3AZID

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziD00
2BYKA 1WWSA 3X1SA 4YM6C 4XUJC 4AWLB 2CV5D 1P3LC 1P3MA 3W98A 2HIOA 5B33B 2F8ND 4Z66B 1H3OB 3REID 3LJAD 5CPKC 1P3GB 4KGCD 3KUYC 1P3OC 2CV5C 3WTPB 2CWEA 4WV4B 3MGRC 3LJAC 4KGCC 4LD9D 3UTBC 1P3KA 4H9SA 4QLCD 3AV2D 3X1UB 3AV1A 4WU8A 3UT9D 4H9PA 4ZUXB 2BYMA 3AZID 4JJNA 2NZDB 5AVBB 5FUGB 1EQZB 1S32B 4QLCC 3AV2C 5CPJB 1M1AD 4CSRA 4YS3B 5B1LB 4WNNA 1KX3D 3AZIC 3WA9D 4WU9C 5AV6D 5E5AC 5B33A 1ZLAB 1KX3C 3KXBC 3WA9C 3B0CT 3X1VB 1H3OA 1KX4D 3B6FD 1P3GA 5GSUB 5B1MD 3W99D 4NFTA 3MGPC 3WTPA 1HQ3C 3AZJB 2IO5C 4Z5TB 1P3FD 5B31B 5BS7A 3B6FC 5B40B 3B0BA 3W97D 5B1MC 3LELA 1TAFB 3W99C 1P3AB 3X1UA 1P3FC 3UTAB 3W96B 3RELD 1EQZA 3AN2D 1S32A 3MVDD 5CPJA 3AFAC 5B1LA 1P3PA 5AY8B 3RELC 4KUDD 1TZYA 5B24A 3LZ1B 1BH9A 3O62C 3MGSB 3KSYA 1ZLAA 5AV9B 3AZHD 4KUDC 3X1VA 4J8XC 4H9QA 5GSUA 5GT3B 3AZFB 3X1TC 5B31A 3AZHC 5CPID 1B6WA 5B40A 3MGQD 3AZMB 1P34C 4XZQB 2AROB 5B2JB 1P3AC 1TAFA 4NE3A 4J8UD 1P3IC 5B2IA 3UTAA 5CPIC 3B6GB 3AYWD 3A6ND 3AZND 2BYKB 3X1SB 1F66A 5GXQD 4J8UC 2HIOB 5AV5D 1ID3B 5AY8A 4DRBA 5C3IC 5B0YD 4J8WC 3AYWC 5AVCD 4M6BA 3REHD 5AV5C 5GT0A 3MNNA 4E44A 5DNNB 4Z2MG 5AV9A 4H9NB 1AOIB 5AV8D 5CP6A 5B0YC 3C1CD 2FJ7A 5GT3C 5F99D 4X23D 3LZ0D 3AZFA 4KHAB 1M19D 2L5AA 3AV1B 4EO5B 1U35D 5AV8C 4ZBJB 3C1CC 3AZMA 1M18D 4XZQA 2AROA 5B2JA 5F99C 5JRGC 3AZGB 4X23C 3REKB 1P3MD 4YM6D 3W98D 4XUJD 2NQBA 1P3BD 3KWQD 5B0ZB 1U35C 3B6GA 5CPKD 5BNXB 1P3MC 3KUYD 1P3OD 3W98C 1P3BC 3KWQC 3REIB 1ID3A 3C1BB 3MGRD 3UTBD 2PYOD 4WU8D 4G91B 4R8PD 4Z2MH 5DNNA 4H9NA 1AOIA 4LD9B 3WAAD 1ULYA 1P3KC 2JSSA 3LELB 3WKJD 3NQJB 4KHAA 2PYOC 4WU8C 4R8PC 1KX5D 1HTAA 4JJNC 3WAAC 4WU9D 3NQUB 3AZGA 3WKJC 3REKA 1M1AB 5E5AD 1BH8B 5B0ZA 1KX5C 4HGAC 5B31G 5AV6B 4Z66D 1P3PB 3KXBD 1P3GD 1TZYB 4NE6A 5B24B 5BNXA 4AWLC 4G92B 5B33C 3MGPD 1BH9B 1HQ3D 1KX4B 