1IA 3LELB 3AZNC 4WU8D 1KX3A 4WU8B 3H0LC 1T3UA 1EQZA 5AV9C 3KSYA 3FDDA 4Z66D 4Z66B 1ID3D 1ID3B 3AZKA 4H9OB 4KHAA 2YFWB 3LZ1D 3LZ1B 1F1EA 4J8VB 3LZ0C 5DNMC 3MGRC 5CPID 1M19D 5CPIB 1M19B 3EPKA 5GSUC 1N1JB 1KX4C 4CSRA 3MGQC 3MGPD 3P5JB 1ZLAA 3MGPB 5B24D 5C3IB 5B24B 3REHA 3VH6W 5DNNC 3AZIC 4Z2MG 1U35A 2Y2IA 3MVDA 3REJD 3WAAC 1WWIA 5GXQD 4ZUXA 5GXQB 1P3PA 2FJ7B 5AVCD 4X23A 1P3KA 5AVCB 5B1MC 3VH5T 2F8NA 4Z2MH 3WA9A 3X1SC 5F99A 5BO0A 2Y2HA 5CP6D 5CP6B 1KX3C 5B33D 5B33B 2F2AC 1EQZC 3LJAC 1H3OB 1B67A 1S32D 1S32B 3X1UA 3AZKC 1BH8B 4UUZA 2ZY3A 3EPLA 3UTBD 3UTAD 5B31D 3UTBB 3UTAB 5CPKA 5B31B 5AV9D 5AV9B 5AVBA 2HIOD 2HIOB 1BFMA 3REHC 1P3BC 2UWXA 2RVQC 1U35C 3LZ0D 3MVDC 5DNMD 3LZ0B 3MGRD 4JJNA 5DNMB 3MGRB 4ZUXC 5GSUD 4X23C 5GSUB 1W2EA 1P3KC 1KX4D 1KX4B 3WA9C 3MGQB 3NQUB 2Y2GA 2F8NK 4H9PB 5F99C 3AZGA 1TZYD 3AZID 1TZYB 3AZIB 3AZJD 3WAAD 4YS3D 2XD5A 3WAAB 4YS3B 2NZDA 3KFUG 1P3AD 5BNVB 1P3AB 1M18D 5GT0A 4E44A 3X1UC 4LD9A 4G91C 3REJA 3W97A 3A1KA 4E45A 5AV8A 2ZY4A 1KX3D 5AV5D 1KX3B 5AV5B 5CPKC 1EQZD 1EQZB 5E5AD 5AVBC 4XZQA 3AN2D 3KWQA 3AN2B 3AZKB 4KHAB 5B33A 2PYOA 1HTAA 4AWLB 4Z66C 4JJNC 4NE5A 1S32A 3X1TA 4CSRB 4J8XA 1ZLAD 1ZLAB 3AZGC 3UTBA 5B31A 2RVQD 5AV6D 3REHB 3MVDB 2HIOA 3V9RA 3UT9D 1P3PD 3UT9B 1P3PB 4LD9C 4HGAC 4QLCA 4M6BA 4X23B 3REJC 1P3KB 2Y2LA 2ZY2A 2F8ND 3W97C 2F8NB 4CAYB 5AV8C 3AZFD 5BO0B 5GXQC 4DQYB 5AVCC 4WV4B 4XZQC 3KWQC 3X1UB 3AZJA 3B6GA 2HUEC 4G91B 5B33C 2Y2MA 4YS3A 1P3ID 1P3IB 1P3AA 4UUZB 5B32A 1M18A 1S32C 1P3LD 2Y2KA 4XUJD 4XUJB 2LY8A 5AVBD 5AVBB 1P3FD 1P3FB 2NQBD 5AV5A 4H9NA 3UTAC 3UTBC 2NQBB 5B31C 1JFIA 3A6ND 5E5AA 2HIOC 3MGSD 4JJND 4JJNB 3AN2A 5CPJA 2YFVA 4YM6D 3VH6A 4YM6B 3AZGD 3REIA 3AZGB 2Y2OA 2Y2NA 4ZBJB 5B0ZA 2NZDD 2NZDB 1TZYC 5GT0D 1F66A 4LD9D 5AV6A 5GT0B 3AZJC 3B6GC 4LD9B 4HGAB 4YS3C 3REJB 3W97D 3W97B 5AV8D 1A7WA 3VH5W 5GT3D 5AV8B 5B32C 1P3AC 1M18C 3UT9A 2G5HC 4CAYA 5JRGD 4XZQD 3EPHA 5JRGB 4XZQB 3AZFA 3KWQD 5B1LD 5AV5C 3KWQB 5B1LB 3AL0C 2HUEB 2PYOD 5E5AC 2PYOB 3AN2C 3X1TD 5CPJC 3X1TB 3X1VD 4NFTA 1P3IA 4AWLC 1P34A 4J8XD 4Z5TD 2L5AA 4J8XB 4Z5TB 1P3LA 2AROA 3REIC 4XUJA 5BNXA 1Z2CB 5B0ZC 1P3FA 1ZLAC 5B0YA 2NQBA 3H0MC 3V9RB 1F66C 5AV6C 3A6NA 4QLCD 4QLCB 3IP4C 3MGSA 2ZM5A 3W99A 2G5IC 2Y2JA 3UT9C 1P3PC 3R45A 4YM6A 4H9RB 1P3GD 1P3GB 3AZFC 1P3OD 1P3OB 3B6GD 2ZY5A 3AZJB 1B6WA 3B6GB 3B0BA 1AOID 5B32D 5JA4A 5B32B 1M18B 1TAFB 3AZLA 1P3IC 2BYKB 1P34C 5GT3A 1P3LC 2AROC 4EO5B 1BH9A 3AV1A 4H9NB 1P3MD 4XUJC 1P3MB 5G49A 3AFAD 1JFIB 5JRGA 5E5AB 3W96D 1P3FC 3W96B 2BG1A 5CPJD 3B0CT 2NQBC 5B1LA 5CPJB 3AV2A 3A6NC 1ULYA 3W99C 2YFVB 3MGSC 5B31G 3RELD 5AY8D 3REID 5AY8B 3REIB 3X1VA 3W98D 5B0ZD 5B0ZB 4YM6C 4Z5TA 3KXBA 1HQ3D 2CWEA 1F66D 4ZBJC 4J8WD 1F66B 5AV6B 4J8WB 1Q9CA 5CHLB 2NZDC 4WU9D 5KDMA 2RIQA 5GT0C 2CV5D 3AZLC 2CV5B 5GT3C 3AZFB 3AV1C 4H9RA 1P3GA 4WJ3C 5JRGC 4H9SA 3KUYD 1P3OA 3AZNA 2FFFB 5B1LC 3AV2C 1P34D 2PYOC 2BYMB 1P34B 1AOIA 3REKA 1TAFA 2JCHA 2AROD 3NQJA 3X1TC 3AYWD 2AROB 3X1VC 1P3LB 5BT1C 2BYKA 5BNXB 3B6FD 4J8XC 4Z5TC 5B0YD 3KXBC 5B0YB 4KUDA 2IO5B 5BS7A 1P3MA 3AFAA 3A6NB 3W99D 3AZEA 3WKJD 3W99B 3W96A 