2NQBD

Drosophila nucleosome structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
RKRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbD00
1F66A 5BO0B 5AVCC 3UTBA 1P34C 1P3IB 5AV9B 4X23D 4H9SA 3AV2B 4J8XA 1U35B 3AZEA 1KX4A 3REIC 4R8PC 3X1UD 3UTAA 4WV4B 2HUEB 3UT9A 4H9PB 5AY8D 3B6FD 3WAAD 3AZKD 4H9QA 5B24B 3WA9A 3MGSC 4M6BA 3AZMA 5B32A 5CPJC 1P3AD 4QLCB 1KX5C 1M19A 3AYWB 5DNND 5JA4B 5B0ZA 5B31A 5BNXA 3X1SC 5AVBB 3LZ1C 5BO0A 3AZND 3AZGB 2BYKB 5AV9A 2HIOC 1P3GC 1EQZB 3AV2A 1U35A 5GXQB 5GSUC 5AV6B 4H9PA 5B32G 1P3PD 2NZDC 5B2JC 5B24A 5AV8B 3B0CW 1M18D 3B0BA 1KU5A 4QLCA 4JJNC 3AYWA 3X1TC 4ZUXC 5B0YB 5JA4A 3R45B 2F8NB 5B1LA 1HQ3C 5AVCB 5CPKC 3AZGA 3VH6W 2BYKA 3AFAD 3KXBC 1P34B 1KX3D 1S32C 1F66C 1EQZA 3REKC 1P3BD 5GXQA 3REIB 4R8PB 4J8UD 2L5AA 5AV6A 2AROD 2PYOD 1KX4C 2RVQD 5AV8A 3KWQD 3MGSB 3C1CC 3WTPE 5CPJB 3B6FA 4XZQD 3MGPC 1KX5B 2CV5D 5B0YA 4DRAA 5BT1D 3X1SB 3REJD 3AZJC 3LZ1B 2F8NA 5AV5D 3B6GC 3X1VD 5AVCA 4WZSB 1P34A 1ULYA 2HIOB 1P3GB 5F99D 1P3MD 3W99C 4H9RB 5B33C 1P3LD 3REIA 4R8PA 5GSUB 3O62D 3MGRD 3LJAC 1AOID 2NZDB 5B2JB 4XUJD 3MGSA 3AZFC 3WKJD 5CPJA 2F8NG 1KX5A 4JJNB 3TU4D 4ZUXB 3X1SA 3LZ1A 1TZYD 4WU8D 5B2IC 3C1BC 1HQ3B 5JRGC 5CPKB 5B1LC 3KXBB 3W97D 2HIOA 1S32B 4ZBJC 1F66B 5CPID 3REKB 4DRBA 3W96C 5G49A 1M18C 5CP6C 4Z2MG 2NZDA 5B2JA 4X23C 4KGCD 3C1CB 3MGPB 4JJNA 3MVDD 3W96D 4ZUXA 3AZJB 3AZLD 5AY8C 3A6ND 3WAAC 3B6FC 3B6GB 2CV5A 3KUYD 3AZKC 5B0YC 1HQ3A 1P3KD 2NQBD 5CPKA 2FJ7D 3KXBA 1P3AC 4J8WD 1S32A 4Z5TD 5DNNC 3REKA 3W99B 5B33B 4EO5C 5E5AD 3AZID 3LJAB 3AZNC 4YM6D 3AZFB 3C1CA 3MGPA 3REHD 3AZJA 3MGQD 1P3PC 3B6GA 5B2IB 4YS3D 3C1BB 4J8VD 2CWEA 5JRGB 4G92C 5B1LB 4ZBJB 3W99A 5B33A 1M18B 3W96B 5CP6B 1A7WA 1F1EA 3LJAA 3AFAC 2F8NH 4X23B 1KX3C 3AZFA 4NE3A 1P3BC 5BS7A 5KDMA 3X1UB 4J8UC 3WTPD 2AROC 5AY8B 2PYOC 3B6FB 3WAAB 5B2IA 4WNNB 1P3OD 3AZKB 3C1BA 2RVQC 5JRGA 3KWQC 5DNMD 3LZ0D 4XZQC 1P3AB 2LY8A 2CV5C 5DNNB 5BT1C 3REJC 3W96A 4Z2MH 1M18A 4EO5B 5CP6A 5AV5C 4J8WA 5B40D 3X1VC 3AZNB 3AV1D 4Z66D 4X23A 1ZLAD 3KSYA 5F99C 1P3MC 3AZIA 3AZHD 4KUDD 1P3LC 1BH8B 2YFVB 3X1UA 4E45A 1ID3D 3O62C 3MGRC 3W98D 5AY8A 1AOIC 1P3PB 3WAAA 4WNNA 3REHA 3AZKA 4XUJC 3WKJC 4G92B 1P3AA 3TU4C 5DNNA 1TZYC 3LELD 4NE5A 3AZNA 5G49B 3AFAB 3RELD 3W97C 1KX3B 3B0CT 5CPIC 1P3BB 1P3FD 5CHLB 5GT3D 1BH8A 2YFVA 2YFWB 4J8UB 5GT0D 2AROB 2PYOB 5B1MD 1P3PA 5BS7C 3MNND 1BH9B 3B0DC 1TAFB 4WU9D 1M1AD 4KGCC 3KWQB 3VH6T 4XZQB 3UTBD 3MVDC 1P3OA 2CV5B 3REJB 3AZLC 4J8XD 3A6NC 5AV5B 3AZED 1KX4D 3X1VB 3KUYC 3AN2D 4H9NA 3UTAD 1P3KC 2NQBC 4UUZB 3UT9D 3AFAA 2FJ7C 4J8WC 1KX3A 4Z5TC 5F99B 1P3MB 3WA9D 3AZMD 1P3BA 5B32D 1P3LB 2YFWA 5E5AC 4J8UA 1M19D 3O62B 3MGRB 2AROA 3AZIC 2PYOA 4LD9D 1AOIB 5B0ZD 5B31D 1BH9A 1TAFA 4YM6C 4XUJB 3X1UC 1B6WA 3KWQA 3WKJB 4XZQA 3TU4B 1P3ID 3REHC 5AV9D 1M1AA 3REJA 3AV2D 1TZYB 1U35D 3MGQC 4WU8B 5AV5A 3NQJB 3X1VA 4YS3C 4J8VC 4UUZA 3VH5T 3W97B 4NE6A 5F99A 4AWLC 5CPIB 5B24D 5C3IC 1P3MA 1P3LA 3RELA 4QLCD 3O62A 3AYWD 3MGRA 1AOIA 3B0DB 5AVBD 5KDMB 4CAYB 4XUJA 4KGCB 3WKJA 3MVDB 3TU4A 3AZGD 3WTPC 1EQZD 3AZLB 1TZYA 4WU8A 3A6NB 1P3OC 3NQJA 5GXQD 3KUYB 3V9RB 1P3KB 2NQBB 1Q9CA 4NFTA 5AV6D 2FJ7B 5DNMC 3LZ0C 3W97A 4J8WB 4Z5TB 3AN2A 5CPIA 2IO5C 4E44A 5AV8D 5E5AB 5B40C 4HGAC 5B0YD 3AZIB 3AV1C 4Z66C 2F8ND 4CAYA 4YM6B 1ZLAC 4KGCA 5AVCD 4LD9A 3AZHC 4KUDC 3MVDA 1P34D 3REHB 1ID3C 3AZLA 3W98C 3MGQB 3A6NA 1P3IA 3KUYA 4YS3B 3REID 4R8PD 3V9RA 4J8VB 1P3KA 2NQBA 2FJ7A 4Z5TA 4AWLB 5C3IB 3MGSD 5CPJD 5E5AA 3LELC 1KX5D 1WWIA 3X1SD 5B31G 3LZ1D 3RELC 4YM6A 1P3FC 5GT3C 5AVBA 1N1JB 3WTPB 2HIOD 1P3GD 5BNVB 5GT0C 4KHAB 3VH6A 2BYMB 3MGQA 5B1MC 3MNNC 1P3OB 4WU9C 4YS3A 4J8VA 1M1AC 1H3OB 5GSUD 5DNMB 3LZ0B 4WU8C 5FUGB 3UTBC 4CSRB 2NZDD 5B2JD 4H9NB 2IO5B 4G91C 4H9SC 4J8XC 3AZEC 3NQUB 5B40B 4JJND 4HGAB 3X1TD 4ZUXD 3AN2C 3UTAC 4H9OB 1JFIB 3UT9C 3AV1B 4Z66B 1ZLAB 1HQ3D 3WA9C 3AZHB 3AZMC 4KUDB 3R45A 5B32C 5CPKD 1N1JA 3KXBD 3WTPA 1HTAA 1S32D 5BNVA 1M19C 1ID3B 4KHAA 1F66D 3W98B 3REKD 2BYMA 4LD9C 5B0ZC 5B31C 1H3OA 5DNMA 2F8NK 3LZ0A 1BFMA 5FUGA 4CSRA 1P3IC 5AV9C 3AV2C 3C1CD 1U35C 3VH5A 3LELB 3MGPD 3NQUA 5B40A 3VH5W 4H9OA 1JFIA 2HUEC 3AZJD 3AV1A 4Z66A 3RELB 1B67A 1ZLAA 3B6GD 3X1TB 5B24C 3AZHA 4KUDA 1P3FB 5GT3B 4QLCC 1ID3A 3AYWC 5GT0B 3W98A 1WWSA 3W99D 5B1MB 3MNNB 5B33D 5AVBC 4WU9B 1M1AB 1P3GA 4H9RA 3LJAD 3UTBB 3AZGC 4G91B 5GSUA 3AZFD 1EQZC 2JSSA 4J8XB 3AZEB 3LELA 1KX4B 5GXQC 3AN2B 3UTAB 5AV6C 3UT9B 5B2ID 3X1TA 4H9QB 3C1BD 3WA9B 5AV8C 5JRGD 3AZMB 1P3FA 5GT3A 5B32B 1R4VA 5B1LD 1M19B 5GT0A 4LD9B 5B1MA 5B31B 5BNXB 5B0ZB 3MNNA 4WU9A 5CP6D
