3AZID

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziD00
5FUGA 1M18D 4Z66C 5AV8B 1TZYB 1S32D 5JRGA 3MGSD 3UTBA 4H9PA 2CV5D 1AOIC 5GSUC 1P3OB 4AWLC 1TAFA 4H9SC 3UT9A 3AZIC 1P3LC 3W98D 1HTAA 3RELC 1KX3D 3LELC 5AVCD 1A7WA 5B33D 5B2ID 3LZ0C 3V9RB 4WU8D 4CSRB 1P3GC 5GXQC 5B1MD 5AV6A 3C1CD 3WTPD 4R8PA 3B6GC 5GT3C 3X1TC 5DNNC 1JFIA 4YM6A 3AV2A 3X1VD 3LZ1A 5AV8C 1P3MB 1TZYC 5AV5D 3NQJB 1P34B 3AZEA 4G91B 4KUDA 5G49A 3VH6T 1BH8B 3AZJB 5FUGB 3AZMD 5B2JD 2PYOC 5JRGB 3AZLA 4ZBJB 1P3OC 3X1SA 4H9OA 3MGPA 4H9PB 1P3FD 3O62D 3AFAA 1TAFB 3W96D 4XZQA 3MGRC 4E45A 4KHAA 1M19A 2HUEB 3UT9B 1P3PD 5AVBA 4YS3D 3WAAA 3REJD 5E5AA 5AV6B 3MGQD 4XUJD 4R8PB 3AZNA 3A6NA 1P3MC 1JFIB 4YM6B 4G91C 3AV2B 3AZKD 5BO0A 4NFTA 3LZ1B 1ID3A 1HQ3A 5JRGC 3AZEB 4KUDB 4ZBJC 5G49B 3AN2A 3UTBC 1BFMA 5F99A 5AY8D 3R45B 1P3KD 3AZLB 3X1SB 4H9OB 3MGPB 1AOID 3MNNA 4ZUXB 4QLCA 3C1BA 3KWQD 3AV1A 3VH6A 3AFAB 3LJAA 3REIA 2HUEC 3UT9C 4XZQB 4X23A 5DNMA 3AZID 1P3LD 4KHAB 3MVDB 3KUYA 3WAAB 3AZGA 3W97A 3UTAD 5AV6C 4R8PC 5GXQD 1U35A 5E5AB 4YM6C 3B6GD 3AV2C 5GT3D 5DNND 4J8WD 3B6FD 1KX4D 3W99A 4Z5TD 3LZ1C 4KGCD 3AZNB 3A6NB 3AZEC 1KU5A 4KUDC 2F8ND 2HIOD 4NE3A 1ID3B 1HQ3B 4WU9A 2RVQC 4UUZA 3AZLC 3X1SC 3MGPC 5CPIA 2F8NG 2BYMB 2PYOD 3AN2B 5F99B 2F8NH 3AFAC 1P3IA 3MNNB 1ZLAD 4QLCB 4XZQC 3C1BB 1P3BA 5B31B 4J8XA 1M19C 4CSRA 3MVDC 3LJAB 3REIB 5CPJA 2NQBD 3MGRD 3WAAC 5AVBC 4X23B 5DNMB 5CPKA 4LD9A 3KUYB 5B32A 4JJND 3AZGB 5E5AC 5B1LB 3NQJA 1P34A 4J8VA 3WKJD 3AZNC 3A6NC 1U35B 3AZJA 2AROA 3VH5T 2JSSA 3REHD 3W99B 5GT0A 1ID3C 3AZHD 5B24D 1HQ3C 5B40A 5CP6A 3AN2C 5F99C 4WU9B 3UTBD 4UUZB 3TU4A 1KX5B 5CPIB 2L5AA 3MNNC 3AZFD 1EQZD 4QLCC 1R4VA 5AV9A 3C1BC 3AV1C 4G92B 1M18A 3LJAC 3REIC 1P3IB 1S32A 3WA9D 2LY8A 5CHLB 4X23C 5DNMC 1P3BB 3REKD 1Q9CA 4J8XB 5CPJB 3KUYC 4H9QA 2CV5A 3AZGC 3W97C 5CPKB 4LD9B 3B0DC 5B32B 5BT1C 1U35C 2IO5B 4R8PD 3W98A 3W99C 4J8VB 1KX3A 5AVCA 2AROB 5B0YD 3R45A 3KXBD 5B2IA 4WU8A 5GT0B 3AZED 2NZDD 4EO5B 5B1MA 5B0ZD 5B40B 3C1CA 4WU9C 5CP6B 1KX5C 4ZUXA 5CPIC 2RVQD 1M1AD 3VH5A 4G92C 5JA4A 4J8UD 3TU4B 1P3IC 1P3AD 3MVDA 5AV9B 1P3BC 4DRBA 2FJ7D 4J8XC 1M18B 3AZMA 5CPJC 5B2JA 1S32B 1M19D 1N1JA 3MGSB 4H9NA 5CPKC 4LD9C 5AVBD 3AYWA 5B32C 4H9QB 2CV5B 2IO5C 3O62A 2CWEA 1P34C 4J8VC 3W96A 3AZJC 2AROC 4YS3A 4M6BA 3W98B 3REJA 5GT0C 4Z66D 4EO5C 1KX3B 5AVCB 5B40C 2BYMA 5B33B 5CP6C 5B2IB 4WU8B 5B1MB 3MGQA 3C1CB 3WTPB 4XUJA 5GSUD 3TU4C 5F99D 3AN2D 3WTPE 5B31A 3B0CW 5AV9C 3AZKA 3MNND 5JA4B 3X1VB 1M18C 3AV1D 1S32C 3RELD 3MGSC 3LELD 3AZMB 5B1LA 5AY8A 5B2JB 1P3KA 2CV5C 3LZ0D 1N1JB 1P3GD 5KDMA 4H9NB 4H9RA 3W97D 3NQUA 3AYWB 3X1TD 1P3FB 3KWQA 3O62B 1WWSA 3W98C 3W96B 5AV8D 1KX3C 1TZYD 5AVCC 1P3PB 4YS3B 5B2IC 3REJB 4WU8C 3UTAA 1KX5A 5B1MC 2YFVB 3C1CC 1P3OD 4ZUXC 4HGAB 5CPID 3MGQB 4XUJB 3B6FA 1KX4A 3X1VC 4Z5TA 4KGCA 1P3ID 2F8NA 2HIOA 5C3IB 3AZKB 3B0CT 3AZMC 5B2JC 4WNNA 5AY8B 3AYWC 1P3KB 3O62C 5KDMB 4H9RB 1ZLAA 3NQUB 3W96C 5BS7A 3X1UA 3KWQB 1P3MD 1P34D 2NQBA 1P3PC 4YS3C 1F66A 3REJC 3AZJD 3AZIB 5JRGD 4HGAC 4JJNA 3UTAB 3MGQC 4XUJC 3WKJA 5B31C 4NE6A 2YFWA 5GT3B 5DNNB 3AZKC 4J8WB 3REHA 1KX4B 3B6FB 4Z5TB 4KGCB 3MGSA 3AZHA 5B24A 3UT9D 5BNXA 2F8NB 2HIOB 5B1LC 5AY8C 1P3KC 4WNNB 2PYOB 5AV6D 3AZFA 1EQZA 2F8NK 3KWQC 4YM6D 3AV2D 3WA9A 5B33A 1ZLAB 3LZ1D 3X1UB 3REKA 4KUDD 1BH9A 2NQBB 3MGRB 1F66B 2BYKB 3WTPA 3UTAC 5BNVA 3AZLD 3X1SD 3MGPD 4JJNB 3X1VA 4ZUXD 5AV5A 4J8WC 1KX4C 3B6FC 4Z5TC 3WKJB 4KGCC 3AFAD 3B0BA 2YFWB 5B0YA 3KXBA 4XZQD 2HIOC 3REHB 2NZDA 1B67A 3MVDD 3AZHB 5B0ZA 5B24B 3WAAD 5BNXB 4WV4B 4E44A 1P3FA 1M1AA 3UTBB 5E5AD 4J8UA 3AYWD 1H3OA 3AZFB 1EQZB 1P3AA 1ZLAC 5BS7C 3X1UC 3A6ND 3AZND 1P3PA 2FJ7A 2NQBC 1F66C 2YFVA 3WA9B 1ID3D 1HQ3D 3REKB 1B6WA 1BH9B 4JJNC 5BNVB 3WKJC 4QLCD 3C1BD 5AV5B 3REHC 5B31D 1ULYA 4Z66A 3LJAD 3REID 3AZHC 5B24C 5B0YB 3KXBB 4X23D 5DNMD 2NZDB 5B31G 4WZSB 3KUYD 5B0ZB 4CAYA 1AOIA 4DRAA 5GSUA 3AZGD 5B1LD 1F1EA 3AZFC 1EQZC 1M1AB 4H9SA 5BT1D 1U35D 4J8UB 1H3OB 3AZIA 1P3LA 3WA9C 3W99D 5B33C 1P3AB 3RELA 3LELA 3REKC 2FJ7B 3LZ0A 3WTPC 1M19B 1P3GA 4NE5A 5GXQA 5AVBB 4WU9D 1KX5D 3B6GA 5GT3A 3X1TA 5DNNA 4J8WA 3VH5W 5AV5C 5AV8A 1TZYA 4Z2MG 5B0YC 3KXBC 1P3BD 2NZDC 4J8XD 4Z66B 4Z2MH 5CPJD 5B0ZC 2PYOA 5BO0B 1P3OA 5CPKD 1P3FC 4LD9D 1M1AC 5B32D 4CAYB 1AOIB 5GSUB 4J8UC 4AWLB 1P3AC 4J8VD 5B32G 3MGRA 2FJ7C 2AROD 2BYKA 3X1UD 3AV1B 3KSYA 1P3LB 3V9RA 5GT0D 3RELB 3LELB 1F66D 5B40D 1WWIA 5CP6D 3LZ0B 1P3GB 5GXQB 3W97B 3TU4D 3B6GB 3X1TB 1P3MA 3B0DB 5C3IC 3VH6W 5AV9D 1BH8A