3MGSB 3WKJB 3EG5B 3AZMD 3C1BD 3C1BB 4R8PD 4R8PB 4QLCC 3R45B 2W8SA 3RELA 3TU4A 5AY8A 3W98A 4WNNB 3VH5A 5B2ID 5B2JD 1P3GC 4H9SC 1WWSA 3AZED 5B40A 3LELD 5JA4B 1HQ3A 2VQRA 4DRAA 3AZEB 4J8WA 1P3OC 2F8NG 3AZLD 3AZLB 3AZHA 3C1CA 4WU9A 2DQNC 3LJAA 5GT3B 3REKC 1AOIC 4KGCD 2JE5A 3AV1D 4KGCB 1BH9B 3AV1B 2CV5A 2F8NH 5G49B 4J8VD 1KU5A 4EO5C 4KUDC 1P3MC 5BS7C 3AV2D 3AFAC 3AV2B 4J8UD 1R4VA 4J8UB 3W96C 3KUYA 5BT1D 3X1VB 1P3BA 2BYMA 3O62A 3RELC 3TU4C 5AY8C 3KXBD 3AYWA 3VH6T 3KXBB 3W98C 2FJ7D 3MNNA 3B6FA 5KDMB 5B40C 1HQ3C 3B0DC 4J8WC 4H9QA 2DF4C 3AZHC 3WKJA 3C1CC 4WU9C 1M1AD 3AZMA 1M1AB 3C1BA 1KX5A 4R8PA 2J8PA 2CV5C 3WTPA 4WNNA 3AZND 3AZNB 5B2IA 5B2JA 3REKD 3KUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI B;  3REK B;  3LEL A;  3NQJ B;  4WU8 A;  4WZS B;  3O62 C;  4Z66 A;  4G92 C;  4KGC A;  1ID3 A;  3AYW C;  4KUD D;  4KUD B;  4H9O A;  3B0C W;  2YFW A;  3MNN C;  3LZ1 A;  3AFA B;  4J8V A;  3B6F C;  3MGQ D;  5FUG B;  5CPI A;  1M19 A;  5B0Y C;  2IO5 C;  2JSS A;  5DNN D;  5DNN B;  1N1J A;  4J8U A;  3WKJ C;  3REL B;  3TU4 D;  3MGP A;  3TU4 B;  3AZM C;  5B24 A;  3C1B C;  1KX5 C;  4R8P C;  3W98 B;  3WTP C;  5B1M D;  5B1M B;  4DRB A;  3X1S D;  5B40 D;  4NE6 A;  3X1S B;  5B40 B;  5GXQ A;  1HQ3 B;  2FJ7 A;  3B0D B;  5B2I C;  3AZH D;  5B2J C;  5AVC A;  3AZH B;  3C1C D;  3C1C B;  4WU9 B;  3LJA D;  3AZE C;  3LJA B;  3LEL C;  5CP6 A;  4WU8 C;  3AZK D;  1M1A A;  3WTP E;  1H3O A;  4KGC C;  1ID3 C;  5B32 G;  3LZ1 C;  4J8V C;  1BH8 A;  3KUY B;  5CPI C;  1M19 C;  3UTA A;  3REH D;  1P3B D;  1U35 D;  1P3B B;  3O62 D;  4J8U C;  5AV9 A;  3MVD D;  3O62 B;  1U35 B;  3MGP C;  5C3I C;  4G92 B;  5B24 C;  4ZUX D;  3AYW B;  4ZUX B;  3MNN D;  3MNN B;  4X23 D;  1P3K D;  3LZ0 A;  3WA9 D;  5DNM A;  3MGR A;  3B6F B;  3WA9 B;  5F99 D;  5F99 B;  2FJ7 C;  4H9Q B;  5GSU A;  1KX4 A;  5FUG A;  3NQU A;  3MGQ A;  4H9P A;  3AZM B;  1KX5 D;  5CP6 C;  1TZY A;  1KX5 B;  5DNN A;  3X1U D;  3AZI A;  3WTP D;  3WAA A;  3WTP B;  5BNV A;  1M1A C;  4NE3 A;  5B2I B;  5CPK D;  5B2J B;  5CPK B;  5B1M A;  3X1S A;  3LEL B;  3AZN C;  4WU8 D;  1KX3 A;  4WU8 B;  1EQZ A;  5AV9 C;  3KSY A;  4Z66 D;  4Z66 B;  1ID3 D;  1ID3 B;  3AZK A;  4H9O B;  4KHA A;  2YFW B;  3LZ1 D;  3LZ1 B;  1F1E A;  4J8V B;  3LZ0 C;  5DNM C;  3MGR C;  5CPI D;  1M19 D;  5CPI B;  1M19 B;  5GSU C;  1N1J B;  1KX4 C;  4CSR A;  3MGQ C;  3MGP D;  1ZLA A;  3MGP B;  5B24 D;  5C3I B;  5B24 B;  3REH A;  3VH6 W;  5DNN C;  3AZI C;  4Z2M G;  1U35 A;  3MVD A;  3REJ D;  3WAA C;  1WWI A;  5GXQ D;  4ZUX A;  5GXQ B;  1P3P A;  2FJ7 B;  5AVC D;  4X23 A;  1P3K A;  5AVC B;  5B1M C;  3VH5 T;  2F8N A;  4Z2M H;  3WA9 A;  3X1S C;  5F99 A;  5BO0 A;  5CP6 D;  5CP6 B;  1KX3 C;  5B33 D;  5B33 B;  1EQZ C;  3LJA C;  1H3O B;  1B67 A;  1S32 D;  1S32 B;  3X1U A;  3AZK C;  1BH8 B;  4UUZ A;  3UTB D;  3UTA D;  5B31 D;  3UTB B;  3UTA B;  5CPK A;  5B31 B;  5AV9 D;  5AV9 B;  5AVB A;  2HIO D;  2HIO B;  1BFM A;  3REH C;  1P3B C;  2RVQ C;  1U35 C;  3LZ0 D;  3MVD C;  5DNM D;  3LZ0 B;  3MGR D;  4JJN A;  5DNM B;  3MGR B;  4ZUX C;  5GSU D;  4X23 