chains in the Genus database with same CATH superfamily
1F66A 5BO0B 5AVCC 3UTBA 1P34C 1P3IB 5AV9B 4X23D 4H9SA 3AV2B 4J8XA 1U35B 3AZEA 1KX4A 3REIC 4R8PC 3X1UD 3UTAA 4WV4B 1Z2CB 2HUEB 3UT9A 4H9PB 5AY8D 3B6FD 3WAAD 3AZKD 4H9QA 5B24B 3WA9A 2ZY5A 3MGSC 4M6BA 3AZMA 3KFUG 5B32A 5CPJC 1P3AD 4QLCB 1KX5C 1M19A 3EPKA 3AYWB 3EPHA 5DNND 5JA4B 5B0ZA 5B31A 5BNXA 3X1SC 5AVBB 3LZ1C 5BO0A 3AZND 3AZGB 2BYKB 5AV9A 2HIOC 1P3GC 1EQZB 4WJ3C 3AV2A 1U35A 5GXQB 5GSUC 5AV6B 4H9PA 5B32G 1P3PD 2NZDC 5B2JC 5B24A 5AV8B 3B0CW 1M18D 3B0BA 2Y2HA 1KU5A 4QLCA 4JJNC 3AYWA 3X1TC 4ZUXC 5B0YB 5JA4A 3R45B 2F8NB 5B1LA 1HQ3C 5AVCB 5CPKC 3AZGA 3VH6W 2BYKA 3AFAD 3KXBC 1P34B 2Y2IA 1KX3D 1S32C 1F66C 1EQZA 3REKC 3A1IA 1P3BD 5GXQA 3REIB 4R8PB 4J8UD 2L5AA 2Y2QA 5AV6A 2AROD 2PYOD 3F6TA 1KX4C 2RVQD 5AV8A 3KWQD 3MGSB 3C1CC 1PZRA 3WTPE 5CPJB 3B6FA 4XZQD 3MGPC 1KX5B 2CV5D 5B0YA 4DRAA 3EPJA 2J8PA 5BT1D 3X1SB 3H0RC 3REJD 3AZJC 3LZ1B 2F8NA 5AV5D 3B6GC 3X1VD 5AVCA 4WZSB 1P34A 1ULYA 2HIOB 1P3GB 5F99D 2Y2MA 1P3MD 3W99C 4H9RB 5B33C 1P3LD 2Y2KA 3REIA 4R8PA 5GSUB 3O62D 3MGRD 3LJAC 1AOID 2NZDB 5B2JB 4XUJD 3MGSA 3AZFC 3WKJD 5CPJA 2F8NG 1KX5A 4JJNB 3TU4D 4ZUXB 3X1SA 3LZ1A 1TZYD 4WU8D 5B2IC 3C1BC 1HQ3B 5JRGC 5CPKB 5B1LC 3KXBB 3W97D 2HIOA 1S32B 4ZBJC 1F66B 5CPID 2ZY3A 3REKB 4DRBA 3W96C 5G49A 1M18C 5CP6C 4Z2MG 2NZDA 2G5IC 5B2JA 4X23C 4KGCD 3C1CB 3MGPB 4JJNA 3MVDD 3W96D 4ZUXA 3AZJB 3AZLD 5AY8C 3A6ND 3WAAC 3B6FC 3B6GB 2CV5A 3KUYD 3AZKC 5B0YC 1HQ3A 1P3KD 2NQBD 5CPKA 2FJ7D 3KXBA 1P3AC 4J8WD 1S32A 4Z5TD 5DNNC 3REKA 3W99B 4DQYB 5B33B 4EO5C 5E5AD 3AZID 3LJAB 3AZNC 4YM6D 3AZFB 3C1CA 3MGPA 3REHD 3AZJA 3MGQD 1P3PC 3B6GA 5B2IB 4YS3D 3C1BB 4J8VD 2CWEA 5JRGB 4G92C 5B1LB 4ZBJB 3W99A 5B33A 1M18B 3W96B 5CP6B 1A7WA 1F1EA 3LJAA 3AFAC 2F8NH 4X23B 1KX3C 3AZFA 4NE3A 1P3BC 5BS7A 5KDMA 3X1UB 4J8UC 3WTPD 2ZY2A 2AROC 2JCHA 5AY8B 2PYOC 3B6FB 3WAAB 3EPLA 5B2IA 4WNNB 1P3OD 3AZKB 3C1BA 2RVQC 5JRGA 3KWQC 5DNMD 3LZ0D 4XZQC 1P3AB 2LY8A 2CV5C 5DNNB 5BT1C 3REJC 3W96A 4Z2MH 1M18A 4EO5B 5AV5C 5CP6A 4J8WA 2Y2GA 5B40D 3X1VC 3H0LC 3AZNB 3AV1D 4Z66D 4X23A 1ZLAD 3KSYA 5F99C 1P3MC 3AZIA 3AZHD 4KUDD 1P3LC 1BH8B 2YFVB 3X1UA 4E45A 1ID3D 3O62C 3H0MC 3MGRC 3W98D 5AY8A 1AOIC 1P3PB 3WAAA 4WNNA 3REHA 3AZKA 4XUJC 3WKJC 4G92B 1P3AA 3TU4C 5DNNA 2XD5A 2Y2PA 1TZYC 3LELD 4NE5A 2XD1A 3AZNA 5G49B 3AFAB 3RELD 3W97C 1KX3B 3B0CT 5CPIC 2BG1A 1P3BB 1P3FD 5CHLB 5GT3D 1BH8A 2YFVA 2YFWB 4J8UB 5GT0D 2AROB 2PYOB 5B1MD 1P3PA 5BS7C 3MNND 1BH9B 3B0DC 1TAFB 4WU9D 1M1AD 4KGCC 3KWQB 3VH6T 4XZQB 3UTBD 3MVDC 1P3OA 2CV5B 3IP4C 2F2AC 3REJB 3AZLC 4J8XD 3A6NC 5AV5B 3AZED 1KX4D 3X1VB 3KUYC 3AN2D 4H9NA 3UTAD 1P3KC 2NQBC 4UUZB 3UT9D 3AFAA 2FJ7C 4J8WC 1KX3A 2UWXA 4Z5TC 5F99B 1P3MB 3WA9D 3AZMD 1P3BA 5B32D 1P3LB 1T3UA 2YFWA 5E5AC 4J8UA 1M19D 3O62B 3MGRB 2AROA 3AZIC 2PYOA 4LD9D 1AOIB 5B0ZD 5B31D 1BH9A 1TAFA 4YM6C 4XUJB 3X1UC 1B6WA 3KWQA 3WKJB 4XZQA 3TU4B 1P3ID 3REHC 5AV9D 1M1AA 3REJA 3AV2D 1TZYB 1U35D 3MGQC 4WU8B 5AV5A 2Y2NA 3NQJB 2RIQA 3X1VA 4YS3C 4J8VC 4UUZA 3VH5T 3W97B 4NE6A 5F99A 4AWLC 5CPIB 5B24D 1W2EA 5C3IC 2ZY4A 1P3MA 1P3LA 3FDDA 3RELA 4QLCD 3O62A 3AYWD 3MGRA 1AOIA 3A1KA 3B0DB 5AVBD 5KDMB 4CAYB 4XUJA 4KGCB 3WKJA 3MVDB 3TU4A 3AZGD 3WTPC 1EQZD 3AZLB 1TZYA 4WU8A 3A6NB 1P3OC 3NQJA 5GXQD 3KUYB 3V9RB 1P3KB 2NQBB 1Q9CA 5AV6D 4NFTA 2Y2OA 2FJ7B 5DNMC 3LZ0C 3W97A 4J8WB 4Z5TB 3AN2A 5CPIA 2IO5C 4E44A 5AV8D 5E5AB 5B40C 4HGAC 5B0YD 3AZIB 3AV1C 4Z66C 2F8ND 4CAYA 4YM6B 1ZLAC 4KGCA 2Y2JA 5AVCD 4LD9A 3AZHC 4KUDC 2DQNC 3MVDA 1P34D 3REHB 1ID3C 3AZLA 3W98C 3MGQB 3A6NA 2VQRA 1P3IA 3KUYA 4YS3B 3REID 4R8PD 3V9RA 4J8VB 1P3KA 2NQBA 2FJ7A 4Z5TA 4AWLB 5C3IB 3MGSD 3EG5B 2JE5A 5CPJD 5E5AA 3LELC 1KX5D 1WWIA 3X1SD 5B31G 3LZ1D 3RELC 4YM6A 1P3FC 5GT3C 5AVBA 1N1JB 3WTPB 2HIOD 1P3GD 5BNVB 5GT0C 4KHAB 3VH6A 2BYMB 3MGQA 5B1MC 3MNNC 1P3OB 2W8SA 4WU9C 4J8VA 4YS3A 1M1AC 1H3OB 5GSUD 3AL0C 5DNMB 3LZ0B 4WU8C 5FUGB 3UTBC 4CSRB 2NZDD 5B2JD 2DF4C 2IO5B 4G91C 4H9NB 4H9SC 4J8XC 2ZM5A 3AZEC 3P5JB 3NQUB 5B40B 4JJND 4HGAB 3X1TD 4ZUXD 3AN2C 3UTAC 4H9OB 1JFIB 3UT9C 3AV1B 4Z66B 1ZLAB 1HQ3D 3WA9C 3AZHB 3AZMC 4KUDB 3R45A 5B32C 5CPKD 1N1JA 3KXBD 3WTPA 1HTAA 1S32D 5BNVA 1M19C 1ID3B 4KHAA 1F66D 3W98B 3REKD 2BYMA 4LD9C 5B0ZC 5B31C 1H3OA 5DNMA 2F8NK 3LZ0A 1BFMA 5FUGA 4CSRA 1P3IC 5AV9C 3AV2C 3C1CD 1U35C 2FFFB 3VH5A 3LELB 3MGPD 3NQUA 5B40A 3VH5W 4H9OA 1JFIA 2HUEC 3AZJD 3AV1A 4Z66A 3RELB 1B67A 1ZLAA 3B6GD 3X1TB 5B24C 3AZHA 4KUDA 1P3FB 4UPKA 5GT3B 4QLCC 1ID3A 3AYWC 5GT0B 3W98A 1WWSA 3W99D 5B1MB 3MNNB 5B33D 5AVBC 4WU9B 1M1AB 1P3GA 4H9RA 3LJAD 3UTBB 3AZGC 4G91B 5GSUA 3AZFD 1EQZC 2JSSA 4J8XB 3AZEB 3LELA 1KX4B 5GXQC 3AN2B 3UTAB 5AV6C 3UT9B 2Y2LA 2G5HC 5B2ID 3X1TA 4H9QB 3C1BD 3WA9B 5AV8C 5JRGD 3AZMB 1P3FA 5GT3A 5B32B 1R4VA 5B1LD 1M19B 5GT0A 4LD9B 5B1MA 5B31B 5BNXB 5B0ZB 3MNNA 4WU9A 5CP6D
chains in the Genus database with same CATH topology
1F66A 5BO0B 5AVCC 3UTBA 1P34C 1P3IB 5AV9B 4X23D 4H9SA 3AV2B 4J8XA 1U35B 3AZEA 1KX4A 3REIC 4R8PC 3X1UD 3UTAA 4WV4B 1Z2CB 2HUEB 3UT9A 4H9PB 5AY8D 3B6FD 3WAAD 3AZKD 4H9QA 5B24B 3WA9A 2ZY5A 3MGSC 4M6BA 3AZMA 3KFUG 5B32A 5CPJC 1P3AD 4QLCB 1KX5C 1M19A 3EPKA 3AYWB 3EPHA 5DNND 5JA4B 5B0ZA 5B31A 5BNXA 3X1SC 5AVBB 3LZ1C 5BO0A 3AZND 3AZGB 2BYKB 5AV9A 2HIOC 1P3GC 1EQZB 4WJ3C 3AV2A 1U35A 5GXQB 5GSUC 5AV6B 4H9PA 5B32G 1P3PD 2NZDC 5B2JC 5B24A 5AV8B 3B0CW 1M18D 3B0BA 2Y2HA 1KU5A 4QLCA 4JJNC 3AYWA 3X1TC 4ZUXC 5B0YB 5JA4A 3R45B 2F8NB 5B1LA 1HQ3C 5AVCB 5CPKC 3AZGA 3VH6W 2BYKA 3AFAD 3KXBC 1P34B 2Y2IA 1KX3D 1S32C 1F66C 1EQZA 3REKC 3A1IA 1P3BD 5GXQA 3REIB 4R8PB 4J8UD 2L5AA 2Y2QA 5AV6A 2AROD 2PYOD 3F6TA 1KX4C 2RVQD 5AV8A 3KWQD 3MGSB 3C1CC 1PZRA 3WTPE 5CPJB 3B6FA 4XZQD 3MGPC 1KX5B 2CV5D 5B0YA 4DRAA 3EPJA 2J8PA 5BT1D 3X1SB 3H0RC 3REJD 3AZJC 3LZ1B 2F8NA 5AV5D 3B6GC 3X1VD 5AVCA 4WZSB 1P34A 1ULYA 2HIOB 1P3GB 5F99D 2Y2MA 1P3MD 3W99C 4H9RB 5B33C 1P3LD 2Y2KA 3REIA 4R8PA 5GSUB 3O62D 3MGRD 3LJAC 1AOID 2NZDB 5B2JB 4XUJD 3MGSA 3AZFC 3WKJD 5CPJA 2F8NG 1KX5A 4JJNB 3TU4D 4ZUXB 3X1SA 3LZ1A 1TZYD 4WU8D 5B2IC 3C1BC 1HQ3B 5JRGC 5CPKB 5B1LC 3KXBB 3W97D 2HIOA 1S32B 4ZBJC 1F66B 5CPID 2ZY3A 3REKB 4DRBA 3W96C 5G49A 1M18C 5CP6C 4Z2MG 2NZDA 2G5IC 5B2JA 4X23C 4KGCD 3C1CB 3MGPB 4JJNA 3MVDD 3W96D 4ZUXA 3AZJB 3AZLD 5AY8C 3A6ND 3WAAC 3B6FC 3B6GB 2CV5A 3KUYD 3AZKC 5B0YC 1HQ3A 1P3KD 2NQBD 5CPKA 2FJ7D 3KXBA 1P3AC 4J8WD 1S32A 4Z5TD 5DNNC 3REKA 3W99B 4DQYB 5B33B 4EO5C 5E5AD 3AZID 3LJAB 3AZNC 4YM6D 3AZFB 3C1CA 3MGPA 3REHD 3AZJA 3MGQD 1P3PC 3B6GA 5B2IB 4YS3D 3C1BB 4J8VD 2CWEA 5JRGB 4G92C 5B1LB 4ZBJB 3W99A 5B33A 1M18B 3W96B 5CP6B 1A7WA 1F1EA 3LJAA 3AFAC 2F8NH 4X23B 1KX3C 3AZFA 4NE3A 1P3BC 5BS7A 5KDMA 3X1UB 4J8UC 3WTPD 2ZY2A 2AROC 2JCHA 5AY8B 2PYOC 3B6FB 3WAAB 3EPLA 5B2IA 4WNNB 1P3OD 3AZKB 3C1BA 2RVQC 5JRGA 3KWQC 5DNMD 3LZ0D 4XZQC 1P3AB 2LY8A 2CV5C 5DNNB 5BT1C 3REJC 3W96A 4Z2MH 1M18A 4EO5B 5AV5C 5CP6A 4J8WA 2Y2GA 5B40D 3X1VC 3H0LC 3AZNB 3AV1D 4Z66D 4X23A 1ZLAD 3KSYA 5F99C 1P3MC 3AZIA 3AZHD 4KUDD 1P3LC 1BH8B 2YFVB 3X1UA 4E45A 1ID3D 3O62C 3H0MC 3MGRC 3W98D 5AY8A 1AOIC 1P3PB 3WAAA 4WNNA 3REHA 3AZKA 4XUJC 3WKJC 4G92B 1P3AA 3TU4C 5DNNA 2XD5A 2Y2PA 1TZYC 3LELD 4NE5A 2XD1A 3AZNA 5G49B 3AFAB 3RELD 3W97C 1KX3B 3B0CT 5CPIC 2BG1A 1P3BB 1P3FD 5CHLB 5GT3D 1BH8A 2YFVA 2YFWB 4J8UB 5GT0D 2AROB 2PYOB 5B1MD 1P3PA 5BS7C 3MNND 1BH9B 3B0DC 1TAFB 4WU9D 1M1AD 4KGCC 3KWQB 3VH6T 4XZQB 3UTBD 3MVDC 1P3OA 2CV5B 3IP4C 2F2AC 3REJB 3AZLC 4J8XD 3A6NC 5AV5B 3AZED 1KX4D 3X1VB 3KUYC 3AN2D 4H9NA 3UTAD 1P3KC 2NQBC 4UUZB 3UT9D 3AFAA 2FJ7C 4J8WC 1KX3A 2UWXA 4Z5TC 5F99B 1P3MB 3WA9D 3AZMD 1P3BA 5B32D 1P3LB 1T3UA 2YFWA 5E5AC 4J8UA 1M19D 3O62B 3MGRB 2AROA 3AZIC 2PYOA 4LD9D 1AOIB 5B0ZD 5B31D 1BH9A 1TAFA 4YM6C 4XUJB 3X1UC 1B6WA 3KWQA 3WKJB 4XZQA 3TU4B 1P3ID 3REHC 5AV9D 1M1AA 3REJA 3AV2D 1TZYB 1U35D 3MGQC 4WU8B 5AV5A 2Y2NA 3NQJB 2RIQA 3X1VA 4YS3C 4J8VC 4UUZA 3VH5T 3W97B 4NE6A 5F99A 4AWLC 5CPIB 5B24D 1W2EA 5C3IC 2ZY4A 1P3MA 1P3LA 3FDDA 3RELA 4QLCD 3O62A 3AYWD 3MGRA 1AOIA 3A1KA 3B0DB 5AVBD 5KDMB 4CAYB 4XUJA 4KGCB 3WKJA 3MVDB 3TU4A 3AZGD 3WTPC 1EQZD 3AZLB 1TZYA 4WU8A 3A6NB 1P3OC 3NQJA 5GXQD 3KUYB 3V9RB 1P3KB 2NQBB 1Q9CA 5AV6D 4NFTA 2Y2OA 2FJ7B 5DNMC 3LZ0C 3W97A 4J8WB 4Z5TB 3AN2A 5CPIA 2IO5C 4E44A 5AV8D 5E5AB 5B40C 4HGAC 5B0YD 3AZIB 3AV1C 4Z66C 2F8ND 4CAYA 4YM6B 1ZLAC 4KGCA 2Y2JA 5AVCD 4LD9A 3AZHC 4KUDC 2DQNC 3MVDA 1P34D 3REHB 1ID3C 3AZLA 3W98C 3MGQB 3A6NA 2VQRA 1P3IA 3KUYA 4YS3B 3REID 4R8PD 3V9RA 4J8VB 1P3KA 2NQBA 2FJ7A 4Z5TA 4AWLB 5C3IB 3MGSD 3EG5B 2JE5A 5CPJD 5E5AA 3LELC 1KX5D 1WWIA 3X1SD 5B31G 3LZ1D 3RELC 4YM6A 1P3FC 5GT3C 5AVBA 1N1JB 3WTPB 2HIOD 1P3GD 5BNVB 5GT0C 4KHAB 3VH6A 2BYMB 3MGQA 5B1MC 3MNNC 1P3OB 2W8SA 4WU9C 4J8VA 4YS3A 1M1AC 