chains in the Genus database with same CATH superfamily
5FUGA 1M18D 4Z66C 5AV8B 1TZYB 3EPLA 1S32D 5JRGA 3MGSD 4DQYB 3UTBA 4H9PA 2CV5D 1AOIC 5GSUC 2Y2LA 1P3OB 4AWLC 1TAFA 4H9SC 4UPKA 3UT9A 3AZIC 1P3LC 3W98D 1HTAA 3RELC 1KX3D 3LELC 5AVCD 1A7WA 5B33D 5B2ID 3LZ0C 3V9RB 4WU8D 4CSRB 1P3GC 2ZY4A 5GXQC 5B1MD 5AV6A 3C1CD 3WTPD 4R8PA 3B6GC 5GT3C 3X1TC 5DNNC 1JFIA 4YM6A 3AV2A 3A1KA 3X1VD 3LZ1A 5AV8C 1P3MB 1TZYC 5AV5D 3NQJB 1P34B 3AZEA 4G91B 4KUDA 5G49A 3VH6T 1BH8B 3AZJB 5FUGB 3AZMD 5B2JD 2PYOC 5JRGB 3AZLA 4ZBJB 1P3OC 3X1SA 4H9OA 3MGPA 2JE5A 4H9PB 1P3FD 3O62D 3AFAA 1TAFB 3W96D 4XZQA 3MGRC 4E45A 4KHAA 1M19A 2HUEB 3UT9B 1P3PD 5AVBA 4YS3D 3WAAA 3REJD 2Y2JA 5E5AA 5AV6B 3MGQD 4XUJD 4R8PB 3AZNA 3A6NA 1P3MC 1JFIB 4YM6B 4G91C 3AV2B 3AZKD 5BO0A 4NFTA 3LZ1B 1ID3A 1HQ3A 5JRGC 3AZEB 4KUDB 4ZBJC 5G49B 3AN2A 3UTBC 1BFMA 5F99A 5AY8D 3R45B 1P3KD 3AZLB 2ZY5A 4H9OB 3X1SB 3MGPB 1AOID 3MNNA 4ZUXB 4QLCA 3C1BA 3KWQD 3AV1A 3VH6A 3AFAB 3LJAA 3REIA 2HUEC 3UT9C 2G5HC 4XZQB 4X23A 5DNMA 3AZID 1P3LD 4KHAB 3MVDB 3KUYA 3WAAB 3AZGA 3W97A 3UTAD 5AV6C 4R8PC 2ZM5A 5GXQD 1U35A 5E5AB 4YM6C 3B6GD 3AV2C 5GT3D 5DNND 4J8WD 3B6FD 1KX4D 3W99A 4Z5TD 3LZ1C 4KGCD 3AZNB 3A6NB 3AZEC 1KU5A 4KUDC 2F8ND 2HIOD 4NE3A 1ID3B 1HQ3B 4WU9A 2RVQC 4UUZA 3AZLC 3X1SC 3MGPC 5CPIA 2F8NG 2BYMB 2PYOD 3AN2B 5F99B 2F8NH 3AFAC 1P3IA 3MNNB 1ZLAD 4QLCB 4XZQC 3A1IA 3C1BB 1P3BA 5B31B 4J8XA 1M19C 4CSRA 3MVDC 3LJAB 3REIB 5CPJA 2NQBD 3MGRD 3WAAC 5AVBC 3FDDA 4X23B 5DNMB 5CPKA 4LD9A 3KUYB 5B32A 4JJND 3AZGB 5E5AC 5B1LB 2W8SA 3NQJA 1P34A 4J8VA 3WKJD 3AZNC 3A6NC 1U35B 3AZJA 2AROA 1W2EA 3VH5T 2JSSA 3REHD 3W99B 5GT0A 1ID3C 3AZHD 5B24D 1HQ3C 5B40A 5CP6A 3AN2C 5F99C 4WU9B 3UTBD 4UUZB 3TU4A 1KX5B 2Y2OA 5CPIB 2L5AA 3MNNC 3AZFD 1EQZD 4QLCC 1R4VA 5AV9A 3C1BC 3AV1C 4G92B 1M18A 3LJAC 3REIC 1P3IB 1S32A 3WA9D 2LY8A 5CHLB 4X23C 5DNMC 1P3BB 3REKD 1Q9CA 4J8XB 5CPJB 3KUYC 4H9QA 2CV5A 3AZGC 3W97C 5CPKB 4LD9B 3B0DC 5B32B 5BT1C 3H0MC 1U35C 2IO5B 4R8PD 3W98A 3W99C 4J8VB 1KX3A 5AVCA 2AROB 2DF4C 5B0YD 3R45A 3KXBD 5B2IA 4WU8A 5GT0B 3AZED 2NZDD 4EO5B 5B1MA 5B0ZD 5B40B 3C1CA 4WU9C 5CP6B 1KX5C 4ZUXA 5CPIC 3H0RC 2RVQD 1M1AD 3VH5A 4G92C 5JA4A 4J8UD 3TU4B 2BG1A 1P3IC 1P3AD 3MVDA 5AV9B 1P3BC 4DRBA 2FJ7D 4J8XC 1M18B 3AZMA 5CPJC 5B2JA 1S32B 1M19D 1N1JA 3MGSB 4H9NA 5CPKC 4LD9C 5AVBD 3AYWA 5B32C 2DQNC 4H9QB 2CV5B 2IO5C 3O62A 2CWEA 3P5JB 2ZY3A 4J8VC 3W96A 1P34C 3AZJC 2AROC 4YS3A 4M6BA 3W98B 3REJA 5GT0C 4Z66D 4EO5C 1KX3B 5AVCB 5B40C 2BYMA 5B33B 5CP6C 5B2IB 4WU8B 5B1MB 3MGQA 3C1CB 3WTPB 4XUJA 5GSUD 3TU4C 5F99D 3AN2D 3WTPE 2FFFB 5B31A 3B0CW 5AV9C 3AZKA 3MNND 5JA4B 3X1VB 1M18C 3AV1D 1S32C 3RELD 3MGSC 3LELD 1T3UA 3AZMB 5B1LA 5AY8A 5B2JB 1P3KA 2CV5C 3LZ0D 1N1JB 1P3GD 5KDMA 4H9NB 4H9RA 3W97D 3NQUA 3AYWB 3X1TD 1P3FB 2Y2NA 3KWQA 3O62B 1Z2CB 1WWSA 3W98C 3W96B 5AV8D 1KX3C 1TZYD 5AVCC 2Y2KA 1P3PB 4YS3B 5B2IC 3REJB 4WU8C 3UTAA 1KX5A 5B1MC 2YFVB 3C1CC 1P3OD 4ZUXC 4HGAB 3H0LC 5CPID 3MGQB 4XUJB 3B6FA 1KX4A 3X1VC 4Z5TA 4KGCA 2Y2HA 1P3ID 2F8NA 2HIOA 5C3IB 3AZKB 3B0CT 3EPKA 3AZMC 5B2JC 4WNNA 5AY8B 3AYWC 1P3KB 3O62C 5KDMB 2Y2PA 4H9RB 1ZLAA 3NQUB 3W96C 5BS7A 3X1UA 3KWQB 3EPJA 1P3MD 1P34D 2NQBA 1P3PC 4YS3C 1F66A 3REJC 3AZJD 3AZIB 5JRGD 4HGAC 4JJNA 3UTAB 3IP4C 3MGQC 4XUJC 3WKJA 5B31C 4NE6A 2YFWA 5GT3B 5DNNB 3AZKC 4J8WB 3REHA 1KX4B 3B6FB 4Z5TB 4KGCB 2J8PA 3MGSA 5B24A 3UT9D 3AZHA 3KFUG 5BNXA 2F8NB 2HIOB 5B1LC 5AY8C 3EPHA 1P3KC 4WNNB 2PYOB 5AV6D 3AZFA 1EQZA 2F8NK 3KWQC 4YM6D 3AV2D 3WA9A 5B33A 1ZLAB 3LZ1D 3X1UB 2F2AC 3REKA 4KUDD 1BH9A 2NQBB 3MGRB 1F66B 2BYKB 3WTPA 3UTAC 5BNVA 3AZLD 3X1SD 3MGPD 4JJNB 3AL0C 3X1VA 4ZUXD 5AV5A 4J8WC 1KX4C 3B6FC 4Z5TC 2UWXA 3WKJB 3AFAD 4KGCC 3B0BA 2YFWB 5B0YA 3KXBA 4XZQD 2HIOC 3REHB 2NZDA 1B67A 3MVDD 3AZHB 5B0ZA 5B24B 3WAAD 5BNXB 4WV4B 4E44A 1P3FA 2VQRA 1M1AA 3UTBB 5E5AD 4J8UA 3AYWD 1H3OA 2ZY2A 3AZFB 1EQZB 1P3AA 1ZLAC 5BS7C 3X1UC 3A6ND 3AZND 2Y2IA 1P3PA 2FJ7A 1PZRA 2NQBC 1F66C 2YFVA 3WA9B 1ID3D 1HQ3D 3REKB 1B6WA 1BH9B 4JJNC 5BNVB 3EG5B 3WKJC 4QLCD 3C1BD 5AV5B 3REHC 5B31D 1ULYA 4Z66A 3LJAD 3REID 3AZHC 5B24C 5B0YB 2RIQA 3KXBB 4X23D 5DNMD 2NZDB 5B31G 2XD1A 4WZSB 5B0ZB 3KUYD 4CAYA 1AOIA 4DRAA 5GSUA 3AZGD 5B1LD 2G5IC 1F1EA 3AZFC 1EQZC 1M1AB 4H9SA 5BT1D 1U35D 4J8UB 1H3OB 3AZIA 1P3LA 3WA9C 3W99D 5B33C 1P3AB 3RELA 3LELA 3REKC 2FJ7B 3LZ0A 3WTPC 1M19B 1P3GA 4NE5A 5GXQA 5AVBB 4WU9D 1KX5D 3B6GA 5GT3A 3X1TA 5DNNA 4J8WA 2XD5A 2Y2GA 4WJ3C 3VH5W 2JCHA 5AV5C 5AV8A 1TZYA 4Z2MG 5B0YC 3KXBC 1P3BD 2NZDC 4J8XD 4Z66B 4Z2MH 5CPJD 5B0ZC 2PYOA 5BO0B 1P3OA 5CPKD 1P3FC 4LD9D 2Y2QA 1M1AC 5B32D 4CAYB 1AOIB 5GSUB 4J8UC 2Y2MA 4AWLB 1P3AC 4J8VD 5B32G 3MGRA 2FJ7C 2AROD 2BYKA 3X1UD 3AV1B 3KSYA 1P3LB 3V9RA 5GT0D 3RELB 3LELB 1F66D 5B40D 1WWIA 5CP6D 3F6TA 3LZ0B 1P3GB 5GXQB 3W97B 3TU4D 3B6GB 3X1TB 1P3MA 3B0DB 5C3IC 3VH6W 5AV9D 1BH8A
