3AZID

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziD00
1P3IC 3WTPE 1WWSA 3AV1B 5DNMA 3UTAD 5CPJA 5B2IA 3AYWC 3O62C 4XZQC 4H9RA 3B6GC 4EO5B 1EQZA 5AV5D 4R8PC 1F66A 3WA9C 1KX5B 3X1SA 3LELB 3X1VB 5AV6A 3UT9B 3AZJC 1P3PC 5DNMB 5AVBD 2HIOA 5CPJB 1KX3C 4HGAC 5B2IB 2IO5C 3AZNC 3LZ0D 3MVDA 4H9RB 1P34A 1M18A 1P3OD 1EQZB 1F66B 4Z2MH 3REIC 4X23D 4H9QA 3W97C 3X1SB 5AV6B 4J8UC 1TZYD 3UT9C 2L5AA 2F8NA 5AV9A 3WTPC 2HIOB 1M1AC 1M19D 2F8NG 3KXBC 3AFAD 3REKA 5CP6D 5DNND 3MVDB 5CPID 1P3BD 1P34B 1M18B 1P3MC 5GT3D 5B1MC 4H9QB 3B6FA 2PYOA 3WAAD 2NQBA 3AZKC 2F8NB 5B1LA 1TAFA 5AV9B 5AV8C 3MGRA 3REKB 3MVDC 4M6BA 1S32A 3TU4D 1M18C 3RELC 5B40D 4G92B 5G49A 5B0YC 4J8VA 3W99A 3B6FB 2PYOB 2NQBB 5B1LB 1TAFB 5JRGD 4JJNC 4WV4B 3MGSA 3VH6A 2HUEC 3AZFD 3MGRB 4J8XA 4ZUXD 1P3KA 2CV5D 1S32B 5BNXA 1WWIA 1U35D 5G49B 5B31A 4J8VB 2FJ7C 3W99B 4KUDD 4Z2MG 5B31G 1P3LD 3AZLA 3MGQD 3KWQA 3X1UC 5BT1D 3MGSB 3W98D 4J8XB 3AZMA 3REHD 1P3KB 3UTBC 4H9NA 1S32C 5BNXB 4X23C 1P3IA 4YM6C 3LZ1A 1KU5A 5B31B 3AZGC 3W99C 3C1CD 2AROD 3MNNC 3W96D 3AZLB 5B0ZC 1ID3D 4G91C 3KWQB 5B24A 1AOID 3VH5T 3AYWA 3O62A 4XZQA 3B6GA 5CPKD 4Z66D 4NFTA 3AZMB 4R8PA 4H9NB 3WA9A 3B0CW 3LZ1B 1P3IB 1AOIB 3AZJA 5B33C 4XUJC 1P3PA 4E45A 5FUGA 1KX3A 3C1BC 1KX5D 5B24B 3LELD 3X1VD 3AYWB 3AZNA 3O62B 4XZQB 4KGCC 3B6GB 3AV2C 1P3AC 5DNMD 3TU4C 1ULYA 5CPJD 5B32B 4R8PB 4LD9D 3REIA 3WA9B 3W97A 5B2ID 3AZED 4J8UA 1B6WA 3LZ1C 3AZJB 3UT9A 3AN2C 1P3PB 3REJC 5FUGB 1EQZD 3WTPA 1M1AA 1KX3B 4QLCD 5KDMB 3X1TC 1F66D 4HGAB 4DRBA 3NQJA 3KXBA 3X1SD 5B24C 2IO5B 5AV6D 3AZNB 1P3MA 5B32C 1Q9CA 1U35C 3REIB 5B1MA 3WKJC 3W97B 4J8UB 5GT0C 1P34D 3AZKA 3MGQC 3WTPB 3AZHC 5AV8A 4WU9D 1M1AB 3KXBB 3NQJB 4Z5TC 2F8NK 3MGPC 5GSUC 2F8ND 1P3MB 3RELA 5AV9D 5GXQC 4DRAA 5F99C 5B1MB 5B0YA 5AVCD 3REKD 3AZKB 4JJNA 1ZLAC 3B0BA 5AV8B 3LJAD 4YS3C 5CPKC 4WU8C 3B0DC 3B6FD 2PYOD 2BYMA 2NQBD 5B1LD 3RELB 3AZID 5C3IC 5B0YB 5AY8C 3KUYC 2YFVA 4J8WC 2FJ7A 1P3GC 5E5AC 1HQ3C 4JJNB 1P3FC 3X1UA 3VH6T 2HUEB 4H9PA 3UTBA 2BYMB 4X23A 3AZEC 4YM6A 3MGSD 3AZGA 2FJ7B 2YFVB 4J8XD 2YFWA 2NZDD 3MNNA 5B2JD 1P3KD 5B0ZA 3UTAC 3X1UB 5B31D 1KX4D 1R4VA 4H9PB 3AZLD 4ZBJC 5AV5C 3UTBB 4X23B 1H3OA 4YM6B 5B33A 4XUJA 3AZGB 4WZSB 3AZMD 2YFWB 3MNNB 5AVBC 5B0ZB 4WU9C 4G91B 3C1BA 1HTAA 5CP6B 4KGCA 3LZ0C 3AV2A 1P3AA 3TU4A 3A6ND 1P3OC 2CWEA 1H3OB 3O62D 4XZQD 5B33B 4AWLC 3AN2A 4XUJB 3B6GD 1TZYC 3REJA 3X1TA 3C1BB 1M19C 3WA9D 3AFAC 3LJAC 5CP6C 5DNNC 3AZJD 4KGCB 3AV2B 5CPIC 1P3PD 1P3BC 1P3AB 4H9OA 3TU4B 3AV1D 5B32A 1KX3D 1U35A 3WKJA 5GT3C 5B32G 3AZND 3AN2B 5GT0A 1P3LA 3REJB 3WAAC 3MGQA 3AZHA 5KDMA 3X1TB 3REID 3W97D 4Z5TA 4J8UD 3REHA 3UT9D 3MGPA 5GSUA 4H9OB 3WTPD 5GXQA 1M1AD 1U35B 5F99A 3KXBD 5B40C 3WKJB 2NZDC 5GT0B 1P3LB 3MGQB 1P3MD 1ZLAA 3AZHB 5JRGC 5B1MD 4Z5TB 4YS3A 5CPKA 3AZFC 4Z66A 4WU8A 4ZUXC 3REHB 3MGPB 5GSUB 3AZKD 2CV5C 5GXQB 5AV8D 2HIOD 3VH5A 5F99B 5AY8A 3KUYA 4J8WA 1P3GA 5E5AA 4KUDC 1HQ3A 3MVDD 1BH8A 1P3LC 1M18D 3RELD 1P3FA 1ZLAB 5BT1C 5B0YD 4YS3B 3W98C 2LY8A 2RVQD 5CPKB 4Z66B 4H9SC 4WU8B 3B0DB 5BS7C 3A6NC 3REHC 4LD9A 4JJND 3AZEA 5C3IB 5AY8B 3KUYB 4J8WB 1A7WA 1P3GB 5E5AB 3C1CC 2AROC 1HQ3B 1BH8B 3UTAA 3W96C 4QLCA 1ID3C 1P3FB 1AOIC 5BNVA 2FJ7D 4Z66C 2BYKA 3AV1C 5AV5A 1N1JA 4LD9B 3B0CT 3X1UD 3AZEB 3MGRD 4EO5C 5AVBA 3UTBD 3UTAB 4WU9A 4QLCB 1S32D 1B67A 1KX5C 4YM6D 3X1VC 3LELC 5BNVB 3LZ0A 3AZGD 3W99D 4J8VD 3MNND 2BYKB 1P3OA 5DNMC 4ZBJB 5B0ZD 1N1JB 5AV5B 5CPJC 4LD9C 1F1EA 4NE6A 5B2IC 3KSYA 5AVCA 3V9RA 3VH5W 1TZYA 1EQZC 5AVBB 4WU9B 1M19A 4QLCC 1F66C 3AFAA 3LJAA 3X1SC 5CP6A 5DNNA 5B33D 5AV6C 3LZ0B 4XUJD 5CPIA 1P3BA 1P3OB 3AZIA 2HIOC 3C1BD 3KWQD 5GT3A 5AVCB 4KHAA 4AWLB 3V9RB 4KGCD 1TZYB 3AV2D 3WAAA 1P34C 1P3AD 3R45A 1M19B 3AFAB 3LJAB 2RVQC 1P3ID 3LZ1D 5DNNB 3AN2D 5CPIB 3REJD 1P3BB 1BFMA 3AZIB 5AV9C 3X1TD 5B40A 5GT3B 5B24D 5BO0A 5AVCC 3REKC 3AYWD 4KHAB 2NZDA 5B2JA 3WAAB 3R45B 4CSRA 5JRGA 5B32D 4R8PD 3WKJD 1KX4A 4G92C 3AZFA 4ZUXA 5GT0D 3B6FC 2CV5A 2PYOC 4CAYA 2NQBC 3AZHD 5B1LC 3AZIC 5B40B 4Z5TD 5BO0B 3MGRC 4KUDA 2NZDB 5B2JB 3MGPD 5GSUD 4CSRB 1JFIA 5JRGB 5GXQD 5F99D 3W98A 4WNNA 1KX4B 4J8VC 3AZFB 4H9SA 4ZUXB 5BS7A 3A6NA 2CV5B 4CAYB 1ZLAD 5JA4A 4UUZA 3MGSC 4YS3D 4J8XC 3C1CA 4KUDB 4WU8D 2AROA 1BH9A 3W96A 4E44A 5B2JC 1P3KC 1ID3A 1JFIB 3NQUA 1AOIA 5AY8D 4WNNB 3KUYD 4J8WD 4NE5A 5B31C 1P3GD 1KX4C 3W98B 5E5AD 2F8NH 5CHLB 1HQ3D 3A6NB 3AV1A 3AZLC 5JA4B 3KWQC 1P3FD 2JSSA 4UUZB 3VH6W 3C1CB 2AROB 3AZMC 1BH9B 3W96B 1ID3B 4NE3A 1KX5A 3NQUB 3LELA 3X1VA