C;  5GSU B;  1P3K C;  1KX4 D;  1KX4 B;  3WA9 C;  3MGQ B;  3NQU B;  2F8N K;  4H9P B;  5F99 C;  3AZG A;  1TZY D;  3AZI D;  1TZY B;  3AZI B;  3AZJ D;  3WAA D;  4YS3 D;  3WAA B;  4YS3 B;  2NZD A;  1P3A D;  5BNV B;  1P3A B;  1M18 D;  5GT0 A;  4E44 A;  3X1U C;  4LD9 A;  4G91 C;  3REJ A;  3W97 A;  4E45 A;  5AV8 A;  1KX3 D;  5AV5 D;  1KX3 B;  5AV5 B;  5CPK C;  1EQZ D;  1EQZ B;  5E5A D;  5AVB C;  4XZQ A;  3AN2 D;  3KWQ A;  3AN2 B;  3AZK B;  4KHA B;  5B33 A;  2PYO A;  1HTA A;  4AWL B;  4Z66 C;  4JJN C;  4NE5 A;  1S32 A;  3X1T A;  4CSR B;  4J8X A;  1ZLA D;  1ZLA B;  3AZG C;  3UTB A;  5B31 A;  2RVQ D;  5AV6 D;  3REH B;  3MVD B;  2HIO A;  3V9R A;  3UT9 D;  1P3P D;  3UT9 B;  1P3P B;  4LD9 C;  4HGA C;  4QLC A;  4M6B A;  4X23 B;  3REJ C;  1P3K B;  2F8N D;  3W97 C;  2F8N B;  4CAY B;  5AV8 C;  3AZF D;  5BO0 B;  5GXQ C;  5AVC C;  4WV4 B;  4XZQ C;  3KWQ C;  3X1U B;  3AZJ A;  3B6G A;  2HUE C;  4G91 B;  5B33 C;  4YS3 A;  1P3I D;  1P3I B;  1P3A A;  4UUZ B;  5B32 A;  1M18 A;  1S32 C;  1P3L D;  4XUJ D;  4XUJ B;  2LY8 A;  5AVB D;  5AVB B;  1P3F D;  1P3F B;  2NQB D;  5AV5 A;  4H9N A;  3UTA C;  3UTB C;  2NQB B;  5B31 C;  1JFI A;  3A6N D;  5E5A A;  2HIO C;  3MGS D;  4JJN D;  4JJN B;  3AN2 A;  5CPJ A;  2YFV A;  4YM6 D;  3VH6 A;  4YM6 B;  3AZG D;  3REI A;  3AZG B;  4ZBJ B;  5B0Z A;  2NZD D;  2NZD B;  1TZY C;  5GT0 D;  1F66 A;  4LD9 D;  5AV6 A;  5GT0 B;  3AZJ C;  3B6G C;  4LD9 B;  4HGA B;  4YS3 C;  3REJ B;  3W97 D;  3W97 B;  5AV8 D;  1A7W A;  3VH5 W;  5GT3 D;  5AV8 B;  5B32 C;  1P3A C;  1M18 C;  3UT9 A;  4CAY A;  5JRG D;  4XZQ D;  5JRG B;  4XZQ B;  3AZF A;  3KWQ D;  5B1L D;  5AV5 C;  3KWQ B;  5B1L B;  2HUE B;  2PYO D;  5E5A C;  2PYO B;  3AN2 C;  3X1T D;  5CPJ C;  3X1T B;  3X1V D;  4NFT A;  1P3I A;  4AWL C;  1P34 A;  4J8X D;  4Z5T D;  2L5A A;  4J8X B;  4Z5T B;  1P3L A;  2ARO A;  3REI C;  4XUJ A;  5BNX A;  5B0Z C;  1P3F A;  1ZLA C;  5B0Y A;  2NQB A;  3V9R B;  1F66 C;  5AV6 C;  3A6N A;  4QLC D;  4QLC B;  3W99 A;  3MGS A;  3UT9 C;  1P3P C;  3R45 A;  4YM6 A;  4H9R B;  1P3G D;  1P3G B;  3AZF C;  1P3O D;  1P3O B;  3B6G D;  3AZJ B;  3B6G B;  1B6W A;  3B0B A;  1AOI D;  5B32 D;  5JA4 A;  5B32 B;  1M18 B;  1TAF B;  3AZL A;  1P3I C;  2BYK B;  1P34 C;  5GT3 A;  1P3L C;  2ARO C;  4EO5 B;  1BH9 A;  3AV1 A;  4H9N B;  1P3M D;  4XUJ C;  1P3M B;  5G49 A;  3AFA D;  1JFI B;  5JRG A;  5E5A B;  3W96 D;  1P3F C;  3W96 B;  5CPJ D;  3B0C T;  2NQB C;  5B1L A;  5CPJ B;  3AV2 A;  3A6N C;  1ULY A;  3W99 C;  2YFV B;  3MGS C;  5B31 G;  3REL D;  5AY8 D;  3REI D;  5AY8 B;  3REI B;  3X1V A;  3W98 D;  5B0Z D;  5B0Z B;  4YM6 C;  4Z5T A;  3KXB A;  1HQ3 D;  2CWE A;  1F66 D;  4ZBJ C;  4J8W D;  1F66 B;  5AV6 B;  4J8W B;  1Q9C A;  5CHL B;  2NZD C;  4WU9 D;  5KDM A;  5GT0 C;  2CV5 D;  3AZL C;  2CV5 B;  5GT3 C;  3AZF B;  3AV1 C;  4H9R A;  1P3G A;  5JRG C;  4H9S A;  3KUY D;  1P3O A;  3AZN A;  5B1L C;  3AV2 C;  1P34 D;  2PYO C;  2BYM B;  1P34 B;  1AOI A;  3REK A;  1TAF A;  3NQJ A;  2ARO D;  3X1T C;  1P3L B;  3AYW D;  2ARO B;  3X1V C;  5BT1 C;  2BYK A;  5BNX B;  3B6F