chains in the Genus database with same CATH topology
5FUGA 1M18D 4Z66C 5AV8B 1TZYB 3EPLA 1S32D 5JRGA 3MGSD 4DQYB 3UTBA 4H9PA 2CV5D 1AOIC 5GSUC 2Y2LA 1P3OB 4AWLC 1TAFA 4H9SC 4UPKA 3UT9A 3AZIC 1P3LC 3W98D 1HTAA 3RELC 1KX3D 3LELC 5AVCD 1A7WA 5B33D 5B2ID 3LZ0C 3V9RB 4WU8D 4CSRB 1P3GC 2ZY4A 5GXQC 5B1MD 5AV6A 3C1CD 3WTPD 4R8PA 3B6GC 5GT3C 3X1TC 5DNNC 1JFIA 4YM6A 3AV2A 3A1KA 3X1VD 3LZ1A 5AV8C 1P3MB 1TZYC 5AV5D 3NQJB 1P34B 3AZEA 4G91B 4KUDA 5G49A 3VH6T 1BH8B 3AZJB 5FUGB 3AZMD 5B2JD 2PYOC 5JRGB 3AZLA 4ZBJB 1P3OC 3X1SA 4H9OA 3MGPA 2JE5A 4H9PB 1P3FD 3O62D 3AFAA 1TAFB 3W96D 4XZQA 3MGRC 4E45A 4KHAA 1M19A 2HUEB 3UT9B 1P3PD 5AVBA 4YS3D 3WAAA 3REJD 2Y2JA 5E5AA 5AV6B 3MGQD 4XUJD 4R8PB 3AZNA 3A6NA 1P3MC 1JFIB 4YM6B 4G91C 3AV2B 3AZKD 5BO0A 4NFTA 3LZ1B 1ID3A 1HQ3A 5JRGC 3AZEB 4KUDB 4ZBJC 5G49B 3AN2A 3UTBC 1BFMA 5F99A 5AY8D 3R45B 1P3KD 3AZLB 2ZY5A 4H9OB 3X1SB 3MGPB 1AOID 3MNNA 4ZUXB 4QLCA 3C1BA 3KWQD 3AV1A 3VH6A 3AFAB 3LJAA 3REIA 2HUEC 3UT9C 2G5HC 4XZQB 4X23A 5DNMA 3AZID 1P3LD 4KHAB 3MVDB 3KUYA 3WAAB 3AZGA 3W97A 3UTAD 5AV6C 4R8PC 2ZM5A 5GXQD 1U35A 5E5AB 4YM6C 3B6GD 3AV2C 5GT3D 5DNND 4J8WD 3B6FD 1KX4D 3W99A 4Z5TD 3LZ1C 4KGCD 3AZNB 3A6NB 3AZEC 1KU5A 4KUDC 2F8ND 2HIOD 4NE3A 1ID3B 1HQ3B 4WU9A 2RVQC 4UUZA 3AZLC 3X1SC 3MGPC 5CPIA 2F8NG 2BYMB 2PYOD 3AN2B 5F99B 2F8NH 3AFAC 1P3IA 3MNNB 1ZLAD 4QLCB 4XZQC 3A1IA 3C1BB 1P3BA 5B31B 4J8XA 1M19C 4CSRA 3MVDC 3LJAB 3REIB 5CPJA 2NQBD 3MGRD 3WAAC 5AVBC 3FDDA 4X23B 5DNMB 5CPKA 4LD9A 3KUYB 5B32A 4JJND 3AZGB 5E5AC 5B1LB 2W8SA 3NQJA 1P34A 4J8VA 3WKJD 3AZNC 3A6NC 1U35B 3AZJA 2AROA 1W2EA 3VH5T 2JSSA 3REHD 3W99B 5GT0A 1ID3C 3AZHD 5B24D 1HQ3C 5B40A 5CP6A 3AN2C 5F99C 4WU9B 3UTBD 4UUZB 3TU4A 1KX5B 2Y2OA 5CPIB 2L5AA 3MNNC 3AZFD 1EQZD 4QLCC 1R4VA 5AV9A 3C1BC 3AV1C 4G92B 1M18A 3LJAC 3REIC 1P3IB 1S32A 3WA9D 2LY8A 5CHLB 4X23C 5DNMC 1P3BB 3REKD 1Q9CA 4J8XB 5CPJB 3KUYC 4H9QA 2CV5A 3AZGC 3W97C 5CPKB 4LD9B 3B0DC 5B32B 5BT1C 3H0MC 1U35C 2IO5B 4R8PD 3W98A 3W99C 4J8VB 1KX3A 5AVCA 2AROB 2DF4C 5B0YD 3R45A 3KXBD 5B2IA 4WU8A 5GT0B 3AZED 2NZDD 4EO5B 5B1MA 5B0ZD 5B40B 3C1CA 4WU9C 5CP6B 1KX5C 4ZUXA 5CPIC 3H0RC 2RVQD 1M1AD 3VH5A 4G92C 5JA4A 4J8UD 3TU4B 2BG1A 1P3IC 1P3AD 3MVDA 5AV9B 1P3BC 4DRBA 2FJ7D 4J8XC 1M18B 3AZMA 5CPJC 5B2JA 1S32B 1M19D 1N1JA 3MGSB 4H9NA 5CPKC 4LD9C 5AVBD 3AYWA 5B32C 2DQNC 4H9QB 2CV5B 2IO5C 3O62A 2CWEA 3P5JB 2ZY3A 4J8VC 3W96A 1P34C 3AZJC 2AROC 4YS3A 4M6BA 3W98B 3REJA 5GT0C 4Z66D 4EO5C 1KX3B 5AVCB 5B40C 2BYMA 5B33B 5CP6C 5B2IB 4WU8B 5B1MB 3MGQA 3C1CB 3WTPB 4XUJA 5GSUD 3TU4C 5F99D 3AN2D 3WTPE 2FFFB 5B31A 3B0CW 5AV9C 3AZKA 3MNND 5JA4B 3X1VB 1M18C 3AV1D 1S32C 3RELD 3MGSC 3LELD 1T3UA 3AZMB 5B1LA 5AY8A 5B2JB 1P3KA 2CV5C 3LZ0D 1N1JB 1P3GD 5KDMA 4H9NB 4H9RA 3W97D 3NQUA 3AYWB 3X1TD 1P3FB 2Y2NA 3KWQA 3O62B 1Z2CB 1WWSA 3W98C 3W96B 5AV8D 1KX3C 1TZYD 5AVCC 2Y2KA 1P3PB 4YS3B 5B2IC 3REJB 4WU8C 3UTAA 1KX5A 5B1MC 2YFVB 3C1CC 1P3OD 4ZUXC 4HGAB 3H0LC 5CPID 3MGQB 4XUJB 3B6FA 1KX4A 3X1VC 4Z5TA 4KGCA 2Y2HA 1P3ID 2F8NA 2HIOA 5C3IB 3AZKB 3B0CT 3EPKA 3AZMC 5B2JC 4WNNA 5AY8B 3AYWC 1P3KB 3O62C 5KDMB 2Y2PA 4H9RB 1ZLAA 3NQUB 3W96C 5BS7A 3X1UA 3KWQB 3EPJA 1P3MD 1P34D 2NQBA 1P3PC 4YS3C 1F66A 3REJC 3AZJD 3AZIB 5JRGD 4HGAC 4JJNA 3UTAB 3IP4C 3MGQC 4XUJC 3WKJA 5B31C 4NE6A 2YFWA 5GT3B 5DNNB 3AZKC 4J8WB 3REHA 1KX4B 3B6FB 4Z5TB 4KGCB 2J8PA 3MGSA 5B24A 3UT9D 3AZHA 3KFUG 5BNXA 2F8NB 2HIOB 5B1LC 5AY8C 3EPHA 1P3KC 4WNNB 2PYOB 5AV6D 3AZFA 1EQZA 2F8NK 3KWQC 4YM6D 3AV2D 3WA9A 5B33A 1ZLAB 3LZ1D 3X1UB 2F2AC 3REKA 4KUDD 1BH9A 2NQBB 3MGRB 1F66B 2BYKB 3WTPA 3UTAC 5BNVA 3AZLD 3X1SD 3MGPD 4JJNB 3AL0C 3X1VA 4ZUXD 5AV5A 4J8WC 1KX4C 3B6FC 4Z5TC 2UWXA 3WKJB 3AFAD 4KGCC 3B0BA 2YFWB 5B0YA 3KXBA 4XZQD 2HIOC 3REHB 2NZDA 1B67A 3MVDD 3AZHB 5B0ZA 5B24B 3WAAD 5BNXB 4WV4B 4E44A 1P3FA 2VQRA 1M1AA 3UTBB 5E5AD 4J8UA 3AYWD 1H3OA 2ZY2A 3AZFB 1EQZB 1P3AA 1ZLAC 5BS7C 3X1UC 3A6ND 3AZND 2Y2IA 1P3PA 2FJ7A 1PZRA 2NQBC 1F66C 2YFVA 3WA9B 1ID3D 1HQ3D 3REKB 1B6WA 1BH9B 4JJNC 5BNVB 3EG5B 3WKJC 4QLCD 3C1BD 5AV5B 3REHC 5B31D 1ULYA 4Z66A 3LJAD 3REID 3AZHC 5B24C 5B0YB 2RIQA 3KXBB 4X23D 5DNMD 2NZDB 5B31G 2XD1A 4WZSB 5B0ZB 3KUYD 4CAYA 1AOIA 4DRAA 5GSUA 3AZGD 5B1LD 2G5IC 1F1EA 3AZFC 1EQZC 1M1AB 4H9SA 5BT1D 1U35D 4J8UB 1H3OB 3AZIA 1P3LA 3WA9C 3W99D 5B33C 1P3AB 3RELA 3LELA 3REKC 2FJ7B 3LZ0A 3WTPC 1M19B 1P3GA 4NE5A 5GXQA 5AVBB 4WU9D 1KX5D 3B6GA 5GT3A 3X1TA 5DNNA 4J8WA 2XD5A 2Y2GA 4WJ3C 3VH5W 2JCHA 5AV5C 5AV8A 1TZYA 4Z2MG 5B0YC 3KXBC 1P3BD 2NZDC 4J8XD 4Z66B 4Z2MH 5CPJD 5B0ZC 2PYOA 5BO0B 1P3OA 5CPKD 1P3FC 4LD9D 2Y2QA 1M1AC 5B32D 4CAYB 1AOIB 5GSUB 4J8UC 2Y2MA 4AWLB 1P3AC 4J8VD 5B32G 3MGRA 2FJ7C 2AROD 2BYKA 3X1UD 3AV1B 3KSYA 1P3LB 3V9RA 5GT0D 3RELB 3LELB 1F66D 5B40D 1WWIA 5CP6D 3F6TA 3LZ0B 1P3GB 5GXQB 3W97B 3TU4D 3B6GB 3X1TB 1P3MA 3B0DB 5C3IC 3VH6W 5AV9D 1BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG A;  1M18 D;  4Z66 C;  5AV8 B;  1TZY B;  1S32 D;  5JRG A;  3MGS D;  3UTB A;  4H9P A;  2CV5 D;  1AOI C;  5GSU C;  1P3O B;  4AWL C;  1TAF A;  4H9S C;  3UT9 A;  3AZI C;  1P3L C;  3W98 D;  1HTA A;  3REL C;  1KX3 D;  3LEL C;  5AVC D;  1A7W A;  5B33 D;  5B2I D;  3LZ0 C;  3V9R B;  4WU8 D;  4CSR B;  1P3G C;  5GXQ C;  5B1M D;  5AV6 A;  3C1C D;  3WTP D;  4R8P A;  3B6G C;  5GT3 C;  3X1T C;  5DNN C;  1JFI A;  4YM6 A;  3AV2 A;  3X1V D;  3LZ1 A;  5AV8 C;  1P3M B;  1TZY C;  5AV5 D;  3NQJ B;  1P34 B;  3AZE A;  4G91 B;  4KUD A;  5G49 A;  3VH6 T;  1BH8 B;  3AZJ B;  5FUG B;  3AZM D;  5B2J D;  2PYO C;  5JRG B;  3AZL A;  4ZBJ B;  1P3O C;  3X1S A;  4H9O A;  3MGP A;  4H9P B;  1P3F D;  3O62 D;  3AFA A;  1TAF B;  3W96 D;  4XZQ A;  3MGR C;  4E45 A;  4KHA A;  1M19 A;  2HUE B;  3UT9 B;  1P3P D;  5AVB A;  4YS3 D;  3WAA A;  3REJ D;  5E5A A;  5AV6 B;  3MGQ D;  4XUJ D;  4R8P B;  3AZN A;  3A6N A;  1P3M C;  1JFI B;  4YM6 B;  4G91 C;  3AV2 B;  3AZK D;  5BO0 A;  4NFT A;  3LZ1 B;  1ID3 A;  1HQ3 A;  5JRG C;  3AZE B;  4KUD B;  4ZBJ C;  5G49 B;  3AN2 A;  3UTB C;  1BFM A;  5F99 A;  5AY8 D;  3R45 B;  1P3K D;  3AZL B;  3X1S B;  4H9O B;  3MGP B;  1AOI D;  3MNN A;  4ZUX B;  4QLC A;  3C1B A;  3KWQ D;  3AV1 A;  3VH6 A;  3AFA B;  3LJA A;  3REI A;  2HUE C;  3UT9 C;  4XZQ B;  4X23 A;  5DNM A;  3AZI D;  1P3L D;  4KHA B;  3MVD B;  3KUY A;  3WAA B;  3AZG A;  3W97 A;  3UTA D;  5AV6 C;  4R8P C;  5GXQ D;  1U35 A;  5E5A B;  4YM6 C;  3B6G D;  3AV2 C;  5GT3 D;  5DNN D;  4J8W D;  3B6F D;  1KX4 D;  3W99 A;  4Z5T D;  3LZ1 C;  4KGC D;  3AZN B;  3A6N B;  3AZE C;  1KU5 A;  4KUD C;  2F8N D;  2HIO D;  4NE3 A;  1ID3 B;  1HQ3 B;  4WU9 A;  2RVQ C;  4UUZ A;  3AZL C;  3X1S C;  3MGP C;  5CPI A;  2F8N G;  2BYM B;  2PYO D;  3AN2 B;  5F99 B;  2F8N H;  3AFA C;  1P3I A;  3MNN B;  1ZLA D;  4QLC B;  4XZQ C;  3C1B B;  1P3B A;  5B31 B;  4J8X A;  1M19 C;  4CSR A;  3MVD C;  3LJA B;  3REI B;  5CPJ A;  2NQB D;  3MGR D;  3WAA C;  5AVB C;  4X23 B;  5DNM B;  5CPK A;  4LD9 A;  3KUY B;  5B32 A;  4JJN D;  3AZG B;  5E5A C;  5B1L B;  3NQJ A;  1P34 A;  4J8V A;  3WKJ D;  3AZN C;  3A6N C;  1U35 B;  3AZJ A;  2ARO A;  3VH5 T;  2JSS A;  3REH D;  3W99 B;  5GT0 A;  1ID3 C;  3AZH D;  5B24 D;  1HQ3 C;  5B40 A;  5CP6 A;  3AN2 C;  5F99 C;  4WU9 B;  3UTB D;  4UUZ B;  3TU4 A;  1KX5 B;  5CPI B;  2L5A A;  3MNN C;  3AZF D;  1EQZ D;  4QLC C;  1R4V A;  5AV9 A;  3C1B C;  3AV1 C;  4G92 B;  1M18 A;  3LJA C;  3REI C;  1P3I B;  1S32 A;  3WA9 D;  2LY8 A;  5CHL B;  4X23 C;  5DNM C;  1P3B B;  3REK D;  1Q9C A;  4J8X B;  5CPJ B;  3KUY C;  4H9Q A;  2CV5 A;  3AZG C;  3W97 C;  5CPK B;  4LD9 B;  3B0D C;  5B32 B;  5BT1 C;  1U35 C;  2IO5 B;  4R8P D;  3W98 A;  3W99 C;  4J8V B;  1KX3 A;  5AVC A;  2ARO B;  5B0Y D;  3R45 A;  3KXB D;  5B2I A;  4WU8 A;  5GT0 B;  3AZE D;  2NZD D;  4EO5 B;  5B1M A;  5B0Z D;  5B40 B;  3C1C A;  4WU9 C;  5CP6 B;  1KX5 C;  4ZUX A;  5CPI C;  2RVQ D;  1M1A D;  3VH5 A;  4G92 C;  5JA4 A;  4J8U D;  3TU4 B;  1P3I C;  1P3A D;  3MVD A;  5AV9 B;  1P3B C;  4DRB A;  2FJ7 D;  4J8X C;  1M18 B;  3AZM A;  5CPJ C;  5B2J A;  1S32 B;  1M19 D;  1N1J A;  3MGS B;  4H9N A;  5CPK C;  4LD9 C;  5AVB D;  3AYW A;  5B32 C;  4H9Q B;  2CV5 B;  2IO5 C;  3O62 A;  2CWE A;  1P34 C;  4J8V C;  3W96 A;  3AZJ C;  2ARO C;  4YS3 A;  4M6B A;  3W98 B;  3REJ A;  5GT0 C;  4Z66 D;  4EO5 C;  1KX3 B;  5AVC B;  5B40 C;  2BYM A;  5B33 B;  5CP6 C;  5B2I