chains in the Genus database with same CATH superfamily
1P3IC 3WTPE 1WWSA 3AV1B 5DNMA 2Y2LA 3UTAD 5CPJA 2Y2PA 5B2IA 3AYWC 3O62C 4XZQC 4H9RA 3B6GC 4EO5B 1EQZA 5AV5D 4R8PC 1F66A 3WA9C 1KX5B 3X1SA 3LELB 3X1VB 1T3UA 5AV6A 3UT9B 3AZJC 1P3PC 3EPJA 5AVBD 5DNMB 2HIOA 5CPJB 2RIQA 1KX3C 4HGAC 5B2IB 2IO5C 3AZNC 3LZ0D 3MVDA 4H9RB 3H0RC 1P34A 1M18A 1P3OD 1EQZB 1F66B 4Z2MH 3REIC 4X23D 4H9QA 3W97C 3X1SB 5AV6B 4J8UC 1TZYD 3UT9C 2L5AA 2F8NA 5AV9A 3WTPC 2HIOB 1M1AC 1M19D 2F8NG 3KXBC 3AFAD 3REKA 5CP6D 5DNND 3MVDB 5CPID 1P3BD 1P34B 1M18B 1P3MC 5GT3D 5B1MC 4H9QB 2F2AC 2J8PA 4DQYB 3IP4C 2PYOA 3B6FA 3WAAD 2NQBA 3AZKC 2F8NB 5B1LA 1TAFA 5AV9B 5AV8C 2FFFB 3MGRA 3REKB 3MVDC 4M6BA 1S32A 3TU4D 1M18C 3RELC 2Y2OA 5B40D 4G92B 5G49A 5B0YC 4J8VA 3W99A 3B6FB 2PYOB 2NQBB 5JRGD 1TAFB 5B1LB 4JJNC 2Y2IA 4WV4B 3MGSA 3VH6A 2HUEC 3AZFD 3MGRB 4J8XA 4ZUXD 1P3KA 2CV5D 1S32B 5BNXA 1WWIA 1U35D 5G49B 5B31A 2BG1A 4J8VB 2FJ7C 3W99B 4KUDD 4Z2MG 5B31G 1P3LD 3AZLA 3MGQD 3KWQA 3X1UC 5BT1D 3MGSB 3W98D 4J8XB 3AZMA 3REHD 1P3KB 3UTBC 4H9NA 1S32C 5BNXB 4X23C 2JE5A 1P3IA 4YM6C 3LZ1A 1KU5A 5B31B 3AZGC 3W99C 3C1CD 2AROD 3MNNC 3W96D 3AZLB 5B0ZC 1ID3D 4G91C 3KWQB 5B24A 1AOID 3VH5T 3AYWA 3O62A 4XZQA 3B6GA 5CPKD 4Z66D 4NFTA 3F6TA 3AZMB 1Z2CB 4R8PA 4H9NB 3WA9A 3B0CW 3LZ1B 1P3IB 1AOIB 3AZJA 5B33C 4XUJC 1P3PA 4E45A 5FUGA 1KX3A 3C1BC 1KX5D 5B24B 3LELD 3X1VD 3AYWB 3AZNA 3O62B 4XZQB 4KGCC 3B6GB 3AV2C 1P3AC 5DNMD 3TU4C 1ULYA 5CPJD 5B32B 4R8PB 4LD9D 3REIA 3WA9B 3W97A 5B2ID 3AZED 2VQRA 4J8UA 1B6WA 3LZ1C 3AZJB 3UT9A 3AN2C 1P3PB 3REJC 5FUGB 1EQZD 3WTPA 1M1AA 1KX3B 4QLCD 5KDMB 3X1TC 1F66D 4HGAB 4DRBA 3NQJA 3KXBA 3X1SD 5B24C 2IO5B 2ZY3A 5AV6D 3AZNB 1P3MA 5B32C 1Q9CA 1U35C 3REIB 5B1MA 3WKJC 3W97B 4J8UB 5GT0C 1P34D 3AZKA 3MGQC 3WTPB 3AZHC 5AV8A 4WU9D 1M1AB 3KXBB 3NQJB 4Z5TC 2XD1A 2F8NK 3MGPC 5GSUC 2F8ND 1P3MB 3RELA 5AV9D 5GXQC 4DRAA 5F99C 5B1MB 5B0YA 5AVCD 3REKD 2ZY2A 3FDDA 3AZKB 4JJNA 1ZLAC 3B0BA 5AV8B 3LJAD 4YS3C 5CPKC 4WU8C 2Y2NA 3B0DC 3B6FD 2PYOD 2BYMA 2NQBD 5B1LD 3RELB 3AZID 5C3IC 5B0YB 5AY8C 3KUYC 2YFVA 4J8WC 2FJ7A 1P3GC 5E5AC 1HQ3C 4JJNB 1P3FC 3X1UA 2ZY4A 3VH6T 2HUEB 2Y2QA 4H9PA 3UTBA 2BYMB 4X23A 3AZEC 4YM6A 3MGSD 3AZGA 2FJ7B 2YFVB 4J8XD 2YFWA 2NZDD 3MNNA 5B2JD 1P3KD 5B0ZA 3UTAC 3X1UB 2Y2JA 5B31D 1KX4D 1R4VA 4H9PB 3AZLD 4ZBJC 5AV5C 3UTBB 4X23B 1H3OA 4YM6B 5B33A 4XUJA 3AZGB 4WZSB 3AZMD 2YFWB 2Y2HA 3MNNB 5AVBC 5B0ZB 4WU9C 4G91B 3C1BA 1HTAA 5CP6B 4KGCA 3LZ0C 3AV2A 1P3AA 3TU4A 3A6ND 1P3OC 2CWEA 1H3OB 3O62D 4XZQD 5B33B 4AWLC 3AN2A 4XUJB 3B6GD 1TZYC 3REJA 3X1TA 3H0LC 3C1BB 1M19C 3WA9D 3AFAC 3LJAC 5CP6C 5DNNC 3AZJD 4KGCB 3AV2B 5CPIC 1P3PD 1P3BC 1P3AB 4H9OA 3TU4B 3AV1D 5B32A 1KX3D 1U35A 3WKJA 5GT3C 5B32G 3AZND 3AN2B 5GT0A 1P3LA 3REJB 3WAAC 3MGQA 3AZHA 5KDMA 3X1TB 3REID 3W97D 4Z5TA 2DQNC 4J8UD 2JCHA 3REHA 3UT9D 3MGPA 5GSUA 4H9OB 3WTPD 5GXQA 2DF4C 1M1AD 1U35B 5F99A 3KXBD 5B40C 3WKJB 3EPHA 1W2EA 2NZDC 5GT0B 1P3LB 3MGQB 1P3MD 1ZLAA 3AZHB 5JRGC 2XD5A 5B1MD 4Z5TB 4YS3A 5CPKA 3AZFC 4Z66A 4WU8A 4ZUXC 3REHB 3MGPB 5GSUB 3AZKD 2CV5C 5GXQB 5AV8D 2HIOD 3VH5A 5F99B 5AY8A 3KUYA 4J8WA 1P3GA 5E5AA 4KUDC 1HQ3A 3MVDD 1BH8A 1P3LC 1M18D 3RELD 1P3FA 1ZLAB 5BT1C 5B0YD 4YS3B 3W98C 2LY8A 2RVQD 5CPKB 4Z66B 3EPLA 4H9SC 4WU8B 3B0DB 5BS7C 3A6NC 3REHC 4LD9A 4JJND 3AZEA 5C3IB 2G5IC 5AY8B 3KUYB 4J8WB 1A7WA 1P3GB 5E5AB 3C1CC 2AROC 1HQ3B 1BH8B 3UTAA 3W96C 4QLCA 1ID3C 1P3FB 1AOIC 3H0MC 5BNVA 2FJ7D 2W8SA 4Z66C 2BYKA 3AV1C 5AV5A 1N1JA 4LD9B 3B0CT 3X1UD 3AZEB 3MGRD 4EO5C 4UPKA 5AVBA 3UTBD 3UTAB 4WU9A 4QLCB 1S32D 1B67A 1KX5C 3A1KA 4YM6D 3X1VC 3LELC 5BNVB 3LZ0A 3AZGD 1PZRA 3W99D 4J8VD 3MNND 2BYKB 3EG5B 5DNMC 4ZBJB 5B0ZD 1N1JB 5AV5B 5CPJC 1P3OA 4LD9C 1F1EA 4NE6A 5B2IC 3KSYA 5AVCA 3V9RA 3VH5W 1TZYA 1EQZC 5AVBB 4WU9B 1M19A 2Y2MA 4QLCC 1F66C 3AFAA 3LJAA 3X1SC 5CP6A 5DNNA 5B33D 5AV6C 3LZ0B 4XUJD 5CPIA 1P3BA 2ZY5A 1P3OB 3AZIA 2HIOC 3C1BD 3KWQD 5GT3A 5AVCB 4KHAA 4AWLB 3V9RB 4KGCD 1TZYB 2Y2GA 3AV2D 3WAAA 1P34C 1P3AD 3R45A 2Y2KA 3KFUG 3A1IA 1M19B 3AFAB 3LJAB 2RVQC 1P3ID 3LZ1D 5DNNB 3AN2D 5CPIB 3REJD 1P3BB 1BFMA 3AZIB 5AV9C 3X1TD 5B40A 5GT3B 5B24D 5BO0A 5AVCC 3REKC 3AYWD 4KHAB 2NZDA 3AL0C 5B2JA 3WAAB 3R45B 4CSRA 5JRGA 5B32D 4R8PD 3WKJD 2UWXA 1KX4A 4G92C 3AZFA 4ZUXA 5GT0D 3B6FC 2CV5A 2PYOC 4CAYA 2NQBC 3AZHD 5B1LC 3AZIC 5B40B 4Z5TD 5BO0B 3MGRC 4KUDA 2NZDB 5B2JB 3MGPD 5GSUD 3EPKA 4CSRB 2ZM5A 1JFIA 5JRGB 5GXQD 5F99D 3W98A 4WNNA 1KX4B 4J8VC 3AZFB 4H9SA 4ZUXB 5BS7A 3A6NA 2CV5B 4CAYB 1ZLAD 5JA4A 4UUZA 3MGSC 4YS3D 4J8XC 3C1CA 4KUDB 4WU8D 2AROA 1BH9A 3W96A 4E44A 5B2JC 1P3KC 1ID3A 4WJ3C 1JFIB 3NQUA 1AOIA 5AY8D 4WNNB 3KUYD 4J8WD 5B31C 4NE5A 1P3GD 1KX4C 3W98B 5E5AD 2G5HC 2F8NH 5CHLB 1HQ3D 3A6NB 3AV1A 3AZLC 5JA4B 3KWQC 1P3FD 2JSSA 4UUZB 3VH6W 3C1CB 2AROB 3AZMC 1BH9B 3W96B 3P5JB 1ID3B 4NE3A 1KX5A 3NQUB 3LELA 3X1VA