1H3OB 5GSUD 3AL0C 5DNMB 3LZ0B 4WU8C 5FUGB 3UTBC 4CSRB 2NZDD 5B2JD 2DF4C 2IO5B 4G91C 4H9NB 4H9SC 4J8XC 2ZM5A 3AZEC 3P5JB 3NQUB 5B40B 4JJND 4HGAB 3X1TD 4ZUXD 3AN2C 3UTAC 4H9OB 1JFIB 3UT9C 3AV1B 4Z66B 1ZLAB 1HQ3D 3WA9C 3AZHB 3AZMC 4KUDB 3R45A 5B32C 5CPKD 1N1JA 3KXBD 3WTPA 1HTAA 1S32D 5BNVA 1M19C 1ID3B 4KHAA 1F66D 3W98B 3REKD 2BYMA 4LD9C 5B0ZC 5B31C 1H3OA 5DNMA 2F8NK 3LZ0A 1BFMA 5FUGA 4CSRA 1P3IC 5AV9C 3AV2C 3C1CD 1U35C 2FFFB 3VH5A 3LELB 3MGPD 3NQUA 5B40A 3VH5W 4H9OA 1JFIA 2HUEC 3AZJD 3AV1A 4Z66A 3RELB 1B67A 1ZLAA 3B6GD 3X1TB 5B24C 3AZHA 4KUDA 1P3FB 4UPKA 5GT3B 4QLCC 1ID3A 3AYWC 5GT0B 3W98A 1WWSA 3W99D 5B1MB 3MNNB 5B33D 5AVBC 4WU9B 1M1AB 1P3GA 4H9RA 3LJAD 3UTBB 3AZGC 4G91B 5GSUA 3AZFD 1EQZC 2JSSA 4J8XB 3AZEB 3LELA 1KX4B 5GXQC 3AN2B 3UTAB 5AV6C 3UT9B 2Y2LA 2G5HC 5B2ID 3X1TA 4H9QB 3C1BD 3WA9B 5AV8C 5JRGD 3AZMB 1P3FA 5GT3A 5B32B 1R4VA 5B1LD 1M19B 5GT0A 4LD9B 5B1MA 5B31B 5BNXB 5B0ZB 3MNNA 4WU9A 5CP6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 A;  5BO0 B;  5AVC C;  3UTB A;  1P34 C;  1P3I B;  5AV9 B;  4X23 D;  4H9S A;  3AV2 B;  4J8X A;  1U35 B;  3AZE A;  1KX4 A;  3REI C;  4R8P C;  3X1U D;  3UTA A;  4WV4 B;  2HUE B;  3UT9 A;  4H9P B;  5AY8 D;  3B6F D;  3WAA D;  3AZK D;  4H9Q A;  5B24 B;  3WA9 A;  3MGS C;  4M6B A;  3AZM A;  5B32 A;  5CPJ C;  1P3A D;  4QLC B;  1KX5 C;  1M19 A;  3AYW B;  5DNN D;  5JA4 B;  5B0Z A;  5B31 A;  5BNX A;  3X1S C;  5AVB B;  3LZ1 C;  5BO0 A;  3AZN D;  3AZG B;  2BYK B;  5AV9 A;  2HIO C;  1P3G C;  1EQZ B;  3AV2 A;  1U35 A;  5GXQ B;  5GSU C;  5AV6 B;  4H9P A;  5B32 G;  1P3P D;  2NZD C;  5B2J C;  5B24 A;  5AV8 B;  3B0C W;  1M18 D;  3B0B A;  1KU5 A;  4QLC A;  4JJN C;  3AYW A;  3X1T C;  4ZUX C;  5B0Y B;  5JA4 A;  3R45 B;  2F8N B;  5B1L A;  1HQ3 C;  5AVC B;  5CPK C;  3AZG A;  3VH6 W;  2BYK A;  3AFA D;  3KXB C;  1P34 B;  1KX3 D;  1S32 C;  1F66 C;  1EQZ A;  3REK C;  1P3B D;  5GXQ A;  3REI B;  4R8P B;  4J8U D;  2L5A A;  5AV6 A;  2ARO D;  2PYO D;  1KX4 C;  2RVQ D;  5AV8 A;  3KWQ D;  3MGS B;  3C1C C;  3WTP E;  5CPJ B;  3B6F A;  4XZQ D;  3MGP C;  1KX5 B;  2CV5 D;  5B0Y A;  4DRA A;  5BT1 D;  3X1S B;  3REJ D;  3AZJ C;  3LZ1 B;  2F8N A;  5AV5 D;  3B6G C;  3X1V D;  5AVC A;  4WZS B;  1P34 A;  1ULY A;  2HIO B;  1P3G B;  5F99 D;  1P3M D;  3W99 C;  4H9R B;  5B33 C;  1P3L D;  3REI A;  4R8P A;  5GSU B;  3O62 D;  3MGR D;  3LJA C;  1AOI D;  2NZD B;  5B2J B;  4XUJ D;  3MGS A;  3AZF C;  3WKJ D;  5CPJ A;  2F8N G;  1KX5 A;  4JJN B;  3TU4 D;  4ZUX B;  3X1S A;  3LZ1 A;  1TZY D;  4WU8 D;  5B2I C;  3C1B C;  1HQ3 B;  5JRG C;  5CPK B;  5B1L C;  3KXB B;  3W97 D;  2HIO A;  1S32 B;  4ZBJ C;  1F66 B;  5CPI D;  3REK B;  4DRB A;  3W96 C;  5G49 A;  1M18 C;  5CP6 C;  4Z2M G;  2NZD A;  5B2J A;  4X23 C;  4KGC D;  3C1C B;  3MGP B;  4JJN A;  3MVD D;  3W96 D;  4ZUX A;  3AZJ B;  3AZL D;  5AY8 C;  3A6N D;  3WAA C;  3B6F C;  3B6G B;  2CV5 A;  3KUY D;  3AZK C;  5B0Y C;  1HQ3 A;  1P3K D;  2NQB D;  5CPK A;  2FJ7 D;  3KXB A;  1P3A C;  4J8W D;  1S32 A;  4Z5T D;  5DNN C;  3REK A;  3W99 B;  5B33 B;  4EO5 C;  5E5A D;  3AZI D;  3LJA B;  3AZN C;  4YM6 D;  3AZF B;  3C1C A;  3MGP A;  3REH D;  3AZJ A;  3MGQ D;  1P3P C;  3B6G A;  5B2I B;  4YS3 D;  3C1B B;  4J8V D;  2CWE A;  5JRG B;  4G92 C;  5B1L B;  4ZBJ B;  3W99 A;  5B33 A;  1M18 B;  3W96 B;  5CP6 B;  1A7W A;  1F1E A;  3LJA A;  3AFA C;  2F8N H;  4X23 B;  1KX3 C;  3AZF A;  4NE3 A;  1P3B C;  5BS7 A;  5KDM A;  3X1U B;  4J8U C;  3WTP D;  2ARO C;  5AY8 B;  2PYO C;  3B6F B;  3WAA B;  5B2I A;  4WNN B;  1P3O D;  3AZK B;  3C1B A;  2RVQ C;  5JRG A;  3KWQ C;  5DNM D;  3LZ0 D;  4XZQ C;  1P3A B;  2LY8 A;  2CV5 C;  5DNN B;  5BT1 C;  3REJ C;  3W96 A;  4Z2M H;  1M18 A;  4EO5 B;  5CP6 A;  5AV5 C;  4J8W A;  5B40 D;  3X1V C;  3AZN B;  3AV1 D;  4Z66 D;  4X23 A;  1ZLA D;  3KSY A;  5F99 C;  1P3M C;  3AZI A;  3AZH D;  4KUD D;  1P3L C;  1BH8 B;  2YFV B;  3X1U A;  4E45 A;  1ID3 D;  3O62 C;  3MGR C;  3W98 D;  5AY8 A;  1AOI C;  1P3P B;  3WAA A;  4WNN A;  3REH A;  3AZK A;  4XUJ C;  3WKJ C;  4G92 B;  1P3A A;  3TU4 C;  5DNN A;  1TZY C;  3LEL D;  4NE5 A;  3AZN A;  5G49 B;  3AFA B;  3REL D;  3W97 C;  1KX3 B;  3B0C T;  5CPI C;  1P3B B;  1P3F D;  5CHL B;  5GT3 D;  1BH8 A;  2YFV A;  2YFW B;  4J8U B;  5GT0 D;  2ARO B;  2PYO B;  5B1M D;  1P3P A;  5BS7 C;  3MNN D;  1BH9 B;  3B0D C;  1TAF B;  4WU9 D;  1M1A D;  4KGC C;  3KWQ B;  3VH6 T;  4XZQ B;  3UTB D;  3MVD C;  1P3O A;  2CV5 B;  3REJ B;  3AZL C;  4J8X D;  3A6N C;  5AV5 B;  3AZE D;  1KX4 D;  3X1V B;  3KUY C;  3AN2 D;  4H9N A;  3UTA D;  1P3K C;  2NQB C;  4UUZ B;  3UT9 D;  3AFA A;  2FJ7 C;  4J8W C;  1KX3 A;  4Z5T C;  5F99 B;  1P3M B;  3WA9 D;  3AZM D;  1P3B A;  5B32 D;  1P3L B;  2YFW A;  5E5A C;  4J8U A;  1M19 D;  3O62 B;  3MGR B;  2ARO A;  3AZI C;  2PYO A;  4LD9 D;  1AOI B;  5B0Z D;  5B31 D;  1BH9 A;  1TAF A;  4YM6 C;  4XUJ B;  3X1U C;  1B6W A;  3KWQ A;  3WKJ B;  4XZQ A;  3TU4 B;  1P3I D;  3REH C;  5AV9 D;  1M1A A;  3REJ A;  3AV2 D;  1TZY B;  1U35 D;  3MGQ C;  4WU8 B;  5AV5 A;  3NQJ B;  3X1V A;  4YS3 C;  4J8V C;  4UUZ A;  3VH5 T;  3W97 B;  4NE6 A;  5F99 A;  4AWL C;  5CPI B;  5B24 D;  5C3I C;  1P3M A;  1P3L A;  3REL A;  4QLC D;  3O62 A;  3AYW D;  3MGR A;  1AOI A;  3B0D B;  5AVB D;  5KDM B;  4CAY B;  4XUJ A;  4KGC B;  3WKJ A;  3MVD B;  3TU4 A;  3AZG D;  3WTP C;  1EQZ D;  3AZL B;  1TZY A;  4WU8 A;  3A6N B;  1P3O C;  3NQJ A;  5GXQ D;  3KUY B;  3V9R B;  1P3K B;  2NQB B;  1Q9C A;  4NFT A;  5AV6 D;  2FJ7 B;  5DNM C;  3LZ0 C;  3W97 A;  4J8W B;  4Z5T B;  3AN2 A;  5CPI A;  2IO5 C;  4E44 A;  5AV8 D;  5E5A B;  5B40 C;  4HGA C;  5B0Y D;  3AZI B;  3AV1 C;  4Z66 C;  2F8N D;  4CAY A;  4YM6 B;  1ZLA C;  4KGC A;  5AVC D;  4LD9 A;  3AZH C;  4KUD C;  3MVD A;  1P34 D;  3REH B;  1ID3 C;  3AZL A;  3W98 C;  3MGQ B;  3A6N A;  1P3I A;  3KUY A;  4YS3 B;  3REI D;  4R8P D;  3V9R A;  4J8V B;  1P3K A;  2NQB A;  2FJ7 A;  4Z5T A;  4AWL B;  5C3I B;  3MGS D;  5CPJ D;  5E5A A;  3LEL C;  1KX5 D;  1WWI A;  3X1S D;  5B31 G;  3LZ1 D;  3REL C;  4YM6 A;  1P3F C;  5GT3 C;  5AVB A;  1N1J B;  3WTP B;  2HIO D;  1P3G D;  5BNV B;  5GT0 C;  4KHA B;  3VH6 A;  2BYM B;  3MGQ A;  5B1M C;  3MNN C;  1P3O B;  4WU9 C;  4YS3 A;  4J8V A;  1M1A C;  1H3O B;  5GSU D;  5DNM B;  3LZ0 B;  4WU8 C;  5FUG B;  3UTB C;  4CSR B;  2NZD D;  5B2J D;  4H9N B;  2IO5 B;  4G91 C;  4H9S C;  4J8X C;  3AZE C;  3NQU B;  5B40 B;  4JJN D;  4HGA B;  3X1T D;  4ZUX D;  3AN2 C;  3UTA C;  4H9O B;  1JFI B;  3UT9 C;  3AV1 B;  4Z66 B;  1ZLA B;  1HQ3 D;  3WA9 C;  3AZH B;  3AZM C;  4KUD B;  3R45 A;  5B32 C;  5CPK D;  1N1J A;  3KXB D;  3WTP A;  1HTA A;  1S32 D;  5BNV A;  1M19 C;  1ID3 B;  4KHA A;  1F66 D;  3W98 B;  3REK D;  2BYM A;  4LD9 C;  5B0Z C;  5B31 C;  1H3O A;  5DNM A;  2F8N K;  3LZ0 A;  1BFM A;  5FUG A;  4CSR A;  1P3I C;  5AV9 C;  3AV2 C;  3C1C D;  1U35 C;  3VH5 A;  3LEL B;  3MGP D;  3NQU A;  5B40 A;  3VH5 W;  4H9O A;  1JFI A;  2HUE C;  3AZJ D;  3AV1 A;  4Z66 A;  3REL B;  1B67 A;  1ZLA A;  3B6G D;  3X1T B;  5B24 C;  3AZH A;  4KUD A;  1P3F B;  5GT3 B;  4QLC C;  1ID3 A;  3AYW C;  5GT0 B;  3W98 A;  1WWS A;  3W99 D;  5B1M B;  3MNN B;  5B33 D;  5AVB C;  4WU9 B;  1M1A B;  1P3G A;  4H9R A;  3LJA D;  3UTB B;  3AZG C;  4G91 B;  5GSU A;  3AZF D;  1EQZ C;  2JSS A;  4J8X B;  3AZE B;  3LEL A;  1KX4 B;  5GXQ C;  3AN2 B;  3UTA B;  5AV6 C;  3UT9 B;  5B2I D;  3X1T A;  4H9Q B;  3C1B D;  3WA9 B;  5AV8 C;  5JRG D;  3AZM B;  1P3F A;  5GT3 A;  5B32 B;  1R4V A;  5B1L D;  1M19 B;  5GT0 A;  4LD9 B;  5B1M A;  5B31 B;  5BNX B;  5B0Z B;  3MNN A;  4WU9 A;  5CP6 D; 
#chains in the Genus database with same CATH topology
 1F66 A;  5BO0 B;  5AVC C;  3UTB A;  1P34 C;  1P3I B;  5AV9 B;  4X23 D;  4H9S A;  3AV2 B;  4J8X A;  1U35 B;  3AZE A;  1KX4 A;  3REI C;  4R8P C;  3X1U D;  3UTA A;  4WV4 B;  1Z2C B;  2HUE B;  3UT9 A;  4H9P B;  5AY8 D;  3B6F D;  3WAA D;  3AZK D;  4H9Q A;  5B24 B;  3WA9 A;  2ZY5 A;  3MGS C;  4M6B A;  3AZM A;  3KFU G;  5B32 A;  5CPJ C;  1P3A D;  4QLC B;  1KX5 C;  1M19 A;  3EPK A;  3AYW B;  3EPH A;  5DNN D;  5JA4 B;  5B0Z A;  5B31 A;  5BNX A;  3X1S C;  5AVB B;  3LZ1 C;  5BO0 A;  3AZN D;  3AZG B;  2BYK B;  5AV9 A;  2HIO C;  1P3G C;  1EQZ B;  4WJ3 C;  3AV2 A;  1U35 A;  5GXQ B;  5GSU C;  5AV6 B;  4H9P A;  5B32 G;  1P3P D;  2NZD C;  5B2J C;  5B24 A;  5AV8 B;  3B0C W;  1M18 D;  3B0B A;  2Y2H A;  1KU5 A;  4QLC A;  4JJN C;  3AYW A;  3X1T C;  4ZUX C;  5B0Y B;  5JA4 A;  3R45 B;  2F8N B;  5B1L A;  1HQ3 C;  5AVC B;  5CPK C;  3AZG A;  3VH6 W;  2BYK A;  3AFA D;  3KXB C;  1P34 B;  2Y2I A;  1KX3 D;  1S32 C;  1F66 C;  1EQZ A;  3REK C;  3A1I A;  1P3B D;  5GXQ A;  3REI B;  4R8P B;  4J8U D;  2L5A A;  2Y2Q A;  5AV6 A;  2ARO D;  2PYO D;  3F6T A;  1KX4 C;  2RVQ D;  5AV8 A;  3KWQ D;  3MGS B;  3C1C