3REIA 3C1BA 4Z66C 1P3GC 4H9QB 3WTPC 3X1UD 5BS7C 4ZUXD 3W97B 4LD9A 2NZDD 5AVBD 2YFVB 4QLCA 4DRAA 5CPJD 3X1UC 3NQJA 3UT9A 3R45B 3AFAD 4YS3D 5B2IB 4ZUXC 2NZDC 5AVBC 3AN2B 1EQZC 3AZKB 3MVDB 3NQUA 3VH6W 1JFIA 3AZEB 1S32C 1M1AA 5CPJC 1F66B 3O62D 4YS3C 3REJB 1BH8A 5B1LC 1P3PC 1KX3A 1ZLAD 3WA9A 5AV6A 3X1VD 1WWIA 5GSUD 4J8XD 2HUEB 3AZJD 4Z5TD 5B31D 1ZLAC 1KX4A 3X1TD 3MNNB 5GT0B 1A7WA 3X1VC 5CP6B 5GSUC 1P34D 2FJ7B 3TU4B 1P3AD 3AZJC 4Z5TC 5B31C 1P3ID 3W97A 3MGQB 3W96D 5B40C 2YFVA 4H9OB 3R45A 3UTAC 2NQBB 3RELA 5G49A 3W96C 5AY8D 3A6NB 2F8NK 3AN2A 3AZNB 3AZLB 5KDMB 3LZ1D 3MVDA 4J8WD 3AZKA 5GXQB 3AZEA 5BT1D 3MGSD 1Q9CA 5DNMB 3REJA 4KUDA 5AY8C 4J8VB 3LZ1C 4UUZA 5GT3D 3AZFD 5BT1C 3MGSC 5GT0C 5AV9C 2FJ7C 3AZMD 2AROD 5B32B 4H9RA 3TU4A 1M19B 3B0DB 5JRGD 3AZFC 2F8NG 5CPIA 3MGQA 1M18B 3B6GD 3AZMC 4XZQC 2AROC 5B2JC 4YM6B 4XUJB 3X1SD 1P3LB 4H9OA 2HIOD 1ID3D 3A6NA 5CPKB 3B6GC 3AZNA 3AZLA 5KDMA 3KUYB 1P3OB 5GXQA 3X1SC 2CV5B 5DNMA 2HIOC 2F8NB 1ID3C 1AOID 3MGRB 3LJAB 5CHLB 4KGCB 4J8VA 3UTBB 5AVCA 3REHA 1P3KD 3AV1D 5DNNC 1AOIC 5F99A 4JJND 5B32A 3LZ0A 3AZGD 3REKD 1M19A 2RVQD 4QLCB 3AV2B 4H9SC 3UT9B 3AV1C 5B0ZD 4EO5C 4ZBJC 3AZIB 1M18A 4WU9B 1BFMA 4YM6A 3AZGC 4CAYB 5E5AB 3REKC 2RVQC 4XUJA 1JFIB 1P3BA 1P3LA 3KWQA 5B33D 5B0ZC 3C1BD 1KX3B 3KXBB 3WA9B 5CPKA 3KUYA 1P3OA 3MGPB 2CV5A 1HQ3B 3WTPD 2IO5B 2F8NA 3REIC 3C1BC 3B6FB 3MGRA 3LJAA 4KGCA 3UTBA 5B1MB 3W99B 3LELD 2PYOA 5BNVB 1P3FB 4R8PA 4G91C 3WAAA 4LD9C 3WKJA 3LELC 1EQZD 3AV2A 3UT9C 3AFAB 1S32D 1KX5A 3RELB 5B1LD 5G49B 3AZIA 4WU9A 1P3PD 1TZYD 4CAYA 5E5AA 5B24D 3VH5W 1M1AC 1KU5A 3O62B 4Z66A 5AV6C 3KXBA 4KUDB 1TZYC 4J8XB 3VH5A 3VH6A 5B24C 3MGPA 4UUZB 4G92C 1HQ3A 3X1TB 1KX4C 3AZHB 3B6FA 5BO0B 1P34B 5B40D 5B1MA 3W99A 4H9RB 5BNVA 1P3FA 1P3IB 4ZUXA 5B2ID 2NZDA 3WTPE 3UTAD 2YFWB 5AVBA 5CPIB 5FUGA 3W97C 3AZKD 3AZED 4J8UB 