chains in the Genus database with same CATH topology
1P3IC 3WTPE 1WWSA 3AV1B 5DNMA 2Y2LA 3UTAD 5CPJA 2Y2PA 5B2IA 3AYWC 3O62C 4XZQC 4H9RA 3B6GC 4EO5B 1EQZA 5AV5D 4R8PC 1F66A 3WA9C 1KX5B 3X1SA 3LELB 3X1VB 1T3UA 5AV6A 3UT9B 3AZJC 1P3PC 3EPJA 5AVBD 5DNMB 2HIOA 5CPJB 2RIQA 1KX3C 4HGAC 5B2IB 2IO5C 3AZNC 3LZ0D 3MVDA 4H9RB 3H0RC 1P34A 1M18A 1P3OD 1EQZB 1F66B 4Z2MH 3REIC 4X23D 4H9QA 3W97C 3X1SB 5AV6B 4J8UC 1TZYD 3UT9C 2L5AA 2F8NA 5AV9A 3WTPC 2HIOB 1M1AC 1M19D 2F8NG 3KXBC 3AFAD 3REKA 5CP6D 5DNND 3MVDB 5CPID 1P3BD 1P34B 1M18B 1P3MC 5GT3D 5B1MC 4H9QB 2F2AC 2J8PA 4DQYB 3IP4C 2PYOA 3B6FA 3WAAD 2NQBA 3AZKC 2F8NB 5B1LA 1TAFA 5AV9B 5AV8C 2FFFB 3MGRA 3REKB 3MVDC 4M6BA 1S32A 3TU4D 1M18C 3RELC 2Y2OA 5B40D 4G92B 5G49A 5B0YC 4J8VA 3W99A 3B6FB 2PYOB 2NQBB 5JRGD 1TAFB 5B1LB 4JJNC 2Y2IA 4WV4B 3MGSA 3VH6A 2HUEC 3AZFD 3MGRB 4J8XA 4ZUXD 1P3KA 2CV5D 1S32B 5BNXA 1WWIA 1U35D 5G49B 5B31A 2BG1A 4J8VB 2FJ7C 3W99B 4KUDD 4Z2MG 5B31G 1P3LD 3AZLA 3MGQD 3KWQA 3X1UC 5BT1D 3MGSB 3W98D 4J8XB 3AZMA 3REHD 1P3KB 3UTBC 4H9NA 1S32C 5BNXB 4X23C 2JE5A 1P3IA 4YM6C 3LZ1A 1KU5A 5B31B 3AZGC 3W99C 3C1CD 2AROD 3MNNC 3W96D 3AZLB 5B0ZC 1ID3D 4G91C 3KWQB 5B24A 1AOID 3VH5T 3AYWA 3O62A 4XZQA 3B6GA 5CPKD 4Z66D 4NFTA 3F6TA 3AZMB 1Z2CB 4R8PA 4H9NB 3WA9A 3B0CW 3LZ1B 1P3IB 1AOIB 3AZJA 5B33C 4XUJC 1P3PA 4E45A 5FUGA 1KX3A 3C1BC 1KX5D 5B24B 3LELD 3X1VD 3AYWB 3AZNA 3O62B 4XZQB 4KGCC 3B6GB 3AV2C 1P3AC 5DNMD 3TU4C 1ULYA 5CPJD 5B32B 4R8PB 4LD9D 3REIA 3WA9B 3W97A 5B2ID 3AZED 2VQRA 4J8UA 1B6WA 3LZ1C 3AZJB 3UT9A 3AN2C 1P3PB 3REJC 5FUGB 1EQZD 3WTPA 1M1AA 1KX3B 4QLCD 5KDMB 3X1TC 1F66D 4HGAB 4DRBA 3NQJA 3KXBA 3X1SD 5B24C 2IO5B 2ZY3A 5AV6D 3AZNB 1P3MA 5B32C 1Q9CA 1U35C 3REIB 5B1MA 3WKJC 3W97B 4J8UB 5GT0C 1P34D 3AZKA 3MGQC 3WTPB 3AZHC 5AV8A 4WU9D 1M1AB 3KXBB 3NQJB 4Z5TC 2XD1A 2F8NK 3MGPC 5GSUC 2F8ND 1P3MB 3RELA 5AV9D 5GXQC 4DRAA 5F99C 5B1MB 5B0YA 5AVCD 3REKD 2ZY2A 3FDDA 3AZKB 4JJNA 1ZLAC 3B0BA 5AV8B 3LJAD 4YS3C 5CPKC 4WU8C 2Y2NA 3B0DC 3B6FD 2PYOD 2BYMA 2NQBD 5B1LD 3RELB 3AZID 5C3IC 5B0YB 5AY8C 3KUYC 2YFVA 4J8WC 2FJ7A 1P3GC 5E5AC 1HQ3C 4JJNB 1P3FC 3X1UA 2ZY4A 3VH6T 2HUEB 2Y2QA 4H9PA 3UTBA 2BYMB 4X23A 3AZEC 4YM6A 3MGSD 3AZGA 2FJ7B 2YFVB 4J8XD 2YFWA 2NZDD 3MNNA 5B2JD 1P3KD 5B0ZA 3UTAC 3X1UB 2Y2JA 5B31D 1KX4D 1R4VA 4H9PB 3AZLD 4ZBJC 5AV5C 3UTBB 4X23B 1H3OA 4YM6B 5B33A 4XUJA 3AZGB 4WZSB 3AZMD 2YFWB 2Y2HA 3MNNB 5AVBC 5B0ZB 4WU9C 4G91B 3C1BA 1HTAA 5CP6B 4KGCA 3LZ0C 3AV2A 1P3AA 3TU4A 3A6ND 1P3OC 2CWEA 1H3OB 3O62D 4XZQD 5B33B 4AWLC 3AN2A 4XUJB 3B6GD 1TZYC 3REJA 3X1TA 3H0LC 3C1BB 1M19C 3WA9D 3AFAC 3LJAC 5CP6C 5DNNC 3AZJD 4KGCB 3AV2B 5CPIC 1P3PD 1P3BC 1P3AB 4H9OA 3TU4B 3AV1D 5B32A 1KX3D 1U35A 3WKJA 5GT3C 5B32G 3AZND 3AN2B 5GT0A 1P3LA 3REJB 3WAAC 3MGQA 3AZHA 5KDMA 3X1TB 3REID 3W97D 4Z5TA 2DQNC 4J8UD 2JCHA 3REHA 3UT9D 3MGPA 5GSUA 4H9OB 3WTPD 5GXQA 2DF4C 1M1AD 1U35B 5F99A 3KXBD 5B40C 3WKJB 3EPHA 1W2EA 2NZDC 5GT0B 1P3LB 3MGQB 1P3MD 1ZLAA 3AZHB 5JRGC 2XD5A 5B1MD 4Z5TB 4YS3A 5CPKA 3AZFC 4Z66A 4WU8A 4ZUXC 3REHB 3MGPB 5GSUB 3AZKD 2CV5C 5GXQB 5AV8D 2HIOD 3VH5A 5F99B 5AY8A 3KUYA 4J8WA 1P3GA 5E5AA 4KUDC 1HQ3A 3MVDD 1BH8A 1P3LC 1M18D 3RELD 1P3FA 1ZLAB 5BT1C 5B0YD 4YS3B 3W98C 2LY8A 2RVQD 5CPKB 4Z66B 3EPLA 4H9SC 4WU8B 3B0DB 5BS7C 3A6NC 3REHC 4LD9A 4JJND 3AZEA 5C3IB 2G5IC 5AY8B 3KUYB 4J8WB 1A7WA 1P3GB 5E5AB 3C1CC 2AROC 1HQ3B 1BH8B 3UTAA 3W96C 4QLCA 1ID3C 1P3FB 1AOIC 3H0MC 5BNVA 2FJ7D 2W8SA 4Z66C 2BYKA 3AV1C 5AV5A 1N1JA 4LD9B 3B0CT 3X1UD 3AZEB 3MGRD 4EO5C 4UPKA 5AVBA 3UTBD 3UTAB 4WU9A 4QLCB 1S32D 1B67A 1KX5C 3A1KA 4YM6D 3X1VC 3LELC 5BNVB 3LZ0A 3AZGD 1PZRA 3W99D 4J8VD 3MNND 2BYKB 3EG5B 5DNMC 4ZBJB 5B0ZD 1N1JB 5AV5B 5CPJC 1P3OA 4LD9C 1F1EA 4NE6A 5B2IC 3KSYA 5AVCA 3V9RA 3VH5W 1TZYA 1EQZC 5AVBB 4WU9B 1M19A 2Y2MA 4QLCC 1F66C 3AFAA 3LJAA 3X1SC 5CP6A 5DNNA 5B33D 5AV6C 3LZ0B 4XUJD 5CPIA 1P3BA 2ZY5A 1P3OB 3AZIA 2HIOC 3C1BD 3KWQD 5GT3A 5AVCB 4KHAA 