B;  4WU8 B;  5B1M B;  3MGQ A;  3C1C B;  3WTP B;  4XUJ A;  5GSU D;  3TU4 C;  5F99 D;  3AN2 D;  3WTP E;  5B31 A;  3B0C W;  5AV9 C;  3AZK A;  3MNN D;  5JA4 B;  3X1V B;  1M18 C;  3AV1 D;  1S32 C;  3REL D;  3MGS C;  3LEL D;  3AZM B;  5B1L A;  5AY8 A;  5B2J B;  1P3K A;  2CV5 C;  3LZ0 D;  1N1J B;  1P3G D;  5KDM A;  4H9N B;  4H9R A;  3W97 D;  3NQU A;  3AYW B;  3X1T D;  1P3F B;  3KWQ A;  3O62 B;  1WWS A;  3W98 C;  3W96 B;  5AV8 D;  1KX3 C;  1TZY D;  5AVC C;  1P3P B;  4YS3 B;  5B2I C;  3REJ B;  4WU8 C;  3UTA A;  1KX5 A;  5B1M C;  2YFV B;  3C1C C;  1P3O D;  4ZUX C;  4HGA B;  5CPI D;  3MGQ B;  4XUJ B;  3B6F A;  1KX4 A;  3X1V C;  4Z5T A;  4KGC A;  1P3I D;  2F8N A;  2HIO A;  5C3I B;  3AZK B;  3B0C T;  3AZM C;  5B2J C;  4WNN A;  5AY8 B;  3AYW C;  1P3K B;  3O62 C;  5KDM B;  4H9R B;  1ZLA A;  3NQU B;  3W96 C;  5BS7 A;  3X1U A;  3KWQ B;  1P3M D;  1P34 D;  2NQB A;  1P3P C;  4YS3 C;  1F66 A;  3REJ C;  3AZJ D;  3AZI B;  5JRG D;  4HGA C;  4JJN A;  3UTA B;  3MGQ C;  4XUJ C;  3WKJ A;  5B31 C;  4NE6 A;  2YFW A;  5GT3 B;  5DNN B;  3AZK C;  4J8W B;  3REH A;  1KX4 B;  3B6F B;  4Z5T B;  4KGC B;  3MGS A;  3AZH A;  5B24 A;  3UT9 D;  5BNX A;  2F8N B;  2HIO B;  5B1L C;  5AY8 C;  1P3K C;  4WNN B;  2PYO B;  5AV6 D;  3AZF A;  1EQZ A;  2F8N K;  3KWQ C;  4YM6 D;  3AV2 D;  3WA9 A;  5B33 A;  1ZLA B;  3LZ1 D;  3X1U B;  3REK A;  4KUD D;  1BH9 A;  2NQB B;  3MGR B;  1F66 B;  2BYK B;  3WTP A;  3UTA C;  5BNV A;  3AZL D;  3X1S D;  3MGP D;  4JJN B;  3X1V A;  4ZUX D;  5AV5 A;  4J8W C;  1KX4 C;  3B6F C;  4Z5T C;  3WKJ B;  4KGC C;  3AFA D;  3B0B A;  2YFW B;  5B0Y A;  3KXB A;  4XZQ D;  2HIO C;  3REH B;  2NZD A;  1B67 A;  3MVD D;  3AZH B;  5B0Z A;  5B24 B;  3WAA D;  5BNX B;  4WV4 B;  4E44 A;  1P3F A;  1M1A A;  3UTB B;  5E5A D;  4J8U A;  3AYW D;  1H3O A;  3AZF B;  1EQZ B;  1P3A A;  1ZLA C;  5BS7 C;  3X1U C;  3A6N D;  3AZN D;  1P3P A;  2FJ7 A;  2NQB C;  1F66 C;  2YFV A;  3WA9 B;  1ID3 D;  1HQ3 D;  3REK B;  1B6W A;  1BH9 B;  4JJN C;  5BNV B;  3WKJ C;  4QLC D;  3C1B D;  5AV5 B;  3REH C;  5B31 D;  1ULY A;  4Z66 A;  3LJA D;  3REI D;  3AZH C;  5B24 C;  5B0Y B;  3KXB B;  4X23 D;  5DNM D;  2NZD B;  5B31 G;  4WZS B;  3KUY D;  5B0Z B;  4CAY A;  1AOI A;  4DRA A;  5GSU A;  3AZG D;  5B1L D;  1F1E A;  3AZF C;  1EQZ C;  1M1A B;  4H9S A;  5BT1 D;  1U35 D;  4J8U B;  1H3O B;  3AZI A;  1P3L A;  3WA9 C;  3W99 D;  5B33 C;  1P3A B;  3REL A;  3LEL A;  3REK C;  2FJ7 B;  3LZ0 A;  3WTP C;  1M19 B;  1P3G A;  4NE5 A;  5GXQ A;  5AVB B;  4WU9 D;  1KX5 D;  3B6G A;  5GT3 A;  3X1T A;  5DNN A;  4J8W A;  3VH5 W;  5AV5 C;  5AV8 A;  1TZY A;  4Z2M G;  5B0Y C;  3KXB C;  1P3B D;  2NZD C;  4J8X D;  4Z66 B;  4Z2M H;  5CPJ D;  5B0Z C;  2PYO A;  5BO0 B;  1P3O A;  5CPK D;  1P3F C;  4LD9 D;  1M1A C;  5B32 D;  4CAY B;  1AOI B;  5GSU B;  4J8U C;  4AWL B;  1P3A C;  4J8V D;  5B32 G;  3MGR A;  2FJ7 C;  2ARO D;  2BYK A;  3X1U D;  3AV1 B;  3KSY A;  1P3L B;  3V9R A;  5GT0 D;  3REL B;  3LEL B;  1F66 D;  5B40 D;  1WWI A;  5CP6 D;  3LZ0 B;  1P3G B;  5GXQ B;  3W97 B;  3TU4 D;  3B6G B;  3X1T B;  1P3M A;  3B0D B;  5C3I C;  3VH6 W;  5AV9 D;  1BH8 A; 
#chains in the Genus database with same CATH topology
 5FUG A;  1M18 D;  4Z66 C;  5AV8 B;  1TZY B;  3EPL A;  1S32 D;  5JRG A;  3MGS D;  4DQY B;  3UTB A;  4H9P A;  2CV5 D;  1AOI C;  5GSU C;  2Y2L A;  1P3O B;  4AWL C;  1TAF A;  4H9S C;  4UPK A;  3UT9 A;  3AZI C;  1P3L C;  3W98 D;  1HTA A;  3REL C;  1KX3 D;  3LEL C;  5AVC D;  1A7W A;  5B33 D;  5B2I D;  3LZ0 C;  3V9R B;  4WU8 D;  4CSR B;  1P3G C;  2ZY4 A;  5GXQ C;  5B1M D;  5AV6 A;  3C1C D;  3WTP D;  4R8P A;  3B6G C;  5GT3 C;  3X1T C;  5DNN C;  1JFI A;  4YM6 A;  3AV2 A;  3A1K A;  3X1V D;  3LZ1 A;  5AV8 C;  1P3M B;  1TZY C;  5AV5 D;  3NQJ B;  1P34 B;  3AZE A;  4G91 B;  4KUD A;  5G49 A;  3VH6 T;  1BH8 B;  3AZJ B;  5FUG B;  3AZM D;  5B2J D;  2PYO C;  5JRG B;  3AZL A;  4ZBJ B;  1P3O C;  3X1S A;  4H9O A;  3MGP A;  2JE5 A;  4H9P B;  1P3F D;  3O62 D;  3AFA A;  1TAF B;  3W96 D;  4XZQ A;  3MGR C;  4E45 A;  4KHA A;  1M19 A;  2HUE B;  3UT9 B;  1P3P D;  5AVB A;  4YS3 D;  3WAA A;  3REJ D;  2Y2J A;  5E5A A;  5AV6 B;  3MGQ D;  4XUJ D;  4R8P B;  3AZN A;  3A6N A;  1P3M C;  1JFI B;  4YM6 B;  4G91 C;  3AV2 B;  3AZK D;  5BO0 A;  4NFT A;  3LZ1 B;  1ID3 A;  1HQ3 A;  5JRG C;  3AZE B;  4KUD B;  4ZBJ C;  5G49 B;  3AN2 A;  3UTB C;  