D;  4J8X C;  4Z5T C;  5B0Y D;  3KXB C;  5B0Y B;  4KUD A;  2IO5 B;  5BS7 A;  1P3M A;  3AFA A;  3A6N B;  3W99 D;  3AZE A;  3WKJ D;  3W99 B;  3W96 A;  3MGS B;  3WKJ B;  3AZM D;  3C1B D;  3C1B B;  4R8P D;  4R8P B;  4QLC C;  3R45 B;  3REL A;  3TU4 A;  5AY8 A;  3W98 A;  4WNN B;  3VH5 A;  5B2I D;  5B2J D;  1P3G C;  4H9S C;  1WWS A;  3AZE D;  5B40 A;  3LEL D;  5JA4 B;  1HQ3 A;  4DRA A;  3AZE B;  1P3O C;  4J8W A;  2F8N G;  3AZL D;  3AZL B;  3AZH A;  3C1C A;  4WU9 A;  3LJA A;  5GT3 B;  3REK C;  1AOI C;  4KGC D;  3AV1 D;  4KGC B;  1BH9 B;  3AV1 B;  2CV5 A;  2F8N H;  5G49 B;  4J8V D;  1KU5 A;  4EO5 C;  4KUD C;  1P3M C;  5BS7 C;  3AV2 D;  3AFA C;  3AV2 B;  4J8U D;  1R4V A;  4J8U B;  3W96 C;  3KUY A;  5BT1 D;  3X1V B;  1P3B A;  2BYM A;  3O62 A;  3REL C;  3TU4 C;  5AY8 C;  3KXB D;  3AYW A;  3VH6 T;  3KXB B;  3W98 C;  2FJ7 D;  3MNN A;  3B6F A;  5KDM B;  5B40 C;  1HQ3 C;  3B0D C;  4J8W C;  4H9Q A;  3AZH C;  3WKJ A;  3C1C C;  4WU9 C;  1M1A D;  3AZM A;  1M1A B;  3C1B A;  1KX5 A;  4R8P A;  2CV5 C;  3WTP A;  4WNN A;  3AZN D;  3AZN B;  5B2I A;  5B2J A;  3REK D;  3KUY C; 
#chains in the Genus database with same CATH topology
 1AOI B;  3REK B;  3LEL A;  3NQJ B;  4WU8 A;  4WZS B;  3O62 C;  4Z66 A;  4G92 C;  4KGC A;  3F6T A;  3AYW C;  1ID3 A;  4KUD D;  4KUD B;  4H9O A;  3B0C W;  2YFW A;  3MNN C;  3LZ1 A;  3H0R C;  3AFA B;  4J8V A;  3B6F C;  3MGQ D;  5FUG B;  5CPI A;  1M19 A;  5B0Y C;  2IO5 C;  3EPJ A;  2JSS A;  5DNN D;  5DNN B;  1N1J A;  4J8U A;  3WKJ C;  3REL B;  3TU4 D;  3MGP A;  3TU4 B;  3AZM C;  5B24 A;  3C1B C;  1KX5 C;  4R8P C;  3W98 B;  3WTP C;  5B1M D;  5B1M B;  4DRB A;  3X1S D;  5B40 D;  4NE6 A;  3X1S B;  5B40 B;  1HQ3 B;  5GXQ A;  2FJ7 A;  3B0D B;  5B2I C;  3AZH D;  2XD1 A;  5B2J C;  5AVC A;  3AZH B;  3C1C D;  3C1C B;  4WU9 B;  3LJA D;  3AZE C;  3LJA B;  3LEL C;  5CP6 A;  4WU8 C;  3AZK D;  1PZR A;  1M1A A;  3WTP E;  1H3O A;  4KGC C;  1ID3 C;  5B32 G;  3LZ1 C;  4J8V C;  1BH8 A;  3KUY B;  5CPI C;  1M19 C;  3UTA A;  3REH D;  1P3B D;  1U35 D;  2Y2Q A;  1P3B B;  3O62 D;  4J8U C;  5AV9 A;  3MVD D;  3O62 B;  1U35 B;  3MGP C;  5C3I C;  4G92 B;  5B24 C;  4ZUX D;  3AYW B;  4ZUX B;  3MNN D;  3MNN B;  4X23 D;  1P3K D;  3LZ0 A;  3WA9 D;  5DNM A;  3MGR A;  3B6F B;  3WA9 B;  5F99 D;  5F99 B;  2FJ7 C;  4H9Q B;  5GSU A;  1KX4 A;  5FUG A;  3NQU A;  4UPK A;  3MGQ A;  4H9P A;  3AZM B;  1KX5 D;  5CP6 C;  1TZY A;  1KX5 B;  5DNN A;  3X1U D;  3AZI A;  3WTP D;  3WAA A;  3WTP B;  5BNV A;  1M1A C;  4NE3 A;  5B2I B;  2Y2P A;  5CPK D;  5B2J B;  5CPK B;  5B1M A;  3X1S A;  3A1I A;  3LEL B;  3AZN C;  4WU8 D;  1KX3 A;  4WU8 B;  3H0L C;  1T3U A;  1EQZ A;  5AV9 C;  3KSY A;  3FDD A;  4Z66 D;  4Z66 B;  1ID3 D;  1ID3 B;  3AZK A;  4H9O B;  4KHA A;  2YFW B;  3LZ1 D;  3LZ1 B;  1F1E A;  4J8V B;  3LZ0 C;  5DNM C;  3MGR C;  5CPI D;  1M19 D;  5CPI B;  1M19 B;  3EPK A;  5GSU C;  1N1J B;  1KX4 C;  4CSR A;  3MGQ C;  3MGP D;  3P5J B;  1ZLA A;  3MGP B;  5B24 D;  5C3I B;  5B24 B;  3REH A;  3VH6 W;  5DNN C;  3AZI C;  4Z2M G;  1U35 A;  2Y2I A;  3MVD A;  3REJ D;  3WAA C;  1WWI A;  5GXQ D;  4ZUX A;  5GXQ B;  1P3P A;  2FJ7 B;  5AVC D;  4X23 A;  1P3K A;  5AVC B;  5B1M C;  3VH5 T;  2F8N A;  4Z2M H;  3WA9 A;  3X1S C;  5F99 A;  5BO0 A;  2Y2H A;  5CP6 D;  5CP6 B;  1KX3 C;  5B33 D;  5B33 B;  2F2A C;  1EQZ C;  3LJA C;  1H3O B;  1B67 A;  1S32 D;  1S32 B;  3X1U A;  3AZK C;  1BH8 B;  4UUZ A;  2ZY3 A;  3EPL A;  3UTB D;  3UTA D;  5B31 D;  3UTB B;  3UTA B;  5CPK A;  5B31 B;  5AV9 D;  5AV9 B;  5AVB A;  2HIO D;  2HIO B;  1BFM A;  3REH C;  1P3B C;  2UWX A;  2RVQ C;  1U35 C;  3LZ0 D;  3MVD C;  5DNM D;  3LZ0 B;  3MGR D;  4JJN A;  5DNM B;  3MGR B;  4ZUX C;  5GSU D;  4X23 C;  5GSU B;  1W2E A;  1P3K C;  1KX4 D;  1KX4 B;  3WA9 C;  3MGQ B;  3NQU B;  2Y2G A;  2F8N K;  4H9P B;  5F99 C;  3AZG A;  1TZY D;  3AZI D;  1TZY B;  3AZI B;  3AZJ D;  3WAA D;  4YS3 D;  2XD5 A;  3WAA B;  4YS3 B;  2NZD A;  3KFU G;  1P3A D;  5BNV B;  1P3A B;  1M18 D;  5GT0 A;  4E44 A;  3X1U C;  4LD9 A;  4G91 C;  3REJ A;  3W97 A;  3A1K A;  4E45 A;  5AV8 A;  2ZY4 A;  1KX3 D;  5AV5 D;  1KX3 B;  5AV5 B;  5CPK C;  1EQZ D;  1EQZ B;  5E5A D;  5AVB C;  4XZQ A;  3AN2 D;  3KWQ A;  3AN2 B;  3AZK B;  4KHA B;  5B33 A;  2PYO A;  1HTA A;  4AWL B;  4Z66 C;  4JJN C;  4NE5 A;  1S32 A;  3X1T A;  4CSR B;  4J8X A;  1ZLA D;  1ZLA B;  3AZG C;  3UTB A;  5B31 A;  2RVQ D;  5AV6 D;  3REH B;  3MVD B;  2HIO A;  3V9R A;  3UT9 D;  1P3P D;  3UT9 B;  1P3P B;  4LD9 C;  4HGA C;  4QLC A;  4M6B A;  4X23 B;  3REJ C;  1P3K B;  2Y2L A;  2ZY2 A;  2F8N D;  3W97 C;  2F8N B;  4CAY B;  5AV8 C;  3AZF D;  5BO0 B;  5GXQ C;  4DQY B;  5AVC C;  4WV4 B;  4XZQ C;  3KWQ C;  3X1U B;  3AZJ A;  3B6G A;  2HUE C;  4G91 B;  5B33 C;  2Y2M A;  4YS3 A;  1P3I D;  1P3I B;  1P3A A;  4UUZ B;  5B32 A;  1M18 A;  1S32 C;  1P3L D;  2Y2K A;  4XUJ D;  4XUJ B;  2LY8 A;  5AVB D;  5AVB B;  1P3F D;  1P3F B;  2NQB D;  5AV5 A;  4H9N A;  3UTA C;  3UTB C;  2NQB B;  5B31 C;  1JFI A;  3A6N D;  5E5A A;  2HIO C;  3MGS D;  4JJN D;  4JJN B;  3AN2 A;  5CPJ A;  2YFV A;  4YM6 D;  3VH6 A;  4YM6 B;  3AZG D;  3REI A;  3AZG B;  2Y2O A;  2Y2N A;  4ZBJ B;  5B0Z A;  2NZD D;  2NZD B;  1TZY C;  5GT0 D;  1F66 A;  4LD9 D;  5AV6 A;  5GT0 B;  3AZJ C;  3B6G C;  4LD9 B;  4HGA B;  4YS3 C;  3REJ B;  3W97 D;  3W97 B;  5AV8 D;  1A7W A;  3VH5 W;  5GT3 D;  5AV8 B;  5B32 C;  1P3A C;  1M18 C;  3UT9 A;  2G5H C;  4CAY A;  5JRG D;  4XZQ D;  3EPH A;  5JRG B;  4XZQ B;  3AZF A;  3KWQ D;  5B1L D;  5AV5 C;  3KWQ B;  5B1L B;  3AL0 C;  2HUE B;  2PYO D;  5E5A C;  2PYO B;  3AN2 C;  3X1T D;  5CPJ C;  3X1T B;  3X1V D;  4NFT A;  1P3I A;  4AWL C;  1P34 A;  4J8X D;  4Z5T D;  2L5A A;  4J8X B;  4Z5T B;  1P3L A;  2ARO A;  3REI C;  4XUJ A;  5BNX A;  1Z2C B;  5B0Z C;  1P3F A;  1ZLA C;  5B0Y A;  2NQB A;  3H0M C;  3V9R B;  1F66 C;  5AV6 C;  3A6N A;  4QLC D;  4QLC B;  3IP4 C;  3MGS A;  2ZM5 A;  3W99 A;  2G5I C;  2Y2J A;  3UT9 C;  1P3P C;  3R45 A;  4YM6 A;  4H9R B;  1P3G D;  1P3G B;  3AZF C;  1P3O D;  1P3O B;  3B6G D;  2ZY5 A;  3AZJ B;  1B6W A;  3B6G B;  3B0B A;  1AOI D;  5B32 D;  5JA4 A;  5B32 B;  1M18 B;  1TAF B;  3AZL A;  1P3I C;  2BYK B;  