4AWLB 3V9RB 4KGCD 1TZYB 2Y2GA 3AV2D 3WAAA 1P34C 1P3AD 3R45A 2Y2KA 3KFUG 3A1IA 1M19B 3AFAB 3LJAB 2RVQC 1P3ID 3LZ1D 5DNNB 3AN2D 5CPIB 3REJD 1P3BB 1BFMA 3AZIB 5AV9C 3X1TD 5B40A 5GT3B 5B24D 5BO0A 5AVCC 3REKC 3AYWD 4KHAB 2NZDA 3AL0C 5B2JA 3WAAB 3R45B 4CSRA 5JRGA 5B32D 4R8PD 3WKJD 2UWXA 1KX4A 4G92C 3AZFA 4ZUXA 5GT0D 3B6FC 2CV5A 2PYOC 4CAYA 2NQBC 3AZHD 5B1LC 3AZIC 5B40B 4Z5TD 5BO0B 3MGRC 4KUDA 2NZDB 5B2JB 3MGPD 5GSUD 3EPKA 4CSRB 2ZM5A 1JFIA 5JRGB 5GXQD 5F99D 3W98A 4WNNA 1KX4B 4J8VC 3AZFB 4H9SA 4ZUXB 5BS7A 3A6NA 2CV5B 4CAYB 1ZLAD 5JA4A 4UUZA 3MGSC 4YS3D 4J8XC 3C1CA 4KUDB 4WU8D 2AROA 1BH9A 3W96A 4E44A 5B2JC 1P3KC 1ID3A 4WJ3C 1JFIB 3NQUA 1AOIA 5AY8D 4WNNB 3KUYD 4J8WD 5B31C 4NE5A 1P3GD 1KX4C 3W98B 5E5AD 2G5HC 2F8NH 5CHLB 1HQ3D 3A6NB 3AV1A 3AZLC 5JA4B 3KWQC 1P3FD 2JSSA 4UUZB 3VH6W 3C1CB 2AROB 3AZMC 1BH9B 3W96B 3P5JB 1ID3B 4NE3A 1KX5A 3NQUB 3LELA 3X1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I C;  3WTP E;  1WWS A;  3AV1 B;  5DNM A;  3UTA D;  5CPJ A;  5B2I A;  3AYW C;  3O62 C;  4XZQ C;  4H9R A;  3B6G C;  4EO5 B;  1EQZ A;  5AV5 D;  4R8P C;  1F66 A;  3WA9 C;  1KX5 B;  3X1S A;  3LEL B;  3X1V B;  5AV6 A;  3UT9 B;  3AZJ C;  1P3P C;  5DNM B;  5AVB D;  2HIO A;  5CPJ B;  1KX3 C;  4HGA C;  5B2I B;  2IO5 C;  3AZN C;  3LZ0 D;  3MVD A;  4H9R B;  1P34 A;  1M18 A;  1P3O D;  1EQZ B;  1F66 B;  4Z2M H;  3REI C;  4X23 D;  4H9Q A;  3W97 C;  3X1S B;  5AV6 B;  4J8U C;  1TZY D;  3UT9 C;  2L5A A;  2F8N A;  5AV9 A;  3WTP C;  2HIO B;  1M1A C;  1M19 D;  2F8N G;  3KXB C;  3AFA D;  3REK A;  5CP6 D;  5DNN D;  3MVD B;  5CPI D;  1P3B D;  1P34 B;  1M18 B;  1P3M C;  5GT3 D;  5B1M C;  4H9Q B;  3B6F A;  2PYO A;  3WAA D;  2NQB A;  3AZK C;  2F8N B;  5B1L A;  1TAF A;  5AV9 B;  5AV8 C;  3MGR A;  3REK B;  3MVD C;  4M6B A;  1S32 A;  3TU4 D;  1M18 C;  3REL C;  5B40 D;  4G92 B;  5G49 A;  5B0Y C;  4J8V A;  3W99 A;  3B6F B;  2PYO B;  2NQB B;  5B1L B;  1TAF B;  5JRG D;  4JJN C;  4WV4 B;  3MGS A;  3VH6 A;  2HUE C;  3AZF D;  3MGR B;  4J8X A;  4ZUX D;  1P3K A;  2CV5 D;  1S32 B;  5BNX A;  1WWI A;  1U35 D;  5G49 B;  5B31 A;  4J8V B;  2FJ7 C;  3W99 B;  4KUD D;  4Z2M G;  5B31 G;  1P3L D;  3AZL A;  3MGQ D;  3KWQ A;  3X1U C;  5BT1 D;  3MGS B;  3W98 D;  4J8X B;  3AZM A;  3REH D;  1P3K B;  3UTB C;  4H9N A;  1S32 C;  5BNX B;  4X23 C;  1P3I A;  4YM6 C;  3LZ1 A;  1KU5 A;  5B31 B;  3AZG C;  3W99 C;  3C1C D;  2ARO D;  3MNN C;  3W96 D;  3AZL B;  5B0Z C;  1ID3 D;  4G91 C;  3KWQ B;  5B24 A;  1AOI D;  3VH5 T;  3AYW A;  3O62 A;  4XZQ A;  3B6G A;  5CPK D;  4Z66 D;  4NFT A;  3AZM B;  4R8P A;  4H9N B;  3WA9 A;  3B0C W;  3LZ1 B;  1P3I B;  1AOI B;  3AZJ A;  5B33 C;  4XUJ C;  1P3P A;  4E45 A;  5FUG A;  1KX3 A;  3C1B C;  1KX5 D;  5B24 B;  3LEL D;  3X1V D;  3AYW B;  3AZN A;  3O62 B;  4XZQ B;  4KGC C;  3B6G B;  3AV2 C;  1P3A C;  5DNM D;  3TU4 C;  1ULY A;  5CPJ D;  5B32 B;  4R8P B;  4LD9 D;  3REI A;  3WA9 B;  3W97 A;  5B2I D;  3AZE D;  4J8U A;  1B6W A;  3LZ1 C;  3AZJ B;  3UT9 A;  3AN2 C;  1P3P B;  3REJ C;  5FUG B;  1EQZ D;  3WTP A;  1M1A A;  1KX3 B;  4QLC D;  5KDM B;  3X1T C;  1F66 D;  4HGA B;  4DRB A;  3NQJ A;  3KXB A;  3X1S D;  5B24 C;  2IO5 B;  5AV6 D;  3AZN B;  1P3M A;  5B32 C;  1Q9C A;  1U35 C;  3REI B;  5B1M A;  3WKJ C;  3W97 B;  4J8U B;  5GT0 C;  1P34 D;  3AZK A;  3MGQ C;  3WTP B;  3AZH C;  5AV8 A;  4WU9 D;  1M1A B;  3KXB B;  3NQJ B;  4Z5T C;  2F8N K;  3MGP C;  5GSU C;  2F8N D;  1P3M B;  3REL A;  5AV9 D;  5GXQ C;  4DRA A;  5F99 C;  5B1M B;  5B0Y A;  5AVC D;  3REK D;  3AZK B;  4JJN A;  1ZLA C;  3B0B A;  5AV8 B;  3LJA D;  4YS3 C;  5CPK C;  4WU8 C;  3B0D C;  3B6F D;  2PYO D;  2BYM A;  2NQB D;  5B1L D;  3REL B;  3AZI D;  5C3I C;  5B0Y B;  5AY8 C;  3KUY C;  2YFV A;  4J8W C;  2FJ7 A;  1P3G C;  5E5A C;  1HQ3 C;  4JJN B;  1P3F C;  3X1U A;  3VH6 T;  2HUE B;  4H9P A;  3UTB A;  2BYM B;  4X23 A;  3AZE C;  4YM6 A;  3MGS D;  3AZG A;  2FJ7 B;  2YFV B;  4J8X D;  2YFW A;  2NZD D;  3MNN A;  5B2J D;  1P3K D;  5B0Z A;  3UTA C;  3X1U B;  5B31 D;  1KX4 D;  1R4V A;  4H9P B;  3AZL D;  4ZBJ C;  5AV5 C;  3UTB B;  4X23 B;  1H3O A;  4YM6 B;  5B33 A;  4XUJ A;  3AZG B;  4WZS B;  3AZM D;  2YFW B;  3MNN B;  5AVB C;  5B0Z B;  4WU9 C;  4G91 B;  3C1B A;  1HTA A;  5CP6 B;  4KGC A;  3LZ0 C;  3AV2 A;  1P3A A;  3TU4 A;  3A6N D;  1P3O C;  2CWE A;  1H3O B;  3O62 D;  4XZQ D;  5B33 B;  4AWL C;  3AN2 