1BFM A;  5F99 A;  5AY8 D;  3R45 B;  1P3K D;  3AZL B;  2ZY5 A;  4H9O B;  3X1S B;  3MGP B;  1AOI D;  3MNN A;  4ZUX B;  4QLC A;  3C1B A;  3KWQ D;  3AV1 A;  3VH6 A;  3AFA B;  3LJA A;  3REI A;  2HUE C;  3UT9 C;  2G5H C;  4XZQ B;  4X23 A;  5DNM A;  3AZI D;  1P3L D;  4KHA B;  3MVD B;  3KUY A;  3WAA B;  3AZG A;  3W97 A;  3UTA D;  5AV6 C;  4R8P C;  2ZM5 A;  5GXQ D;  1U35 A;  5E5A B;  4YM6 C;  3B6G D;  3AV2 C;  5GT3 D;  5DNN D;  4J8W D;  3B6F D;  1KX4 D;  3W99 A;  4Z5T D;  3LZ1 C;  4KGC D;  3AZN B;  3A6N B;  3AZE C;  1KU5 A;  4KUD C;  2F8N D;  2HIO D;  4NE3 A;  1ID3 B;  1HQ3 B;  4WU9 A;  2RVQ C;  4UUZ A;  3AZL C;  3X1S C;  3MGP C;  5CPI A;  2F8N G;  2BYM B;  2PYO D;  3AN2 B;  5F99 B;  2F8N H;  3AFA C;  1P3I A;  3MNN B;  1ZLA D;  4QLC B;  4XZQ C;  3A1I A;  3C1B B;  1P3B A;  5B31 B;  4J8X A;  1M19 C;  4CSR A;  3MVD C;  3LJA B;  3REI B;  5CPJ A;  2NQB D;  3MGR D;  3WAA C;  5AVB C;  3FDD A;  4X23 B;  5DNM B;  5CPK A;  4LD9 A;  3KUY B;  5B32 A;  4JJN D;  3AZG B;  5E5A C;  5B1L B;  2W8S A;  3NQJ A;  1P34 A;  4J8V A;  3WKJ D;  3AZN C;  3A6N C;  1U35 B;  3AZJ A;  2ARO A;  1W2E A;  3VH5 T;  2JSS A;  3REH D;  3W99 B;  5GT0 A;  1ID3 C;  3AZH D;  5B24 D;  1HQ3 C;  5B40 A;  5CP6 A;  3AN2 C;  5F99 C;  4WU9 B;  3UTB D;  4UUZ B;  3TU4 A;  1KX5 B;  2Y2O A;  5CPI B;  2L5A A;  3MNN C;  3AZF D;  1EQZ D;  4QLC C;  1R4V A;  5AV9 A;  3C1B C;  3AV1 C;  4G92 B;  1M18 A;  3LJA C;  3REI C;  1P3I B;  1S32 A;  3WA9 D;  2LY8 A;  5CHL B;  4X23 C;  5DNM C;  1P3B B;  3REK D;  1Q9C A;  4J8X B;  5CPJ B;  3KUY C;  4H9Q A;  2CV5 A;  3AZG C;  3W97 C;  5CPK B;  4LD9 B;  3B0D C;  5B32 B;  5BT1 C;  3H0M C;  1U35 C;  2IO5 B;  4R8P D;  3W98 A;  3W99 C;  4J8V B;  1KX3 A;  5AVC A;  2ARO B;  2DF4 C;  5B0Y D;  3R45 A;  3KXB D;  5B2I A;  4WU8 A;  5GT0 B;  3AZE D;  2NZD D;  4EO5 B;  5B1M A;  5B0Z D;  5B40 B;  3C1C A;  4WU9 C;  5CP6 B;  1KX5 C;  4ZUX A;  5CPI C;  3H0R C;  2RVQ D;  1M1A D;  3VH5 A;  4G92 C;  5JA4 A;  4J8U D;  3TU4 B;  2BG1 A;  1P3I C;  1P3A D;  3MVD A;  5AV9 B;  1P3B C;  4DRB A;  2FJ7 D;  4J8X C;  1M18 B;  3AZM A;  5CPJ C;  5B2J A;  1S32 B;  1M19 D;  1N1J A;  3MGS B;  4H9N A;  5CPK C;  4LD9 C;  5AVB D;  3AYW A;  5B32 C;  2DQN C;  4H9Q B;  2CV5 B;  2IO5 C;  3O62 A;  2CWE A;  3P5J B;  2ZY3 A;  4J8V C;  3W96 A;  1P34 C;  3AZJ C;  2ARO C;  4YS3 A;  4M6B A;  3W98 B;  3REJ A;  5GT0 C;  4Z66 D;  4EO5 C;  1KX3 B;  5AVC B;  5B40 C;  2BYM A;  5B33 B;  5CP6 C;  5B2I B;  4WU8 B;  5B1M B;  3MGQ A;  3C1C B;  3WTP B;  4XUJ A;  5GSU D;  3TU4 C;  5F99 D;  3AN2 D;  3WTP E;  2FFF B;  5B31 A;  3B0C W;  5AV9 C;  3AZK A;  3MNN D;  5JA4 B;  3X1V B;  1M18 C;  3AV1 D;  1S32 C;  3REL D;  3MGS C;  3LEL D;  1T3U A;  3AZM B;  5B1L A;  5AY8 A;  5B2J B;  1P3K A;  2CV5 C;  3LZ0 D;  1N1J B;  1P3G D;  5KDM A;  4H9N B;  4H9R A;  3W97 D;  3NQU A;  3AYW B;  3X1T D;  1P3F B;  2Y2N A;  3KWQ A;  3O62 B;  1Z2C B;  1WWS A;  3W98 C;  3W96 B;  5AV8 D;  1KX3 C;  1TZY D;  5AVC C;  2Y2K A;  1P3P B;  4YS3 B;  5B2I C;  3REJ B;  4WU8 C;  3UTA A;  1KX5 A;  5B1M C;  2YFV B;  3C1C C;  1P3O D;  4ZUX C;  4HGA B;  3H0L C;  5CPI D;  3MGQ B;  4XUJ B;  3B6F A;  1KX4 A;  3X1V C;  4Z5T A;  4KGC A;  2Y2H A;  1P3I D;  2F8N A;  2HIO A;  5C3I B;  3AZK B;  3B0C T;  3EPK A;  3AZM C;  5B2J C;  4WNN A;  5AY8 B;  3AYW C;  1P3K B;  3O62 C;  5KDM B;  2Y2P A;  4H9R B;  1ZLA A;  3NQU B;  3W96 C;  5BS7 A;  3X1U A;  3KWQ B;  3EPJ A;  1P3M D;  1P34 D;  2NQB A;  1P3P C;  4YS3 C;  1F66 A;  3REJ C;  3AZJ D;  3AZI B;  5JRG D;  4HGA C;  4JJN A;  3UTA B;  3IP4 C;  3MGQ C;  4XUJ C;  3WKJ A;  5B31 C;  4NE6 A;  2YFW A;  5GT3 B;  5DNN B;  3AZK C;  4J8W B;  3REH A;  1KX4 B;  3B6F B;  4Z5T B;  4KGC B;  2J8P A;  3MGS A;  5B24 A;  3UT9 D;  3AZH A;  3KFU G;  5BNX A;  2F8N B;  2HIO B;  5B1L C;  5AY8 C;  3EPH A;  1P3K C;  4WNN B;  2PYO B;  5AV6 D;  3AZF A;  1EQZ A;  2F8N K;  3KWQ C;  4YM6 D;  3AV2 D;  3WA9 A;  5B33 A;  1ZLA B;  3LZ1 D;  3X1U B;  2F2A C;  3REK A;  4KUD D;  1BH9 A;  2NQB B;  3MGR B;  1F66 B;  2BYK B;  3WTP A;  3UTA C;  5BNV A;  3AZL D;  3X1S D;  3MGP D;  4JJN B;  3AL0 C;  3X1V A;  4ZUX D;  5AV5 A;  4J8W C;  1KX4 C;  3B6F C;  4Z5T C;  2UWX A;  3WKJ B;  3AFA D;  4KGC C;  3B0B A;  2YFW B;  5B0Y A;  3KXB A;  4XZQ D;  2HIO C;  3REH B;  2NZD A;  1B67 A;  3MVD D;  3AZH B;  5B0Z A;  5B24 B;  3WAA D;  5BNX B;  4WV4 