1P34 C;  5GT3 A;  1P3L C;  2ARO C;  4EO5 B;  1BH9 A;  3AV1 A;  4H9N B;  1P3M D;  4XUJ C;  1P3M B;  5G49 A;  3AFA D;  1JFI B;  5JRG A;  5E5A B;  3W96 D;  1P3F C;  3W96 B;  2BG1 A;  5CPJ D;  3B0C T;  2NQB C;  5B1L A;  5CPJ B;  3AV2 A;  3A6N C;  1ULY A;  3W99 C;  2YFV B;  3MGS C;  5B31 G;  3REL D;  5AY8 D;  3REI D;  5AY8 B;  3REI B;  3X1V A;  3W98 D;  5B0Z D;  5B0Z B;  4YM6 C;  4Z5T A;  3KXB A;  1HQ3 D;  2CWE A;  1F66 D;  4ZBJ C;  4J8W D;  1F66 B;  5AV6 B;  4J8W B;  1Q9C A;  5CHL B;  2NZD C;  4WU9 D;  5KDM A;  2RIQ A;  5GT0 C;  2CV5 D;  3AZL C;  2CV5 B;  5GT3 C;  3AZF B;  3AV1 C;  4H9R A;  1P3G A;  4WJ3 C;  5JRG C;  4H9S A;  3KUY D;  1P3O A;  3AZN A;  2FFF B;  5B1L C;  3AV2 C;  1P34 D;  2PYO C;  2BYM B;  1P34 B;  1AOI A;  3REK A;  1TAF A;  2JCH A;  2ARO D;  3NQJ A;  3X1T C;  3AYW D;  2ARO B;  3X1V C;  1P3L B;  5BT1 C;  2BYK A;  5BNX B;  3B6F D;  4J8X C;  4Z5T C;  5B0Y D;  3KXB C;  5B0Y B;  4KUD A;  2IO5 B;  5BS7 A;  1P3M A;  3AFA A;  3A6N B;  3W99 D;  3AZE A;  3WKJ D;  3W99 B;  3W96 A;  3MGS B;  3WKJ B;  3EG5 B;  3AZM D;  3C1B D;  3C1B B;  4R8P D;  4R8P B;  4QLC C;  3R45 B;  2W8S A;  3REL A;  3TU4 A;  5AY8 A;  3W98 A;  4WNN B;  3VH5 A;  5B2I D;  5B2J D;  1P3G C;  4H9S C;  1WWS A;  3AZE D;  5B40 A;  3LEL D;  5JA4 B;  1HQ3 A;  2VQR A;  4DRA A;  3AZE B;  4J8W A;  1P3O C;  2F8N G;  3AZL D;  3AZL B;  3AZH A;  3C1C A;  4WU9 A;  2DQN C;  3LJA A;  5GT3 B;  3REK C;  1AOI C;  4KGC D;  2JE5 A;  3AV1 D;  4KGC B;  1BH9 B;  3AV1 B;  2CV5 A;  2F8N H;  5G49 B;  4J8V D;  1KU5 A;  4EO5 C;  4KUD C;  1P3M C;  5BS7 C;  3AV2 D;  3AFA C;  3AV2 B;  4J8U D;  1R4V A;  4J8U B;  3W96 C;  3KUY A;  5BT1 D;  3X1V B;  1P3B A;  2BYM A;  3O62 A;  3REL C;  3TU4 C;  5AY8 C;  3KXB D;  3AYW A;  3VH6 T;  3KXB B;  3W98 C;  2FJ7 D;  3MNN A;  3B6F A;  5KDM B;  5B40 C;  1HQ3 C;  3B0D C;  4J8W C;  4H9Q A;  2DF4 C;  3AZH C;  3WKJ A;  3C1C C;  4WU9 C;  1M1A D;  3AZM A;  1M1A B;  3C1B A;  1KX5 A;  4R8P A;  2J8P A;  2CV5 C;  3WTP A;  4WNN A;  3AZN D;  3AZN B;  5B2I A;  5B2J A;  3REK D;  3KUY C; 
#chains in the Genus database with same CATH homology
 1AOI B;  3REK B;  3LEL A;  3NQJ B;  4WU8 A;  4WZS B;  3O62 C;  4Z66 A;  4G92 C;  4KGC A;  3F6T A;  3AYW C;  1ID3 A;  4KUD D;  4KUD B;  4H9O A;  3B0C W;  2YFW A;  3MNN C;  3LZ1 A;  3H0R C;  3AFA B;  4J8V A;  3B6F C;  3MGQ D;  5FUG B;  5CPI A;  1M19 A;  5B0Y C;  2IO5 C;  3EPJ A;  2JSS A;  5DNN D;  5DNN B;  1N1J A;  4J8U A;  3WKJ C;  3REL B;  3TU4 D;  3MGP A;  3TU4 B;  3AZM C;  5B24 A;  3C1B C;  1KX5 C;  4R8P C;  3W98 B;  3WTP C;  5B1M D;  5B1M B;  4DRB A;  3X1S D;  5B40 D;  4NE6 A;  3X1S B;  5B40 B;  1HQ3 B;  5GXQ A;  2FJ7 A;  3B0D B;  5B2I C;  3AZH D;  2XD1 A;  5B2J C;  5AVC A;  3AZH B;  3C1C D;  3C1C B;  4WU9 B;  3LJA D;  3AZE C;  3LJA B;  3LEL C;  5CP6 A;  4WU8 C;  3AZK D;  1PZR A;  1M1A A;  3WTP E;  1H3O A;  4KGC C;  1ID3 C;  5B32 G;  3LZ1 C;  4J8V C;  1BH8 A;  3KUY B;  5CPI C;  1M19 C;  3UTA A;  3REH D;  1P3B D;  1U35 D;  2Y2Q A;  1P3B B;  3O62 D;  4J8U C;  5AV9 A;  3MVD D;  3O62 B;  1U35 B;  