A;  4XUJ B;  3B6G D;  1TZY C;  3REJ A;  3X1T A;  3C1B B;  1M19 C;  3WA9 D;  3AFA C;  3LJA C;  5CP6 C;  5DNN C;  3AZJ D;  4KGC B;  3AV2 B;  5CPI C;  1P3P D;  1P3B C;  1P3A B;  4H9O A;  3TU4 B;  3AV1 D;  5B32 A;  1KX3 D;  1U35 A;  3WKJ A;  5GT3 C;  5B32 G;  3AZN D;  3AN2 B;  5GT0 A;  1P3L A;  3REJ B;  3WAA C;  3MGQ A;  3AZH A;  5KDM A;  3X1T B;  3REI D;  3W97 D;  4Z5T A;  4J8U D;  3REH A;  3UT9 D;  3MGP A;  5GSU A;  4H9O B;  3WTP D;  5GXQ A;  1M1A D;  1U35 B;  5F99 A;  3KXB D;  5B40 C;  3WKJ B;  2NZD C;  5GT0 B;  1P3L B;  3MGQ B;  1P3M D;  1ZLA A;  3AZH B;  5JRG C;  5B1M D;  4Z5T B;  4YS3 A;  5CPK A;  3AZF C;  4Z66 A;  4WU8 A;  4ZUX C;  3REH B;  3MGP B;  5GSU B;  3AZK D;  2CV5 C;  5GXQ B;  5AV8 D;  2HIO D;  3VH5 A;  5F99 B;  5AY8 A;  3KUY A;  4J8W A;  1P3G A;  5E5A A;  4KUD C;  1HQ3 A;  3MVD D;  1BH8 A;  1P3L C;  1M18 D;  3REL D;  1P3F A;  1ZLA B;  5BT1 C;  5B0Y D;  4YS3 B;  3W98 C;  2LY8 A;  2RVQ D;  5CPK B;  4Z66 B;  4H9S C;  4WU8 B;  3B0D B;  5BS7 C;  3A6N C;  3REH C;  4LD9 A;  4JJN D;  3AZE A;  5C3I B;  5AY8 B;  3KUY B;  4J8W B;  1A7W A;  1P3G B;  5E5A B;  3C1C C;  2ARO C;  1HQ3 B;  1BH8 B;  3UTA A;  3W96 C;  4QLC A;  1ID3 C;  1P3F B;  1AOI C;  5BNV A;  2FJ7 D;  4Z66 C;  2BYK A;  3AV1 C;  5AV5 A;  1N1J A;  4LD9 B;  3B0C T;  3X1U D;  3AZE B;  3MGR D;  4EO5 C;  5AVB A;  3UTB D;  3UTA B;  4WU9 A;  4QLC B;  1S32 D;  1B67 A;  1KX5 C;  4YM6 D;  3X1V C;  3LEL C;  5BNV B;  3LZ0 A;  3AZG D;  3W99 D;  4J8V D;  3MNN D;  2BYK B;  1P3O A;  5DNM C;  4ZBJ B;  5B0Z D;  1N1J B;  5AV5 B;  5CPJ C;  4LD9 C;  1F1E A;  4NE6 A;  5B2I C;  3KSY A;  5AVC A;  3V9R A;  3VH5 W;  1TZY A;  1EQZ C;  5AVB B;  4WU9 B;  1M19 A;  4QLC C;  1F66 C;  3AFA A;  3LJA A;  3X1S C;  5CP6 A;  5DNN A;  5B33 D;  5AV6 C;  3LZ0 B;  4XUJ D;  5CPI A;  1P3B A;  1P3O B;  3AZI A;  2HIO C;  3C1B D;  3KWQ D;  5GT3 A;  5AVC B;  4KHA A;  4AWL B;  3V9R B;  4KGC D;  1TZY B;  3AV2 D;  3WAA A;  1P34 C;  1P3A D;  3R45 A;  1M19 B;  3AFA B;  3LJA B;  2RVQ C;  1P3I D;  3LZ1 D;  5DNN B;  3AN2 D;  5CPI B;  3REJ D;  1P3B B;  1BFM A;  3AZI B;  5AV9 C;  3X1T D;  5B40 A;  5GT3 B;  5B24 D;  5BO0 A;  5AVC C;  3REK C;  3AYW D;  4KHA B;  2NZD A;  5B2J A;  3WAA B;  3R45 B;  4CSR A;  5JRG A;  5B32 D;  4R8P D;  3WKJ D;  1KX4 A;  4G92 C;  3AZF A;  4ZUX A;  5GT0 D;  3B6F C;  2CV5 A;  2PYO C;  4CAY A;  2NQB C;  3AZH D;  5B1L C;  3AZI C;  5B40 B;  4Z5T D;  5BO0 B;  3MGR C;  4KUD A;  2NZD B;  5B2J B;  3MGP D;  5GSU D;  4CSR B;  1JFI A;  5JRG B;  5GXQ D;  5F99 D;  3W98 A;  4WNN A;  1KX4 B;  4J8V C;  3AZF B;  4H9S A;  4ZUX B;  5BS7 A;  3A6N A;  2CV5 B;  4CAY B;  1ZLA D;  5JA4 A;  4UUZ A;  3MGS C;  4YS3 D;  4J8X C;  3C1C A;  4KUD B;  4WU8 D;  2ARO A;  1BH9 A;  3W96 A;  4E44 A;  5B2J C;  1P3K C;  1ID3 A;  1JFI B;  3NQU A;  1AOI A;  5AY8 D;  4WNN B;  3KUY D;  4J8W D;  4NE5 A;  5B31 C;  1P3G D;  1KX4 C;  3W98 B;  5E5A D;  2F8N H;  5CHL B;  1HQ3 D;  3A6N B;  3AV1 A;  3AZL C;  5JA4 B;  3KWQ C;  1P3F D;  2JSS A;  4UUZ B;  3VH6 W;  3C1C B;  2ARO B;  3AZM C;  1BH9 B;  3W96 B;  1ID3 B;  4NE3 A;  1KX5 A;  3NQU B;  3LEL A;  3X1V A; 
#chains in the Genus database with same CATH topology
 1P3I C;  3WTP E;  1WWS A;  3AV1 B;  5DNM A;  2Y2L A;  3UTA D;  5CPJ A;  2Y2P A;  5B2I A;  3AYW C;  3O62 C;  4XZQ C;  4H9R A;  3B6G C;  4EO5 B;  1EQZ A;  5AV5 D;  4R8P C;  1F66 A;  3WA9 C;  1KX5 B;  3X1S A;  3LEL B;  3X1V B;  1T3U A;  5AV6 A;  3UT9 B;  3AZJ C;  1P3P C;  3EPJ A;  5AVB D;  5DNM B;  2HIO A;  5CPJ B;  2RIQ A;  1KX3 C;  4HGA C;  5B2I B;  2IO5 C;  3AZN C;  3LZ0 D;  3MVD A;  4H9R B;  3H0R C;  1P34 A;  1M18 A;  1P3O D;  1EQZ B;  1F66 B;  4Z2M H;  3REI C;  4X23 D;  4H9Q A;  3W97 C;  3X1S B;  5AV6 B;  4J8U C;  1TZY D;  3UT9 C;  2L5A A;  2F8N A;  5AV9 A;  3WTP C;  2HIO B;  1M1A C;  1M19 D;  2F8N G;  3KXB C;  3AFA D;  3REK A;  5CP6 D;  5DNN D;  3MVD B;  5CPI D;  1P3B D;  1P34 B;  1M18 B;  1P3M C;  5GT3 D;  5B1M C;  4H9Q B;  2F2A C;  2J8P A;  4DQY B;  3IP4 C;  2PYO A;  3B6F A;  3WAA D;  2NQB A;  3AZK C;  2F8N B;  5B1L A;  1TAF A;  5AV9 B;  5AV8 C;  2FFF B;  3MGR A;  3REK B;  3MVD C;  4M6B A;  1S32 A;  3TU4 D;  1M18 C;  3REL C;  2Y2O A;  5B40 D;  4G92 B;  5G49 A;  5B0Y C;  4J8V A;  3W99 A;  3B6F B;  2PYO B;  2NQB B;  5JRG D;  1TAF B;  5B1L B;  4JJN C;  2Y2I A;  4WV4 B;  3MGS A;  3VH6 A;  2HUE C;  