B;  4E44 A;  1P3F A;  2VQR A;  1M1A A;  3UTB B;  5E5A D;  4J8U A;  3AYW D;  1H3O A;  2ZY2 A;  3AZF B;  1EQZ B;  1P3A A;  1ZLA C;  5BS7 C;  3X1U C;  3A6N D;  3AZN D;  2Y2I A;  1P3P A;  2FJ7 A;  1PZR A;  2NQB C;  1F66 C;  2YFV A;  3WA9 B;  1ID3 D;  1HQ3 D;  3REK B;  1B6W A;  1BH9 B;  4JJN C;  5BNV B;  3EG5 B;  3WKJ C;  4QLC D;  3C1B D;  5AV5 B;  3REH C;  5B31 D;  1ULY A;  4Z66 A;  3LJA D;  3REI D;  3AZH C;  5B24 C;  5B0Y B;  2RIQ A;  3KXB B;  4X23 D;  5DNM D;  2NZD B;  5B31 G;  2XD1 A;  4WZS B;  5B0Z B;  3KUY D;  4CAY A;  1AOI A;  4DRA A;  5GSU A;  3AZG D;  5B1L D;  2G5I C;  1F1E A;  3AZF C;  1EQZ C;  1M1A B;  4H9S A;  5BT1 D;  1U35 D;  4J8U B;  1H3O B;  3AZI A;  1P3L A;  3WA9 C;  3W99 D;  5B33 C;  1P3A B;  3REL A;  3LEL A;  3REK C;  2FJ7 B;  3LZ0 A;  3WTP C;  1M19 B;  1P3G A;  4NE5 A;  5GXQ A;  5AVB B;  4WU9 D;  1KX5 D;  3B6G A;  5GT3 A;  3X1T A;  5DNN A;  4J8W A;  2XD5 A;  2Y2G A;  4WJ3 C;  3VH5 W;  2JCH A;  5AV5 C;  5AV8 A;  1TZY A;  4Z2M G;  5B0Y C;  3KXB C;  1P3B D;  2NZD C;  4J8X D;  4Z66 B;  4Z2M H;  5CPJ D;  5B0Z C;  2PYO A;  5BO0 B;  1P3O A;  5CPK D;  1P3F C;  4LD9 D;  2Y2Q A;  1M1A C;  5B32 D;  4CAY B;  1AOI B;  5GSU B;  4J8U C;  2Y2M A;  4AWL B;  1P3A C;  4J8V D;  5B32 G;  3MGR A;  2FJ7 C;  2ARO D;  2BYK A;  3X1U D;  3AV1 B;  3KSY A;  1P3L B;  3V9R A;  5GT0 D;  3REL B;  3LEL B;  1F66 D;  5B40 D;  1WWI A;  5CP6 D;  3F6T A;  3LZ0 B;  1P3G B;  5GXQ B;  3W97 B;  3TU4 D;  3B6G B;  3X1T B;  1P3M A;  3B0D B;  5C3I C;  3VH6 W;  5AV9 D;  1BH8 A; 
#chains in the Genus database with same CATH homology
 5FUG A;  1M18 D;  4Z66 C;  5AV8 B;  1TZY B;  3EPL A;  1S32 D;  5JRG A;  3MGS D;  4DQY B;  3UTB A;  4H9P A;  2CV5 D;  1AOI C;  5GSU C;  2Y2L A;  1P3O B;  4AWL C;  1TAF A;  4H9S C;  4UPK A;  3UT9 A;  3AZI C;  1P3L C;  3W98 D;  1HTA A;  3REL C;  1KX3 D;  3LEL C;  5AVC D;  1A7W A;  5B33 D;  5B2I D;  3LZ0 C;  3V9R B;  4WU8 D;  4CSR B;  1P3G C;  2ZY4 A;  5GXQ C;  5B1M D;  5AV6 A;  3C1C D;  3WTP D;  4R8P A;  3B6G C;  5GT3 C;  3X1T C;  5DNN C;  1JFI A;  4YM6 A;  3AV2 A;  3A1K A;  3X1V D;  3LZ1 A;  5AV8 C;  1P3M B;  1TZY C;  5AV5 D;  3NQJ B;  1P34 B;  3AZE A;  4G91 B;  4KUD A;  5G49 A;  3VH6 T;  1BH8 B;  3AZJ B;  5FUG B;  3AZM D;  5B2J D;  2PYO C;  5JRG B;  3AZL A;  4ZBJ B;  1P3O C;  3X1S A;  4H9O A;  3MGP A;  2JE5 A;  4H9P B;  1P3F D;  3O62 D;  3AFA A;  1TAF B;  3W96 D;  4XZQ A;  3MGR C;  4E45 A;  4KHA A;  1M19 A;  2HUE B;  3UT9 B;  1P3P D;  5AVB A;  4YS3 D;  3WAA A;  3REJ D;  2Y2J A;  5E5A A;  5AV6 B;  3MGQ D;  4XUJ D;  4R8P B;  3AZN A;  3A6N A;  1P3M C;  1JFI B;  4YM6 B;  4G91 C;  3AV2 B;  3AZK D;  5BO0 A;  4NFT A;  3LZ1 B;  1ID3 A;  1HQ3 A;  5JRG C;  3AZE B;  4KUD B;  4ZBJ C;  5G49 B;  3AN2 A;  3UTB C;  1BFM A;  5F99 A;  5AY8 D;  3R45 B;  1P3K D;  3AZL B;  2ZY5 A;  4H9O B;  3X1S B;  3MGP B;  1AOI D;  3MNN A;  4ZUX B;  4QLC A;  3C1B A;  3KWQ D;  3AV1 A;  3VH6 A;  3AFA B;  3LJA A;  3REI A;  2HUE C;  3UT9 C;  2G5H C;  4XZQ B;  4X23 A;  5DNM A;  3AZI D;  1P3L D;  4KHA B;  3MVD B;  3KUY A;  3WAA B;  3AZG A;  3W97 A;  3UTA D;  5AV6 C;  4R8P C;  2ZM5 A;  5GXQ D;  1U35 A;  5E5A B;  4YM6 C;  3B6G D;  3AV2 C;  5GT3 D;  5DNN D;  4J8W D;  3B6F D;  1KX4 D;  3W99 A;  4Z5T D;  3LZ1 C;  4KGC D;  3AZN B;  3A6N B;  3AZE C;  1KU5 A;  4KUD C;  2F8N D;  2HIO D;  4NE3 A;  1ID3 B;  1HQ3 B;  4WU9 A;  2RVQ C;  4UUZ A;  3AZL C;  3X1S C;  3MGP C;  5CPI A;  2F8N G;  2BYM B;  2PYO D;  3AN2 B;  5F99 B;  2F8N H;  3AFA C;  1P3I A;  3MNN B;  1ZLA D;  4QLC B;  4XZQ C;  3A1I A;  3C1B B;  1P3B A;  5B31 B;  4J8X A;  1M19 C;  4CSR A;  3MVD C;  3LJA B;  3REI B;  5CPJ A;  2NQB D;  3MGR D;  3WAA C;  5AVB C;  3FDD A;  4X23 B;  5DNM B;  5CPK A;  4LD9 A;  3KUY B;  5B32 A;  4JJN D;  3AZG B;  5E5A C;  5B1L B;  2W8S A;  3NQJ A;  1P34 A;  4J8V A;  3WKJ D;  3AZN C;  3A6N C;  1U35 B;  3AZJ A;  2ARO A;  1W2E A;  3VH5 T;  2JSS A;  3REH D;  3W99 B;  5GT0 A;  1ID3 C;  3AZH D;  5B24 D;  1HQ3 C;  5B40 A;  5CP6 A;  3AN2 C;  5F99 C;  4WU9 B;  3UTB D;  4UUZ B;  3TU4 A;  1KX5 B;  2Y2O A;  5CPI B;  2L5A A;  3MNN C;  3AZF D;  1EQZ D;  4QLC C;  1R4V A;  5AV9 A;  3C1B C;  3AV1 C;  4G92 B;  1M18 A;  3LJA C;  3REI C;  1P3I B;  1S32 A;  3WA9 D;  2LY8 A;  5CHL B;  4X23 C;  5DNM C;  1P3B B;  3REK D;  1Q9C A;  4J8X B;  5CPJ B;  3KUY C;  4H9Q A;  2CV5 A;  3AZG C;  