C;  1PZR A;  3WTP E;  5CPJ B;  3B6F A;  4XZQ D;  3MGP C;  1KX5 B;  2CV5 D;  5B0Y A;  4DRA A;  3EPJ A;  2J8P A;  5BT1 D;  3X1S B;  3H0R C;  3REJ D;  3AZJ C;  3LZ1 B;  2F8N A;  5AV5 D;  3B6G C;  3X1V D;  5AVC A;  4WZS B;  1P34 A;  1ULY A;  2HIO B;  1P3G B;  5F99 D;  2Y2M A;  1P3M D;  3W99 C;  4H9R B;  5B33 C;  1P3L D;  2Y2K A;  3REI A;  4R8P A;  5GSU B;  3O62 D;  3MGR D;  3LJA C;  1AOI D;  2NZD B;  5B2J B;  4XUJ D;  3MGS A;  3AZF C;  3WKJ D;  5CPJ A;  2F8N G;  1KX5 A;  4JJN B;  3TU4 D;  4ZUX B;  3X1S A;  3LZ1 A;  1TZY D;  4WU8 D;  5B2I C;  3C1B C;  1HQ3 B;  5JRG C;  5CPK B;  5B1L C;  3KXB B;  3W97 D;  2HIO A;  1S32 B;  4ZBJ C;  1F66 B;  5CPI D;  2ZY3 A;  3REK B;  4DRB A;  3W96 C;  5G49 A;  1M18 C;  5CP6 C;  4Z2M G;  2NZD A;  2G5I C;  5B2J A;  4X23 C;  4KGC D;  3C1C B;  3MGP B;  4JJN A;  3MVD D;  3W96 D;  4ZUX A;  3AZJ B;  3AZL D;  5AY8 C;  3A6N D;  3WAA C;  3B6F C;  3B6G B;  2CV5 A;  3KUY D;  3AZK C;  5B0Y C;  1HQ3 A;  1P3K D;  2NQB D;  5CPK A;  2FJ7 D;  3KXB A;  1P3A C;  4J8W D;  1S32 A;  4Z5T D;  5DNN C;  3REK A;  3W99 B;  4DQY B;  5B33 B;  4EO5 C;  5E5A D;  3AZI D;  3LJA B;  3AZN C;  4YM6 D;  3AZF B;  3C1C A;  3MGP A;  3REH D;  3AZJ A;  3MGQ D;  1P3P C;  3B6G A;  5B2I B;  4YS3 D;  3C1B B;  4J8V D;  2CWE A;  5JRG B;  4G92 C;  5B1L B;  4ZBJ B;  3W99 A;  5B33 A;  1M18 B;  3W96 B;  5CP6 B;  1A7W A;  1F1E A;  3LJA A;  3AFA C;  2F8N H;  4X23 B;  1KX3 C;  3AZF A;  4NE3 A;  1P3B C;  5BS7 A;  5KDM A;  3X1U B;  4J8U C;  3WTP D;  2ZY2 A;  2ARO C;  2JCH A;  5AY8 B;  2PYO C;  3B6F B;  3WAA B;  3EPL A;  5B2I A;  4WNN B;  1P3O D;  3AZK B;  3C1B A;  2RVQ C;  5JRG A;  3KWQ C;  5DNM D;  3LZ0 D;  4XZQ C;  1P3A B;  2LY8 A;  2CV5 C;  5DNN B;  5BT1 C;  3REJ C;  3W96 A;  4Z2M H;  1M18 A;  4EO5 B;  5AV5 C;  5CP6 A;  4J8W A;  2Y2G A;  5B40 D;  3X1V C;  3H0L C;  3AZN B;  3AV1 D;  4Z66 D;  4X23 A;  1ZLA D;  3KSY A;  5F99 C;  1P3M C;  3AZI A;  3AZH D;  4KUD D;  1P3L C;  1BH8 B;  2YFV B;  3X1U A;  4E45 A;  1ID3 D;  3O62 C;  3H0M C;  3MGR C;  3W98 D;  5AY8 A;  1AOI C;  1P3P B;  3WAA A;  4WNN A;  3REH A;  3AZK A;  4XUJ C;  3WKJ C;  4G92 B;  1P3A A;  3TU4 C;  5DNN A;  2XD5 A;  2Y2P A;  1TZY C;  3LEL D;  4NE5 A;  2XD1 A;  3AZN A;  5G49 B;  3AFA B;  3REL D;  3W97 C;  1KX3 B;  3B0C T;  5CPI C;  2BG1 A;  1P3B B;  1P3F D;  5CHL B;  5GT3 D;  1BH8 A;  2YFV A;  2YFW B;  4J8U B;  5GT0 D;  2ARO B;  2PYO B;  5B1M D;  1P3P A;  5BS7 C;  3MNN D;  1BH9 B;  3B0D C;  1TAF B;  4WU9 D;  1M1A D;  4KGC C;  3KWQ B;  3VH6 T;  4XZQ B;  3UTB D;  3MVD C;  1P3O A;  2CV5 B;  3IP4 C;  2F2A C;  3REJ B;  3AZL C;  4J8X D;  3A6N C;  5AV5 B;  3AZE D;  1KX4 D;  3X1V B;  3KUY C;  3AN2 D;  4H9N A;  3UTA D;  1P3K C;  2NQB C;  4UUZ B;  3UT9 D;  3AFA A;  2FJ7 C;  4J8W C;  1KX3 A;  2UWX A;  4Z5T C;  5F99 B;  1P3M B;  3WA9 D;  3AZM D;  1P3B A;  5B32 D;  1P3L B;  1T3U A;  2YFW A;  5E5A C;  4J8U A;  1M19 D;  3O62 B;  3MGR B;  2ARO A;  3AZI C;  2PYO A;  4LD9 D;  1AOI B;  5B0Z D;  5B31 D;  1BH9 A;  1TAF A;  4YM6 C;  4XUJ B;  3X1U C;  1B6W A;  3KWQ A;  3WKJ B;  4XZQ A;  3TU4 B;  1P3I D;  3REH C;  5AV9 D;  1M1A A;  3REJ A;  3AV2 D;  1TZY B;  1U35 D;  3MGQ C;  4WU8 B;  5AV5 A;  2Y2N A;  3NQJ B;  2RIQ A;  3X1V A;  4YS3 C;  4J8V C;  4UUZ A;  3VH5 T;  3W97 B;  4NE6 A;  5F99 A;  4AWL C;  5CPI B;  5B24 D;  1W2E A;  5C3I C;  2ZY4 A;  1P3M A;  1P3L A;  3FDD A;  3REL A;  4QLC D;  3O62 A;  3AYW D;  3MGR A;  1AOI A;  3A1K A;  3B0D B;  5AVB D;  5KDM B;  4CAY B;  4XUJ A;  4KGC B;  3WKJ A;  3MVD B;  3TU4 A;  3AZG D;  3WTP C;  1EQZ D;  3AZL B;  1TZY A;  4WU8 A;  3A6N B;  1P3O C;  3NQJ A;  5GXQ D;  3KUY B;  3V9R B;  1P3K B;  2NQB B;  1Q9C A;  5AV6 D;  4NFT A;  2Y2O A;  2FJ7 B;  5DNM C;  3LZ0 C;  3W97 A;  4J8W B;  4Z5T B;  3AN2 A;  5CPI A;  2IO5 C;  4E44 A;  5AV8 D;  5E5A B;  5B40 C;  4HGA C;  5B0Y D;  3AZI B;  3AV1 C;  4Z66 C;  2F8N D;  4CAY A;  4YM6 B;  1ZLA C;  4KGC A;  2Y2J A;  5AVC D;  4LD9 A;  3AZH C;  4KUD C;  2DQN C;  3MVD A;  1P34 D;  3REH B;  1ID3 C;  3AZL A;  3W98 C;  3MGQ B;  3A6N A;  2VQR A;  1P3I A;  3KUY A;  4YS3 B;  3REI D;  4R8P D;  3V9R A;  4J8V B;  1P3K A;  2NQB A;  2FJ7 A;  4Z5T A;  4AWL B;  5C3I B;  3MGS D;  3EG5 B;  2JE5 A;  5CPJ D;  5E5A A;  3LEL C;  1KX5 D;  1WWI A;  3X1S D;  5B31 G;  3LZ1 D;  3REL C;  4YM6 A;  1P3F C;  5GT3 C;  5AVB A;  1N1J B;  3WTP B;  2HIO D;  