3AZF D;  3MGR B;  4J8X A;  4ZUX D;  1P3K A;  2CV5 D;  1S32 B;  5BNX A;  1WWI A;  1U35 D;  5G49 B;  5B31 A;  2BG1 A;  4J8V B;  2FJ7 C;  3W99 B;  4KUD D;  4Z2M G;  5B31 G;  1P3L D;  3AZL A;  3MGQ D;  3KWQ A;  3X1U C;  5BT1 D;  3MGS B;  3W98 D;  4J8X B;  3AZM A;  3REH D;  1P3K B;  3UTB C;  4H9N A;  1S32 C;  5BNX B;  4X23 C;  2JE5 A;  1P3I A;  4YM6 C;  3LZ1 A;  1KU5 A;  5B31 B;  3AZG C;  3W99 C;  3C1C D;  2ARO D;  3MNN C;  3W96 D;  3AZL B;  5B0Z C;  1ID3 D;  4G91 C;  3KWQ B;  5B24 A;  1AOI D;  3VH5 T;  3AYW A;  3O62 A;  4XZQ A;  3B6G A;  5CPK D;  4Z66 D;  4NFT A;  3F6T A;  3AZM B;  1Z2C B;  4R8P A;  4H9N B;  3WA9 A;  3B0C W;  3LZ1 B;  1P3I B;  1AOI B;  3AZJ A;  5B33 C;  4XUJ C;  1P3P A;  4E45 A;  5FUG A;  1KX3 A;  3C1B C;  1KX5 D;  5B24 B;  3LEL D;  3X1V D;  3AYW B;  3AZN A;  3O62 B;  4XZQ B;  4KGC C;  3B6G B;  3AV2 C;  1P3A C;  5DNM D;  3TU4 C;  1ULY A;  5CPJ D;  5B32 B;  4R8P B;  4LD9 D;  3REI A;  3WA9 B;  3W97 A;  5B2I D;  3AZE D;  2VQR A;  4J8U A;  1B6W A;  3LZ1 C;  3AZJ B;  3UT9 A;  3AN2 C;  1P3P B;  3REJ C;  5FUG B;  1EQZ D;  3WTP A;  1M1A A;  1KX3 B;  4QLC D;  5KDM B;  3X1T C;  1F66 D;  4HGA B;  4DRB A;  3NQJ A;  3KXB A;  3X1S D;  5B24 C;  2IO5 B;  2ZY3 A;  5AV6 D;  3AZN B;  1P3M A;  5B32 C;  1Q9C A;  1U35 C;  3REI B;  5B1M A;  3WKJ C;  3W97 B;  4J8U B;  5GT0 C;  1P34 D;  3AZK A;  3MGQ C;  3WTP B;  3AZH C;  5AV8 A;  4WU9 D;  1M1A B;  3KXB B;  3NQJ B;  4Z5T C;  2XD1 A;  2F8N K;  3MGP C;  5GSU C;  2F8N D;  1P3M B;  3REL A;  5AV9 D;  5GXQ C;  4DRA A;  5F99 C;  5B1M B;  5B0Y A;  5AVC D;  3REK D;  2ZY2 A;  3FDD A;  3AZK B;  4JJN A;  1ZLA C;  3B0B A;  5AV8 B;  3LJA D;  4YS3 C;  5CPK C;  4WU8 C;  2Y2N A;  3B0D C;  3B6F D;  2PYO D;  2BYM A;  2NQB D;  5B1L D;  3REL B;  3AZI D;  5C3I C;  5B0Y B;  5AY8 C;  3KUY C;  2YFV A;  4J8W C;  2FJ7 A;  1P3G C;  5E5A C;  1HQ3 C;  4JJN B;  1P3F C;  3X1U A;  2ZY4 A;  3VH6 T;  2HUE B;  2Y2Q A;  4H9P A;  3UTB A;  2BYM B;  4X23 A;  3AZE C;  4YM6 A;  3MGS D;  3AZG A;  2FJ7 B;  2YFV B;  4J8X D;  2YFW A;  2NZD D;  3MNN A;  5B2J D;  1P3K D;  5B0Z A;  3UTA C;  3X1U B;  2Y2J A;  5B31 D;  1KX4 D;  1R4V A;  4H9P B;  3AZL D;  4ZBJ C;  5AV5 C;  3UTB B;  4X23 B;  1H3O A;  4YM6 B;  5B33 A;  4XUJ A;  3AZG B;  4WZS B;  3AZM D;  2YFW B;  2Y2H A;  3MNN B;  5AVB C;  5B0Z B;  4WU9 C;  4G91 B;  3C1B A;  1HTA A;  5CP6 B;  4KGC A;  3LZ0 C;  3AV2 A;  1P3A A;  3TU4 A;  3A6N D;  1P3O C;  2CWE A;  1H3O B;  3O62 D;  4XZQ D;  5B33 B;  4AWL C;  3AN2 A;  4XUJ B;  3B6G D;  1TZY C;  3REJ A;  3X1T A;  3H0L C;  3C1B B;  1M19 C;  3WA9 D;  3AFA C;  3LJA C;  5CP6 C;  5DNN C;  3AZJ D;  4KGC B;  3AV2 B;  5CPI C;  1P3P D;  1P3B C;  1P3A B;  4H9O A;  3TU4 B;  3AV1 D;  5B32 A;  1KX3 D;  1U35 A;  3WKJ A;  5GT3 C;  5B32 G;  3AZN D;  3AN2 B;  5GT0 A;  1P3L A;  3REJ B;  3WAA C;  3MGQ A;  3AZH A;  5KDM A;  3X1T B;  3REI D;  3W97 D;  4Z5T A;  2DQN C;  4J8U D;  2JCH A;  3REH A;  3UT9 D;  3MGP A;  5GSU A;  4H9O B;  3WTP D;  5GXQ A;  2DF4 C;  1M1A D;  1U35 B;  5F99 A;  3KXB D;  5B40 C;  3WKJ B;  3EPH A;  1W2E A;  2NZD C;  5GT0 B;  1P3L B;  3MGQ B;  1P3M D;  1ZLA A;  3AZH B;  5JRG C;  2XD5 A;  5B1M D;  4Z5T B;  4YS3 A;  5CPK A;  3AZF C;  4Z66 A;  4WU8 A;  4ZUX C;  3REH B;  3MGP B;  5GSU B;  3AZK D;  2CV5 C;  5GXQ B;  5AV8 D;  2HIO D;  3VH5 A;  5F99 B;  5AY8 A;  3KUY A;  4J8W A;  1P3G A;  5E5A A;  4KUD C;  1HQ3 A;  3MVD D;  1BH8 A;  1P3L C;  1M18 D;  3REL D;  1P3F A;  1ZLA B;  5BT1 C;  5B0Y D;  4YS3 B;  3W98 C;  2LY8 A;  2RVQ D;  5CPK B;  4Z66 B;  3EPL A;  4H9S C;  4WU8 B;  3B0D B;  5BS7 C;  3A6N C;  3REH C;  4LD9 A;  4JJN D;  3AZE A;  5C3I B;  2G5I C;  5AY8 B;  3KUY B;  4J8W B;  1A7W A;  1P3G B;  5E5A B;  3C1C C;  2ARO C;  1HQ3 B;  1BH8 B;  3UTA A;  3W96 C;  4QLC A;  1ID3 C;  1P3F B;  1AOI C;  3H0M C;  5BNV A;  2FJ7 D;  2W8S A;  4Z66 C;  2BYK A;  3AV1 C;  5AV5 A;  1N1J A;  4LD9 B;  3B0C T;  3X1U D;  3AZE B;  3MGR D;  4EO5 C;  4UPK A;  5AVB A;  3UTB D;  3UTA B;  4WU9 A;  4QLC B;  1S32 D;  1B67 A;  1KX5 C;  3A1K A;  4YM6 D;  3X1V C;  3LEL C;  5BNV B;  3LZ0 A;  3AZG D;  1PZR A;  3W99 D;  4J8V D;  3MNN D;  2BYK B;  3EG5 B;  5DNM C;  4ZBJ B;  5B0Z D;  1N1J B;  5AV5 B;  5CPJ C;  1P3O A;  4LD9 C;  1F1E A;  4NE6 A;  5B2I C;  3KSY A;  5AVC A;  3V9R A;  3VH5 W;  1TZY A;  1EQZ C;  5AVB B;  4WU9 B;  1M19 A;  2Y2M A;  4QLC