3W97 C;  5CPK B;  4LD9 B;  3B0D C;  5B32 B;  5BT1 C;  3H0M C;  1U35 C;  2IO5 B;  4R8P D;  3W98 A;  3W99 C;  4J8V B;  1KX3 A;  5AVC A;  2ARO B;  2DF4 C;  5B0Y D;  3R45 A;  3KXB D;  5B2I A;  4WU8 A;  5GT0 B;  3AZE D;  2NZD D;  4EO5 B;  5B1M A;  5B0Z D;  5B40 B;  3C1C A;  4WU9 C;  5CP6 B;  1KX5 C;  4ZUX A;  5CPI C;  3H0R C;  2RVQ D;  1M1A D;  3VH5 A;  4G92 C;  5JA4 A;  4J8U D;  3TU4 B;  2BG1 A;  1P3I C;  1P3A D;  3MVD A;  5AV9 B;  1P3B C;  4DRB A;  2FJ7 D;  4J8X C;  1M18 B;  3AZM A;  5CPJ C;  5B2J A;  1S32 B;  1M19 D;  1N1J A;  3MGS B;  4H9N A;  5CPK C;  4LD9 C;  5AVB D;  3AYW A;  5B32 C;  2DQN C;  4H9Q B;  2CV5 B;  2IO5 C;  3O62 A;  2CWE A;  3P5J B;  2ZY3 A;  4J8V C;  3W96 A;  1P34 C;  3AZJ C;  2ARO C;  4YS3 A;  4M6B A;  3W98 B;  3REJ A;  5GT0 C;  4Z66 D;  4EO5 C;  1KX3 B;  5AVC B;  5B40 C;  2BYM A;  5B33 B;  5CP6 C;  5B2I B;  4WU8 B;  5B1M B;  3MGQ A;  3C1C B;  3WTP B;  4XUJ A;  5GSU D;  3TU4 C;  5F99 D;  3AN2 D;  3WTP E;  2FFF B;  5B31 A;  3B0C W;  5AV9 C;  3AZK A;  3MNN D;  5JA4 B;  3X1V B;  1M18 C;  3AV1 D;  1S32 C;  3REL D;  3MGS C;  3LEL D;  1T3U A;  3AZM B;  5B1L A;  5AY8 A;  5B2J B;  1P3K A;  2CV5 C;  3LZ0 D;  1N1J B;  1P3G D;  5KDM A;  4H9N B;  4H9R A;  3W97 D;  3NQU A;  3AYW B;  3X1T D;  1P3F B;  2Y2N A;  3KWQ A;  3O62 B;  1Z2C B;  1WWS A;  3W98 C;  3W96 B;  5AV8 D;  1KX3 C;  1TZY D;  5AVC C;  2Y2K A;  1P3P B;  4YS3 B;  5B2I C;  3REJ B;  4WU8 C;  3UTA A;  1KX5 A;  5B1M C;  2YFV B;  3C1C C;  1P3O D;  4ZUX C;  4HGA B;  3H0L C;  5CPI D;  3MGQ B;  4XUJ B;  3B6F A;  1KX4 A;  3X1V C;  4Z5T A;  4KGC A;  2Y2H A;  1P3I D;  2F8N A;  2HIO A;  5C3I B;  3AZK B;  3B0C T;  3EPK A;  3AZM C;  5B2J C;  4WNN A;  5AY8 B;  3AYW C;  1P3K B;  3O62 C;  5KDM B;  2Y2P A;  4H9R B;  1ZLA A;  3NQU B;  3W96 C;  5BS7 A;  3X1U A;  3KWQ B;  3EPJ A;  1P3M D;  1P34 D;  2NQB A;  1P3P C;  4YS3 C;  1F66 A;  3REJ C;  3AZJ D;  3AZI B;  5JRG D;  4HGA C;  4JJN A;  3UTA B;  3IP4 C;  3MGQ C;  4XUJ C;  3WKJ A;  5B31 C;  4NE6 A;  2YFW A;  5GT3 B;  5DNN B;  3AZK C;  4J8W B;  3REH A;  1KX4 B;  3B6F B;  4Z5T B;  4KGC B;  2J8P A;  3MGS A;  5B24 A;  3UT9 D;  3AZH A;  3KFU G;  5BNX A;  2F8N B;  2HIO B;  5B1L C;  5AY8 C;  3EPH A;  1P3K C;  4WNN B;  2PYO B;  5AV6 D;  3AZF A;  1EQZ A;  2F8N K;  3KWQ C;  4YM6 D;  3AV2 D;  3WA9 A;  5B33 A;  1ZLA B;  3LZ1 D;  3X1U B;  2F2A C;  3REK A;  4KUD D;  1BH9 A;  2NQB B;  3MGR B;  1F66 B;  2BYK B;  3WTP A;  3UTA C;  5BNV A;  3AZL D;  3X1S D;  3MGP D;  4JJN B;  3AL0 C;  3X1V A;  4ZUX D;  5AV5 A;  4J8W C;  1KX4 C;  3B6F C;  4Z5T C;  2UWX A;  3WKJ B;  3AFA D;  4KGC C;  3B0B A;  2YFW B;  5B0Y A;  3KXB A;  4XZQ D;  2HIO C;  3REH B;  2NZD A;  1B67 A;  3MVD D;  3AZH B;  5B0Z A;  5B24 B;  3WAA D;  5BNX B;  4WV4 B;  4E44 A;  1P3F A;  2VQR A;  1M1A A;  3UTB B;  5E5A D;  4J8U A;  3AYW D;  1H3O A;  2ZY2 A;  3AZF B;  1EQZ B;  1P3A A;  1ZLA C;  5BS7 C;  3X1U C;  3A6N D;  3AZN D;  2Y2I A;  1P3P A;  2FJ7 A;  1PZR A;  2NQB C;  1F66 C;  2YFV A;  3WA9 B;  1ID3 D;  1HQ3 D;  3REK B;  1B6W A;  1BH9 B;  4JJN C;  5BNV B;  3EG5 B;  3WKJ C;  4QLC D;  3C1B D;  5AV5 B;  3REH C;  5B31 D;  1ULY A;  4Z66 A;  3LJA D;  3REI D;  3AZH C;  5B24 C;  5B0Y B;  2RIQ A;  3KXB B;  4X23 D;  5DNM D;  2NZD B;  5B31 G;  2XD1 A;  4WZS B;  5B0Z B;  3KUY D;  4CAY A;  1AOI A;  4DRA A;  5GSU A;  3AZG D;  5B1L D;  2G5I C;  1F1E A;  3AZF C;  1EQZ C;  1M1A B;  4H9S A;  5BT1 D;  1U35 D;  4J8U B;  1H3O B;  3AZI A;  1P3L A;  3WA9 C;  3W99 D;  5B33 C;  1P3A B;  3REL A;  3LEL A;  3REK C;  2FJ7 B;  3LZ0 A;  3WTP C;  1M19 B;  1P3G A;  4NE5 A;  5GXQ A;  5AVB B;  4WU9 D;  1KX5 D;  3B6G A;  5GT3 A;  3X1T A;  5DNN A;  4J8W A;  2XD5 A;  2Y2G A;  4WJ3 C;  3VH5 W;  2JCH A;  5AV5 C;  5AV8 A;  1TZY A;  4Z2M G;  5B0Y C;  3KXB C;  1P3B D;  2NZD C;  4J8X D;  4Z66 B;  4Z2M H;  5CPJ D;  5B0Z C;  2PYO A;  5BO0 B;  1P3O A;  5CPK D;  1P3F C;  4LD9 D;  2Y2Q A;  1M1A C;  5B32 D;  4CAY B;  1AOI B;  5GSU B;  4J8U C;  2Y2M A;  4AWL B;  1P3A C;  4J8V D;  5B32 G;  3MGR A;  2FJ7 C;  2ARO D;  2BYK A;  3X1U D;  3AV1 B;  3KSY A;  1P3L B;  3V9R A;  5GT0 D;  3REL B;  3LEL B;  1F66 D;  5B40 D;  1WWI A;  5CP6 D;  3F6T A;  3LZ0 B;  1P3G B;  5GXQ B;  3W97 B;  3TU4 D;  3B6G B;  3X1T B;  1P3M A;  3B0D B;  5C3I C;  3VH6 W;  5AV9 D;  1BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...