1P3G D;  5BNV B;  5GT0 C;  4KHA B;  3VH6 A;  2BYM B;  3MGQ A;  5B1M C;  3MNN C;  1P3O B;  2W8S A;  4WU9 C;  4J8V A;  4YS3 A;  1M1A C;  1H3O B;  5GSU D;  3AL0 C;  5DNM B;  3LZ0 B;  4WU8 C;  5FUG B;  3UTB C;  4CSR B;  2NZD D;  5B2J D;  2DF4 C;  2IO5 B;  4G91 C;  4H9N B;  4H9S C;  4J8X C;  2ZM5 A;  3AZE C;  3P5J B;  3NQU B;  5B40 B;  4JJN D;  4HGA B;  3X1T D;  4ZUX D;  3AN2 C;  3UTA C;  4H9O B;  1JFI B;  3UT9 C;  3AV1 B;  4Z66 B;  1ZLA B;  1HQ3 D;  3WA9 C;  3AZH B;  3AZM C;  4KUD B;  3R45 A;  5B32 C;  5CPK D;  1N1J A;  3KXB D;  3WTP A;  1HTA A;  1S32 D;  5BNV A;  1M19 C;  1ID3 B;  4KHA A;  1F66 D;  3W98 B;  3REK D;  2BYM A;  4LD9 C;  5B0Z C;  5B31 C;  1H3O A;  5DNM A;  2F8N K;  3LZ0 A;  1BFM A;  5FUG A;  4CSR A;  1P3I C;  5AV9 C;  3AV2 C;  3C1C D;  1U35 C;  2FFF B;  3VH5 A;  3LEL B;  3MGP D;  3NQU A;  5B40 A;  3VH5 W;  4H9O A;  1JFI A;  2HUE C;  3AZJ D;  3AV1 A;  4Z66 A;  3REL B;  1B67 A;  1ZLA A;  3B6G D;  3X1T B;  5B24 C;  3AZH A;  4KUD A;  1P3F B;  4UPK A;  5GT3 B;  4QLC C;  1ID3 A;  3AYW C;  5GT0 B;  3W98 A;  1WWS A;  3W99 D;  5B1M B;  3MNN B;  5B33 D;  5AVB C;  4WU9 B;  1M1A B;  1P3G A;  4H9R A;  3LJA D;  3UTB B;  3AZG C;  4G91 B;  5GSU A;  3AZF D;  1EQZ C;  2JSS A;  4J8X B;  3AZE B;  3LEL A;  1KX4 B;  5GXQ C;  3AN2 B;  3UTA B;  5AV6 C;  3UT9 B;  2Y2L A;  2G5H C;  5B2I D;  3X1T A;  4H9Q B;  3C1B D;  3WA9 B;  5AV8 C;  5JRG D;  3AZM B;  1P3F A;  5GT3 A;  5B32 B;  1R4V A;  5B1L D;  1M19 B;  5GT0 A;  4LD9 B;  5B1M A;  5B31 B;  5BNX B;  5B0Z B;  3MNN A;  4WU9 A;  5CP6 D; 
#chains in the Genus database with same CATH homology
 1F66 A;  5BO0 B;  5AVC C;  3UTB A;  1P34 C;  1P3I B;  5AV9 B;  4X23 D;  4H9S A;  3AV2 B;  4J8X A;  1U35 B;  3AZE A;  1KX4 A;  3REI C;  4R8P C;  3X1U D;  3UTA A;  4WV4 B;  1Z2C B;  2HUE B;  3UT9 A;  4H9P B;  5AY8 D;  3B6F D;  3WAA D;  3AZK D;  4H9Q A;  5B24 B;  3WA9 A;  2ZY5 A;  3MGS C;  4M6B A;  3AZM A;  3KFU G;  5B32 A;  5CPJ C;  1P3A D;  4QLC B;  1KX5 C;  1M19 A;  3EPK A;  3AYW B;  3EPH A;  5DNN D;  5JA4 B;  5B0Z A;  5B31 A;  5BNX A;  3X1S C;  5AVB B;  3LZ1 C;  5BO0 A;  3AZN D;  3AZG B;  2BYK B;  5AV9 A;  2HIO C;  1P3G C;  1EQZ B;  4WJ3 C;  3AV2 A;  1U35 A;  5GXQ B;  5GSU C;  5AV6 B;  4H9P A;  5B32 G;  1P3P D;  2NZD C;  5B2J C;  5B24 A;  5AV8 B;  3B0C W;  1M18 D;  3B0B A;  2Y2H A;  1KU5 A;  4QLC A;  4JJN C;  3AYW A;  3X1T C;  4ZUX C;  5B0Y B;  5JA4 A;  3R45 B;  2F8N B;  5B1L A;  1HQ3 C;  5AVC B;  5CPK C;  3AZG A;  3VH6 W;  2BYK A;  3AFA D;  3KXB C;  1P34 B;  2Y2I A;  1KX3 D;  1S32 C;  1F66 C;  1EQZ A;  3REK C;  3A1I A;  1P3B D;  5GXQ A;  3REI B;  4R8P B;  4J8U D;  2L5A A;  2Y2Q A;  5AV6 A;  2ARO D;  2PYO D;  3F6T A;  1KX4 C;  2RVQ D;  5AV8 A;  3KWQ D;  3MGS B;  3C1C C;  1PZR A;  3WTP E;  5CPJ B;  3B6F A;  4XZQ D;  3MGP C;  1KX5 B;  2CV5 D;  5B0Y A;  4DRA A;  3EPJ A;  2J8P A;  5BT1 D;  3X1S B;  3H0R C;  3REJ D;  3AZJ C;  3LZ1 B;  2F8N A;  5AV5 D;  3B6G C;  3X1V D;  5AVC A;  4WZS B;  1P34 A;  1ULY A;  2HIO B;  1P3G B;  5F99 D;  2Y2M A;  1P3M D;  3W99 C;  4H9R B;  5B33 C;  1P3L D;  2Y2K A;  3REI A;  4R8P A;  5GSU B;  3O62 D;  3MGR D;  3LJA C;  1AOI D;  2NZD B;  5B2J B;  4XUJ D;  3MGS A;  3AZF C;  3WKJ D;  5CPJ A;  2F8N G;  1KX5 A;  4JJN B;  3TU4 D;  4ZUX B;  3X1S A;  3LZ1 A;  1TZY D;  4WU8 D;  5B2I C;  3C1B C;  1HQ3 B;  5JRG C;  5CPK B;  5B1L C;  3KXB B;  3W97 D;  2HIO A;  1S32 B;  4ZBJ C;  1F66 B;  5CPI D;  2ZY3 A;  3REK B;  4DRB A;  3W96 C;  5G49 A;  1M18 C;  5CP6 C;  4Z2M G;  2NZD A;  2G5I C;  5B2J A;  4X23 C;  4KGC D;  3C1C B;  3MGP B;  4JJN A;  3MVD D;  3W96 D;  4ZUX A;  3AZJ B;  3AZL D;  5AY8 C;  3A6N D;  3WAA C;  3B6F C;  3B6G B;  2CV5 A;  3KUY D;  3AZK C;  5B0Y C;  1HQ3 A;  1P3K D;  2NQB D;  5CPK A;  2FJ7 D;  3KXB A;  1P3A C;  4J8W D;  1S32 A;  4Z5T D;  5DNN C;  3REK A;  3W99 B;  4DQY B;  5B33 B;  4EO5 C;  5E5A D;  3AZI D;  3LJA B;  3AZN C;  4YM6 D;  3AZF B;  3C1C A;  3MGP A;  3REH D;  3AZJ A;  3MGQ D;  1P3P C;  3B6G A;  5B2I B;  4YS3 D;  3C1B B;  4J8V D;  2CWE A;  5JRG B;  4G92 C;  5B1L B;  4ZBJ B;  3W99 A;  5B33 A;  1M18 B;  3W96 B;  5CP6 B;  1A7W A;  1F1E A;  3LJA A;  3AFA C;  2F8N H;  4X23 B;  1KX3 C;  3AZF A;  4NE3 A;  1P3B C;  5BS7 A;  5KDM A;  3X1U B;  4J8U C;  3WTP D;  2ZY2 A;  2ARO C;  2JCH A;  5AY8 B;  2PYO C;  3B6F B;  3WAA B;  3EPL A;  5B2I A;  4WNN B;  1P3O D;  