3MGP C;  5C3I C;  4G92 B;  5B24 C;  4ZUX D;  3AYW B;  4ZUX B;  3MNN D;  3MNN B;  4X23 D;  1P3K D;  3LZ0 A;  3WA9 D;  5DNM A;  3MGR A;  3B6F B;  3WA9 B;  5F99 D;  5F99 B;  2FJ7 C;  4H9Q B;  5GSU A;  1KX4 A;  5FUG A;  3NQU A;  4UPK A;  3MGQ A;  4H9P A;  3AZM B;  1KX5 D;  5CP6 C;  1TZY A;  1KX5 B;  5DNN A;  3X1U D;  3AZI A;  3WTP D;  3WAA A;  3WTP B;  5BNV A;  1M1A C;  4NE3 A;  5B2I B;  2Y2P A;  5CPK D;  5B2J B;  5CPK B;  5B1M A;  3X1S A;  3A1I A;  3LEL B;  3AZN C;  4WU8 D;  1KX3 A;  4WU8 B;  3H0L C;  1T3U A;  1EQZ A;  5AV9 C;  3KSY A;  3FDD A;  4Z66 D;  4Z66 B;  1ID3 D;  1ID3 B;  3AZK A;  4H9O B;  4KHA A;  2YFW B;  3LZ1 D;  3LZ1 B;  1F1E A;  4J8V B;  3LZ0 C;  5DNM C;  3MGR C;  5CPI D;  1M19 D;  5CPI B;  1M19 B;  3EPK A;  5GSU C;  1N1J B;  1KX4 C;  4CSR A;  3MGQ C;  3MGP D;  3P5J B;  1ZLA A;  3MGP B;  5B24 D;  5C3I B;  5B24 B;  3REH A;  3VH6 W;  5DNN C;  3AZI C;  4Z2M G;  1U35 A;  2Y2I A;  3MVD A;  3REJ D;  3WAA C;  1WWI A;  5GXQ D;  4ZUX A;  5GXQ B;  1P3P A;  2FJ7 B;  5AVC D;  4X23 A;  1P3K A;  5AVC B;  5B1M C;  3VH5 T;  2F8N A;  4Z2M H;  3WA9 A;  3X1S C;  5F99 A;  5BO0 A;  2Y2H A;  5CP6 D;  5CP6 B;  1KX3 C;  5B33 D;  5B33 B;  2F2A C;  1EQZ C;  3LJA C;  1H3O B;  1B67 A;  1S32 D;  1S32 B;  3X1U A;  3AZK C;  1BH8 B;  4UUZ A;  2ZY3 A;  3EPL A;  3UTB D;  3UTA D;  5B31 D;  3UTB B;  3UTA B;  5CPK A;  5B31 B;  5AV9 D;  5AV9 B;  5AVB A;  2HIO D;  2HIO B;  1BFM A;  3REH C;  1P3B C;  2UWX A;  2RVQ C;  1U35 C;  3LZ0 D;  3MVD C;  5DNM D;  3LZ0 B;  3MGR D;  4JJN A;  5DNM B;  3MGR B;  4ZUX C;  5GSU D;  4X23 C;  5GSU B;  1W2E A;  1P3K C;  1KX4 D;  1KX4 B;  3WA9 C;  3MGQ B;  3NQU B;  2Y2G A;  2F8N K;  4H9P B;  5F99 C;  3AZG A;  1TZY D;  3AZI D;  1TZY B;  3AZI B;  3AZJ D;  3WAA D;  4YS3 D;  2XD5 A;  3WAA B;  4YS3 B;  2NZD A;  3KFU G;  1P3A D;  5BNV B;  1P3A B;  1M18 D;  5GT0 A;  4E44 A;  3X1U C;  4LD9 A;  4G91 C;  3REJ A;  3W97 A;  3A1K A;  4E45 A;  5AV8 A;  2ZY4 A;  1KX3 D;  5AV5 D;  1KX3 B;  5AV5 B;  5CPK C;  1EQZ D;  1EQZ B;  5E5A D;  5AVB C;  4XZQ A;  3AN2 D;  3KWQ A;  3AN2 B;  3AZK B;  4KHA B;  5B33 A;  2PYO A;  1HTA A;  4AWL B;  4Z66 C;  4JJN C;  4NE5 A;  1S32 A;  3X1T A;  4CSR B;  4J8X A;  1ZLA D;  1ZLA B;  3AZG C;  3UTB A;  5B31 A;  2RVQ D;  5AV6 D;  3REH B;  3MVD B;  2HIO A;  3V9R A;  3UT9 D;  1P3P D;  3UT9 B;  1P3P B;  4LD9 C;  4HGA C;  4QLC A;  4M6B A;  4X23 B;  3REJ C;  1P3K B;  2Y2L A;  2ZY2 A;  2F8N D;  3W97 C;  2F8N B;  4CAY B;  5AV8 C;  3AZF D;  5BO0 B;  5GXQ C;  4DQY B;  5AVC C;  4WV4 B;  4XZQ C;  3KWQ C;  3X1U B;  3AZJ A;  3B6G A;  2HUE C;  4G91 B;  5B33 C;  2Y2M A;  4YS3 A;  1P3I D;  1P3I B;  1P3A A;  4UUZ B;  5B32 A;  1M18 A;  1S32 C;  1P3L D;  2Y2K A;  4XUJ D;  4XUJ B;  2LY8 A;  5AVB D;  5AVB B;  1P3F D;  1P3F B;  2NQB D;  5AV5 A;  4H9N A;  3UTA C;  3UTB C;  2NQB B;  5B31 C;  1JFI A;  3A6N D;  5E5A A;  2HIO C;  3MGS D;  4JJN D;  4JJN B;  3AN2 A;  5CPJ A;  2YFV A;  4YM6 D;  3VH6 A;  4YM6 B;  3AZG D;  3REI A;  3AZG B;  2Y2O A;  2Y2N A;  4ZBJ B;  5B0Z A;  2NZD D;  2NZD B;  1TZY C;  5GT0 D;  1F66 