C;  1F66 C;  3AFA A;  3LJA A;  3X1S C;  5CP6 A;  5DNN A;  5B33 D;  5AV6 C;  3LZ0 B;  4XUJ D;  5CPI A;  1P3B A;  2ZY5 A;  1P3O B;  3AZI A;  2HIO C;  3C1B D;  3KWQ D;  5GT3 A;  5AVC B;  4KHA A;  4AWL B;  3V9R B;  4KGC D;  1TZY B;  2Y2G A;  3AV2 D;  3WAA A;  1P34 C;  1P3A D;  3R45 A;  2Y2K A;  3KFU G;  3A1I A;  1M19 B;  3AFA B;  3LJA B;  2RVQ C;  1P3I D;  3LZ1 D;  5DNN B;  3AN2 D;  5CPI B;  3REJ D;  1P3B B;  1BFM A;  3AZI B;  5AV9 C;  3X1T D;  5B40 A;  5GT3 B;  5B24 D;  5BO0 A;  5AVC C;  3REK C;  3AYW D;  4KHA B;  2NZD A;  3AL0 C;  5B2J A;  3WAA B;  3R45 B;  4CSR A;  5JRG A;  5B32 D;  4R8P D;  3WKJ D;  2UWX A;  1KX4 A;  4G92 C;  3AZF A;  4ZUX A;  5GT0 D;  3B6F C;  2CV5 A;  2PYO C;  4CAY A;  2NQB C;  3AZH D;  5B1L C;  3AZI C;  5B40 B;  4Z5T D;  5BO0 B;  3MGR C;  4KUD A;  2NZD B;  5B2J B;  3MGP D;  5GSU D;  3EPK A;  4CSR B;  2ZM5 A;  1JFI A;  5JRG B;  5GXQ D;  5F99 D;  3W98 A;  4WNN A;  1KX4 B;  4J8V C;  3AZF B;  4H9S A;  4ZUX B;  5BS7 A;  3A6N A;  2CV5 B;  4CAY B;  1ZLA D;  5JA4 A;  4UUZ A;  3MGS C;  4YS3 D;  4J8X C;  3C1C A;  4KUD B;  4WU8 D;  2ARO A;  1BH9 A;  3W96 A;  4E44 A;  5B2J C;  1P3K C;  1ID3 A;  4WJ3 C;  1JFI B;  3NQU A;  1AOI A;  5AY8 D;  4WNN B;  3KUY D;  4J8W D;  5B31 C;  4NE5 A;  1P3G D;  1KX4 C;  3W98 B;  5E5A D;  2G5H C;  2F8N H;  5CHL B;  1HQ3 D;  3A6N B;  3AV1 A;  3AZL C;  5JA4 B;  3KWQ C;  1P3F D;  2JSS A;  4UUZ B;  3VH6 W;  3C1C B;  2ARO B;  3AZM C;  1BH9 B;  3W96 B;  3P5J B;  1ID3 B;  4NE3 A;  1KX5 A;  3NQU B;  3LEL A;  3X1V A; 
#chains in the Genus database with same CATH homology
 1P3I C;  3WTP E;  1WWS A;  3AV1 B;  5DNM A;  2Y2L A;  3UTA D;  5CPJ A;  2Y2P A;  5B2I A;  3AYW C;  3O62 C;  4XZQ C;  4H9R A;  3B6G C;  4EO5 B;  1EQZ A;  5AV5 D;  4R8P C;  1F66 A;  3WA9 C;  1KX5 B;  3X1S A;  3LEL B;  3X1V B;  1T3U A;  5AV6 A;  3UT9 B;  3AZJ C;  1P3P C;  3EPJ A;  5AVB D;  5DNM B;  2HIO A;  5CPJ B;  2RIQ A;  1KX3 C;  4HGA C;  5B2I B;  2IO5 C;  3AZN C;  3LZ0 D;  3MVD A;  4H9R B;  3H0R C;  1P34 A;  1M18 A;  1P3O D;  1EQZ B;  1F66 B;  4Z2M H;  3REI C;  4X23 D;  4H9Q A;  3W97 C;  3X1S B;  5AV6 B;  4J8U C;  1TZY D;  3UT9 C;  2L5A A;  2F8N A;  5AV9 A;  3WTP C;  2HIO B;  1M1A C;  1M19 D;  2F8N G;  3KXB C;  3AFA D;  3REK A;  5CP6 D;  5DNN D;  3MVD B;  5CPI D;  1P3B D;  1P34 B;  1M18 B;  1P3M C;  5GT3 D;  5B1M C;  4H9Q B;  2F2A C;  2J8P A;  4DQY B;  3IP4 C;  2PYO A;  3B6F A;  3WAA D;  2NQB A;  3AZK C;  2F8N B;  5B1L A;  1TAF A;  5AV9 B;  5AV8 C;  2FFF B;  3MGR A;  3REK B;  3MVD C;  4M6B A;  1S32 A;  3TU4 D;  1M18 C;  3REL C;  2Y2O A;  5B40 D;  4G92 B;  5G49 A;  5B0Y C;  4J8V A;  3W99 A;  3B6F B;  2PYO B;  2NQB B;  5JRG D;  1TAF B;  5B1L B;  4JJN C;  2Y2I A;  4WV4 B;  3MGS A;  3VH6 A;  2HUE C;  3AZF D;  3MGR B;  4J8X A;  4ZUX D;  1P3K A;  2CV5 D;  1S32 B;  5BNX A;  1WWI A;  1U35 D;  5G49 B;  5B31 A;  2BG1 A;  4J8V B;  2FJ7 C;  3W99 B;  4KUD D;  4Z2M G;  5B31 G;  1P3L D;  3AZL A;  3MGQ D;  3KWQ A;  3X1U C;  5BT1 D;  3MGS B;  3W98 D;  4J8X B;  3AZM A;  3REH D;  1P3K B;  3UTB C;  4H9N A;  1S32 C;  5BNX B;  4X23 C;  2JE5 A;  1P3I A;  4YM6 C;  3LZ1 A;  1KU5 A;  5B31 B;  3AZG C;  3W99 C;  3C1C D;  2ARO D;  3MNN C;  3W96 D;  3AZL B;  5B0Z C;  1ID3 D;  4G91 C;  3KWQ B;  5B24 A;  1AOI D;  3VH5 T;  3AYW A;  3O62 A;  4XZQ A;  3B6G A;  5CPK D;  4Z66 D;  4NFT A;  3F6T A;  3AZM B;  1Z2C B;  4R8P A;  4H9N B;  3WA9 A;  3B0C W;  3LZ1 B;  1P3I B;  1AOI B;  3AZJ A;  5B33 C;  4XUJ C;  1P3P A;  4E45 A;  5FUG A;  1KX3 A;  3C1B C;  1KX5 D;  5B24 B;  3LEL D;  3X1V D;  3AYW B;  3AZN A;  3O62 B;  4XZQ B;  4KGC C;  3B6G B;  3AV2 C;  1P3A C;  5DNM D;  3TU4 C;  1ULY A;  5CPJ D;  5B32 B;  4R8P B;  4LD9 D;  3REI A;  3WA9 B;  3W97 A;  5B2I D;  3AZE D;  2VQR A;  4J8U A;  1B6W A;  3LZ1 C;  3AZJ B;  3UT9 A;  3AN2 C;  1P3P B;  3REJ C;  5FUG B;  1EQZ D;  3WTP A;  1M1A A;  1KX3 B;  4QLC D;  5KDM B;  3X1T C;  1F66 D;  4HGA B;  4DRB A;  3NQJ A;  3KXB A;  3X1S D;  5B24 C;  2IO5 B;  2ZY3 A;  5AV6 D;  3AZN B;  1P3M A;  5B32 C;  1Q9C A;  1U35 C;  3REI B;  5B1M A;  3WKJ C;  3W97 B;  4J8U B;  5GT0 C;  1P34 D;  3AZK A;  3MGQ C;  3WTP B;  3AZH C;  5AV8 A;  4WU9 D;  1M1A B;  3KXB B;  3NQJ B;  4Z5T C;  2XD1 A;  2F8N K;  3MGP C;  5GSU C;  2F8N D;  1P3M B;  3REL A;  5AV9 D;  5GXQ C;  4DRA A;  5F99 C;  5B1M B;  5B0Y A;  5AVC D;  3REK D;  