3AZK B;  3C1B A;  2RVQ C;  5JRG A;  3KWQ C;  5DNM D;  3LZ0 D;  4XZQ C;  1P3A B;  2LY8 A;  2CV5 C;  5DNN B;  5BT1 C;  3REJ C;  3W96 A;  4Z2M H;  1M18 A;  4EO5 B;  5AV5 C;  5CP6 A;  4J8W A;  2Y2G A;  5B40 D;  3X1V C;  3H0L C;  3AZN B;  3AV1 D;  4Z66 D;  4X23 A;  1ZLA D;  3KSY A;  5F99 C;  1P3M C;  3AZI A;  3AZH D;  4KUD D;  1P3L C;  1BH8 B;  2YFV B;  3X1U A;  4E45 A;  1ID3 D;  3O62 C;  3H0M C;  3MGR C;  3W98 D;  5AY8 A;  1AOI C;  1P3P B;  3WAA A;  4WNN A;  3REH A;  3AZK A;  4XUJ C;  3WKJ C;  4G92 B;  1P3A A;  3TU4 C;  5DNN A;  2XD5 A;  2Y2P A;  1TZY C;  3LEL D;  4NE5 A;  2XD1 A;  3AZN A;  5G49 B;  3AFA B;  3REL D;  3W97 C;  1KX3 B;  3B0C T;  5CPI C;  2BG1 A;  1P3B B;  1P3F D;  5CHL B;  5GT3 D;  1BH8 A;  2YFV A;  2YFW B;  4J8U B;  5GT0 D;  2ARO B;  2PYO B;  5B1M D;  1P3P A;  5BS7 C;  3MNN D;  1BH9 B;  3B0D C;  1TAF B;  4WU9 D;  1M1A D;  4KGC C;  3KWQ B;  3VH6 T;  4XZQ B;  3UTB D;  3MVD C;  1P3O A;  2CV5 B;  3IP4 C;  2F2A C;  3REJ B;  3AZL C;  4J8X D;  3A6N C;  5AV5 B;  3AZE D;  1KX4 D;  3X1V B;  3KUY C;  3AN2 D;  4H9N A;  3UTA D;  1P3K C;  2NQB C;  4UUZ B;  3UT9 D;  3AFA A;  2FJ7 C;  4J8W C;  1KX3 A;  2UWX A;  4Z5T C;  5F99 B;  1P3M B;  3WA9 D;  3AZM D;  1P3B A;  5B32 D;  1P3L B;  1T3U A;  2YFW A;  5E5A C;  4J8U A;  1M19 D;  3O62 B;  3MGR B;  2ARO A;  3AZI C;  2PYO A;  4LD9 D;  1AOI B;  5B0Z D;  5B31 D;  1BH9 A;  1TAF A;  4YM6 C;  4XUJ B;  3X1U C;  1B6W A;  3KWQ A;  3WKJ B;  4XZQ A;  3TU4 B;  1P3I D;  3REH C;  5AV9 D;  1M1A A;  3REJ A;  3AV2 D;  1TZY B;  1U35 D;  3MGQ C;  4WU8 B;  5AV5 A;  2Y2N A;  3NQJ B;  2RIQ A;  3X1V A;  4YS3 C;  4J8V C;  4UUZ A;  3VH5 T;  3W97 B;  4NE6 A;  5F99 A;  4AWL C;  5CPI B;  5B24 D;  1W2E A;  5C3I C;  2ZY4 A;  1P3M A;  1P3L A;  3FDD A;  3REL A;  4QLC D;  3O62 A;  3AYW D;  3MGR A;  1AOI A;  3A1K A;  3B0D B;  5AVB D;  5KDM B;  4CAY B;  4XUJ A;  4KGC B;  3WKJ A;  3MVD B;  3TU4 A;  3AZG D;  3WTP C;  1EQZ D;  3AZL B;  1TZY A;  4WU8 A;  3A6N B;  1P3O C;  3NQJ A;  5GXQ D;  3KUY B;  3V9R B;  1P3K B;  2NQB B;  1Q9C A;  5AV6 D;  4NFT A;  2Y2O A;  2FJ7 B;  5DNM C;  3LZ0 C;  3W97 A;  4J8W B;  4Z5T B;  3AN2 A;  5CPI A;  2IO5 C;  4E44 A;  5AV8 D;  5E5A B;  5B40 C;  4HGA C;  5B0Y D;  3AZI B;  3AV1 C;  4Z66 C;  2F8N D;  4CAY A;  4YM6 B;  1ZLA C;  4KGC A;  2Y2J A;  5AVC D;  4LD9 A;  3AZH C;  4KUD C;  2DQN C;  3MVD A;  1P34 D;  3REH B;  1ID3 C;  3AZL A;  3W98 C;  3MGQ B;  3A6N A;  2VQR A;  1P3I A;  3KUY A;  4YS3 B;  3REI D;  4R8P D;  3V9R A;  4J8V B;  1P3K A;  2NQB A;  2FJ7 A;  4Z5T A;  4AWL B;  5C3I B;  3MGS D;  3EG5 B;  2JE5 A;  5CPJ D;  5E5A A;  3LEL C;  1KX5 D;  1WWI A;  3X1S D;  5B31 G;  3LZ1 D;  3REL C;  4YM6 A;  1P3F C;  5GT3 C;  5AVB A;  1N1J B;  3WTP B;  2HIO D;  1P3G D;  5BNV B;  5GT0 C;  4KHA B;  3VH6 A;  2BYM B;  3MGQ A;  5B1M C;  3MNN C;  1P3O B;  2W8S A;  4WU9 C;  4J8V A;  4YS3 A;  1M1A C;  1H3O B;  5GSU D;  3AL0 C;  5DNM B;  3LZ0 B;  4WU8 C;  5FUG B;  3UTB C;  4CSR B;  2NZD D;  5B2J D;  2DF4 C;  2IO5 B;  4G91 C;  4H9N B;  4H9S C;  4J8X C;  2ZM5 A;  3AZE C;  3P5J B;  3NQU B;  5B40 B;  4JJN D;  4HGA B;  3X1T D;  4ZUX D;  3AN2 C;  3UTA C;  4H9O B;  1JFI B;  3UT9 C;  3AV1 B;  4Z66 B;  1ZLA B;  1HQ3 D;  3WA9 C;  3AZH B;  3AZM C;  4KUD B;  3R45 A;  5B32 C;  5CPK D;  1N1J A;  3KXB D;  3WTP A;  1HTA A;  1S32 D;  5BNV A;  1M19 C;  1ID3 B;  4KHA A;  1F66 D;  3W98 B;  3REK D;  2BYM A;  4LD9 C;  5B0Z C;  5B31 C;  1H3O A;  5DNM A;  2F8N K;  3LZ0 A;  1BFM A;  5FUG A;  4CSR A;  1P3I C;  5AV9 C;  3AV2 C;  3C1C D;  1U35 C;  2FFF B;  3VH5 A;  3LEL B;  3MGP D;  3NQU A;  5B40 A;  3VH5 W;  4H9O A;  1JFI A;  2HUE C;  3AZJ D;  3AV1 A;  4Z66 A;  3REL B;  1B67 A;  1ZLA A;  3B6G D;  3X1T B;  5B24 C;  3AZH A;  4KUD A;  1P3F B;  4UPK A;  5GT3 B;  4QLC C;  1ID3 A;  3AYW C;  5GT0 B;  3W98 A;  1WWS A;  3W99 D;  5B1M B;  3MNN B;  5B33 D;  5AVB C;  4WU9 B;  1M1A B;  1P3G A;  4H9R A;  3LJA D;  3UTB B;  3AZG C;  4G91 B;  5GSU A;  3AZF D;  1EQZ C;  2JSS A;  4J8X B;  3AZE B;  3LEL A;  1KX4 B;  5GXQ C;  3AN2 B;  3UTA B;  5AV6 C;  3UT9 B;  2Y2L A;  2G5H C;  5B2I D;  3X1T A;  4H9Q B;  3C1B D;  3WA9 B;  5AV8 C;  5JRG D;  3AZM B;  1P3F A;  5GT3 A;  5B32 B;  1R4V A;  5B1L D;  1M19 B;  5GT0 A;  4LD9 B;  5B1M A;  5B31 B;  5BNX B;  5B0Z B;  3MNN A;  4WU9 A;  5CP6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...