A;  4LD9 D;  5AV6 A;  5GT0 B;  3AZJ C;  3B6G C;  4LD9 B;  4HGA B;  4YS3 C;  3REJ B;  3W97 D;  3W97 B;  5AV8 D;  1A7W A;  3VH5 W;  5GT3 D;  5AV8 B;  5B32 C;  1P3A C;  1M18 C;  3UT9 A;  2G5H C;  4CAY A;  5JRG D;  4XZQ D;  3EPH A;  5JRG B;  4XZQ B;  3AZF A;  3KWQ D;  5B1L D;  5AV5 C;  3KWQ B;  5B1L B;  3AL0 C;  2HUE B;  2PYO D;  5E5A C;  2PYO B;  3AN2 C;  3X1T D;  5CPJ C;  3X1T B;  3X1V D;  4NFT A;  1P3I A;  4AWL C;  1P34 A;  4J8X D;  4Z5T D;  2L5A A;  4J8X B;  4Z5T B;  1P3L A;  2ARO A;  3REI C;  4XUJ A;  5BNX A;  1Z2C B;  5B0Z C;  1P3F A;  1ZLA C;  5B0Y A;  2NQB A;  3H0M C;  3V9R B;  1F66 C;  5AV6 C;  3A6N A;  4QLC D;  4QLC B;  3IP4 C;  3MGS A;  2ZM5 A;  3W99 A;  2G5I C;  2Y2J A;  3UT9 C;  1P3P C;  3R45 A;  4YM6 A;  4H9R B;  1P3G D;  1P3G B;  3AZF C;  1P3O D;  1P3O B;  3B6G D;  2ZY5 A;  3AZJ B;  1B6W A;  3B6G B;  3B0B A;  1AOI D;  5B32 D;  5JA4 A;  5B32 B;  1M18 B;  1TAF B;  3AZL A;  1P3I C;  2BYK B;  1P34 C;  5GT3 A;  1P3L C;  2ARO C;  4EO5 B;  1BH9 A;  3AV1 A;  4H9N B;  1P3M D;  4XUJ C;  1P3M B;  5G49 A;  3AFA D;  1JFI B;  5JRG A;  5E5A B;  3W96 D;  1P3F C;  3W96 B;  2BG1 A;  5CPJ D;  3B0C T;  2NQB C;  5B1L A;  5CPJ B;  3AV2 A;  3A6N C;  1ULY A;  3W99 C;  2YFV B;  3MGS C;  5B31 G;  3REL D;  5AY8 D;  3REI D;  5AY8 B;  3REI B;  3X1V A;  3W98 D;  5B0Z D;  5B0Z B;  4YM6 C;  4Z5T A;  3KXB A;  1HQ3 D;  2CWE A;  1F66 D;  4ZBJ C;  4J8W D;  1F66 B;  5AV6 B;  4J8W B;  1Q9C A;  5CHL B;  2NZD C;  4WU9 D;  5KDM A;  2RIQ A;  5GT0 C;  2CV5 D;  3AZL C;  2CV5 B;  5GT3 C;  3AZF B;  3AV1 C;  4H9R A;  1P3G A;  4WJ3 C;  5JRG C;  4H9S A;  3KUY D;  1P3O A;  3AZN A;  2FFF B;  5B1L C;  3AV2 C;  1P34 D;  2PYO C;  2BYM B;  1P34 B;  1AOI A;  3REK A;  1TAF A;  2JCH A;  2ARO D;  3NQJ A;  3X1T C;  3AYW D;  2ARO B;  3X1V C;  1P3L B;  5BT1 C;  2BYK A;  5BNX B;  3B6F D;  4J8X C;  4Z5T C;  5B0Y D;  3KXB C;  5B0Y B;  4KUD A;  2IO5 B;  5BS7 A;  1P3M A;  3AFA A;  3A6N B;  3W99 D;  3AZE A;  3WKJ D;  3W99 B;  3W96 A;  3MGS B;  3WKJ B;  3EG5 B;  3AZM D;  3C1B D;  3C1B B;  4R8P D;  4R8P B;  4QLC C;  3R45 B;  2W8S A;  3REL A;  3TU4 A;  5AY8 A;  3W98 A;  4WNN B;  3VH5 A;  5B2I D;  5B2J D;  1P3G C;  4H9S C;  1WWS A;  3AZE D;  5B40 A;  3LEL D;  5JA4 B;  1HQ3 A;  2VQR A;  4DRA A;  3AZE B;  4J8W A;  1P3O C;  2F8N G;  3AZL D;  3AZL B;  3AZH A;  3C1C A;  4WU9 A;  2DQN C;  3LJA A;  5GT3 B;  3REK C;  1AOI C;  4KGC D;  2JE5 A;  3AV1 D;  4KGC B;  1BH9 B;  3AV1 B;  2CV5 A;  2F8N H;  5G49 B;  4J8V D;  1KU5 A;  4EO5 C;  4KUD C;  1P3M C;  5BS7 C;  3AV2 D;  3AFA C;  3AV2 B;  4J8U D;  1R4V A;  4J8U B;  3W96 C;  3KUY A;  5BT1 D;  3X1V B;  1P3B A;  2BYM A;  3O62 A;  3REL C;  3TU4 C;  5AY8 C;  3KXB D;  3AYW A;  3VH6 T;  3KXB B;  3W98 C;  2FJ7 D;  3MNN A;  3B6F A;  5KDM B;  5B40 C;  1HQ3 C;  3B0D C;  4J8W C;  4H9Q A;  2DF4 C;  3AZH C;  3WKJ A;  3C1C C;  4WU9 C;  1M1A D;  3AZM A;  1M1A B;  3C1B A;  1KX5 A;  4R8P A;  2J8P A;  2CV5 C;  3WTP A;  4WNN A;  3AZN D;  3AZN B;  5B2I A;  5B2J A;  3REK D;  3KUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...