2ZY2 A;  3FDD A;  3AZK B;  4JJN A;  1ZLA C;  3B0B A;  5AV8 B;  3LJA D;  4YS3 C;  5CPK C;  4WU8 C;  2Y2N A;  3B0D C;  3B6F D;  2PYO D;  2BYM A;  2NQB D;  5B1L D;  3REL B;  3AZI D;  5C3I C;  5B0Y B;  5AY8 C;  3KUY C;  2YFV A;  4J8W C;  2FJ7 A;  1P3G C;  5E5A C;  1HQ3 C;  4JJN B;  1P3F C;  3X1U A;  2ZY4 A;  3VH6 T;  2HUE B;  2Y2Q A;  4H9P A;  3UTB A;  2BYM B;  4X23 A;  3AZE C;  4YM6 A;  3MGS D;  3AZG A;  2FJ7 B;  2YFV B;  4J8X D;  2YFW A;  2NZD D;  3MNN A;  5B2J D;  1P3K D;  5B0Z A;  3UTA C;  3X1U B;  2Y2J A;  5B31 D;  1KX4 D;  1R4V A;  4H9P B;  3AZL D;  4ZBJ C;  5AV5 C;  3UTB B;  4X23 B;  1H3O A;  4YM6 B;  5B33 A;  4XUJ A;  3AZG B;  4WZS B;  3AZM D;  2YFW B;  2Y2H A;  3MNN B;  5AVB C;  5B0Z B;  4WU9 C;  4G91 B;  3C1B A;  1HTA A;  5CP6 B;  4KGC A;  3LZ0 C;  3AV2 A;  1P3A A;  3TU4 A;  3A6N D;  1P3O C;  2CWE A;  1H3O B;  3O62 D;  4XZQ D;  5B33 B;  4AWL C;  3AN2 A;  4XUJ B;  3B6G D;  1TZY C;  3REJ A;  3X1T A;  3H0L C;  3C1B B;  1M19 C;  3WA9 D;  3AFA C;  3LJA C;  5CP6 C;  5DNN C;  3AZJ D;  4KGC B;  3AV2 B;  5CPI C;  1P3P D;  1P3B C;  1P3A B;  4H9O A;  3TU4 B;  3AV1 D;  5B32 A;  1KX3 D;  1U35 A;  3WKJ A;  5GT3 C;  5B32 G;  3AZN D;  3AN2 B;  5GT0 A;  1P3L A;  3REJ B;  3WAA C;  3MGQ A;  3AZH A;  5KDM A;  3X1T B;  3REI D;  3W97 D;  4Z5T A;  2DQN C;  4J8U D;  2JCH A;  3REH A;  3UT9 D;  3MGP A;  5GSU A;  4H9O B;  3WTP D;  5GXQ A;  2DF4 C;  1M1A D;  1U35 B;  5F99 A;  3KXB D;  5B40 C;  3WKJ B;  3EPH A;  1W2E A;  2NZD C;  5GT0 B;  1P3L B;  3MGQ B;  1P3M D;  1ZLA A;  3AZH B;  5JRG C;  2XD5 A;  5B1M D;  4Z5T B;  4YS3 A;  5CPK A;  3AZF C;  4Z66 A;  4WU8 A;  4ZUX C;  3REH B;  3MGP B;  5GSU B;  3AZK D;  2CV5 C;  5GXQ B;  5AV8 D;  2HIO D;  3VH5 A;  5F99 B;  5AY8 A;  3KUY A;  4J8W A;  1P3G A;  5E5A A;  4KUD C;  1HQ3 A;  3MVD D;  1BH8 A;  1P3L C;  1M18 D;  3REL D;  1P3F A;  1ZLA B;  5BT1 C;  5B0Y D;  4YS3 B;  3W98 C;  2LY8 A;  2RVQ D;  5CPK B;  4Z66 B;  3EPL A;  4H9S C;  4WU8 B;  3B0D B;  5BS7 C;  3A6N C;  3REH C;  4LD9 A;  4JJN D;  3AZE A;  5C3I B;  2G5I C;  5AY8 B;  3KUY B;  4J8W B;  1A7W A;  1P3G B;  5E5A B;  3C1C C;  2ARO C;  1HQ3 B;  1BH8 B;  3UTA A;  3W96 C;  4QLC A;  1ID3 C;  1P3F B;  1AOI C;  3H0M C;  5BNV A;  2FJ7 D;  2W8S A;  4Z66 C;  2BYK A;  3AV1 C;  5AV5 A;  1N1J A;  4LD9 B;  3B0C T;  3X1U D;  3AZE B;  3MGR D;  4EO5 C;  4UPK A;  5AVB A;  3UTB D;  3UTA B;  4WU9 A;  4QLC B;  1S32 D;  1B67 A;  1KX5 C;  3A1K A;  4YM6 D;  3X1V C;  3LEL C;  5BNV B;  3LZ0 A;  3AZG D;  1PZR A;  3W99 D;  4J8V D;  3MNN D;  2BYK B;  3EG5 B;  5DNM C;  4ZBJ B;  5B0Z D;  1N1J B;  5AV5 B;  5CPJ C;  1P3O A;  4LD9 C;  1F1E A;  4NE6 A;  5B2I C;  3KSY A;  5AVC A;  3V9R A;  3VH5 W;  1TZY A;  1EQZ C;  5AVB B;  4WU9 B;  1M19 A;  2Y2M A;  4QLC C;  1F66 C;  3AFA A;  3LJA A;  3X1S C;  5CP6 A;  5DNN A;  5B33 D;  5AV6 C;  3LZ0 B;  4XUJ D;  5CPI A;  1P3B A;  2ZY5 A;  1P3O B;  3AZI A;  2HIO C;  3C1B D;  3KWQ D;  5GT3 A;  5AVC B;  4KHA A;  4AWL B;  3V9R B;  4KGC D;  1TZY B;  2Y2G A;  3AV2 D;  3WAA A;  1P34 C;  1P3A D;  3R45 A;  2Y2K A;  3KFU G;  3A1I A;  1M19 B;  3AFA B;  3LJA B;  2RVQ C;  1P3I D;  3LZ1 D;  5DNN B;  3AN2 D;  5CPI B;  3REJ D;  1P3B B;  1BFM A;  3AZI B;  5AV9 C;  3X1T D;  5B40 A;  5GT3 B;  5B24 D;  5BO0 A;  5AVC C;  3REK C;  3AYW D;  4KHA B;  2NZD A;  3AL0 C;  5B2J A;  3WAA B;  3R45 B;  4CSR A;  5JRG A;  5B32 D;  4R8P D;  3WKJ D;  2UWX A;  1KX4 A;  4G92 C;  3AZF A;  4ZUX A;  5GT0 D;  3B6F C;  2CV5 A;  2PYO C;  4CAY A;  2NQB C;  3AZH D;  5B1L C;  3AZI C;  5B40 B;  4Z5T D;  5BO0 B;  3MGR C;  4KUD A;  2NZD B;  5B2J B;  3MGP D;  5GSU D;  3EPK A;  4CSR B;  2ZM5 A;  1JFI A;  5JRG B;  5GXQ D;  5F99 D;  3W98 A;  4WNN A;  1KX4 B;  4J8V C;  3AZF B;  4H9S A;  4ZUX B;  5BS7 A;  3A6N A;  2CV5 B;  4CAY B;  1ZLA D;  5JA4 A;  4UUZ A;  3MGS C;  4YS3 D;  4J8X C;  3C1C A;  4KUD B;  4WU8 D;  2ARO A;  1BH9 A;  3W96 A;  4E44 A;  5B2J C;  1P3K C;  1ID3 A;  4WJ3 C;  1JFI B;  3NQU A;  1AOI A;  5AY8 D;  4WNN B;  3KUY D;  4J8W D;  5B31 C;  4NE5 A;  1P3G D;  1KX4 C;  3W98 B;  5E5A D;  2G5H C;  2F8N H;  5CHL B;  1HQ3 D;  3A6N B;  3AV1 A;  3AZL C;  5JA4 B;  3KWQ C;  1P3F D;  2JSS A;  4UUZ B;  3VH6 W;  3C1C B;  2ARO B;  3AZM C;  1BH9 B;  3W96 B;  3P5J B;  1ID3 B;  4NE3 A;  1KX5 A;  3NQU B;  3LEL A;  3X1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...