3AFAA 4YS3A 1F66D 3REJD 5B2IC 5C3IB 4J8WB 3AYWB 3AN2C 3AZKC 3MVDC 3AZEC 5B32G 3O62A 1F66C 5AV5B 3REJC 3MNND 5GT0D 5AV9D 5B0YB 5CP6D 4J8XA 2FJ7D 3TU4D 3AZJA 2HUEC 4Z5TA 5AVCB 3B0CW 3REHB 3X1TA 3MNNC 3AZHA 5AV8B 3C1CB 5BO0A 1P34A 5CP6C 5F99B 1P3AA 5JRGB 5B2JD 1F1EA 1N1JB 4XZQD 4X23B 3LZ0B 3TU4C 1P3IA 3V9RB 2NQBD 3W96A 5JA4B 3MGQC 1U35B 2YFWA 3AZLD 1P3MB 4E45A 3W98B 4J8UA 5DNMD 2LY8A 1P3BB 3KWQB 2NQBC 3A6NC 3LZ1A 4J8WA 3AYWA 3AZLC 3AZNC 4J8VD 5GXQC 3MGSA 1B67A 4NE5A 5DNMC 5AV5A 5DNND 5B0YA 1R4VA 5GT3A 4J8VC 5B32D 5AVCC 1P3KB 3REHC 2PYOB 4WU8B 4R8PB 4H9PB 2BYMB 5AV8A 3C1CA 4JJNB 3WAAB 5B32C 3LZ0C 5JRGA 1N1JA 4X23A 1M19C 3B0DC 3WKJB 1P3LD 3V9RA 4CSRB 5JA4A 4WNNB 1KX5B 4HGAB 3VH5T 1U35A 1M18C 3VH6T 2F8NH 4WZSB
chains in the Genus database with same CATH superfamily
2BYKA 1WWSA 3X1SA 4YM6C 4XUJC 4AWLB 2CV5D 1P3LC 1P3MA 3W98A 2HIOA 5B33B 4WJ3C 2F8ND 4Z66B 1H3OB 3REID 3LJAD 5CPKC 1P3GB 4KGCD 2JCHA 3KUYC 1P3OC 2CV5C 3WTPB 3F6TA 2CWEA 2Y2PA 4WV4B 3MGRC 3LJAC 4KGCC 4LD9D 3UTBC 1P3KA 4H9SA 4QLCD 3AV2D 3X1UB 3AV1A 4WU8A 3UT9D 4H9PA 4ZUXB 2BYMA 3AZID 4JJNA 2NZDB 5AVBB 5FUGB 1EQZB 1S32B 4QLCC 3AV2C 5CPJB 1M1AD 4CSRA 4YS3B 5B1LB 4WNNA 1KX3D 3AZIC 3WA9D 4WU9C 5AV6D 5E5AC 2BG1A 5B33A 1ZLAB 1KX3C 3KXBC 3WA9C 3B0CT 2ZY5A 1H3OA 3X1VB 1KX4D 3B6FD 1P3GA 5GSUB 5B1MD 3W99D 4NFTA 3MGPC 3WTPA 1HQ3C 3AZJB 2IO5C 4Z5TB 1P3FD 5B31B 5BS7A 3B6FC 5B40B 3B0BA 3W97D 5B1MC 3LELA 1TAFB 3W99C 1P3AB 3X1UA 1P3FC 3UTAB 3W96B 3RELD 1EQZA 3AN2D 1S32A 3MVDD 5CPJA 3AFAC 5B1LA 1P3PA 5AY8B 3RELC 4KUDD 1TZYA 5B24A 3LZ1B 2Y2HA 1BH9A 3O62C 3MGSB 3KSYA 1ZLAA 5AV9B 3AZHD 4KUDC 3X1VA 2F2AC 4J8XC 4H9QA 5GSUA 5GT3B 3AZFB 3X1TC 5B31A 3AZHC 5CPID 1B6WA 5B40A 3MGQD 3AZMB 3A1IA 4XZQB 2AROB 5B2JB 1P34C 1P3AC 3EPHA 1TAFA 4NE3A 4J8UD 1P3IC 2Y2OA 2ZY3A 5B2IA 3UTAA 5CPIC 3B6GB 3AYWD 3A6ND 3H0LC 2Y2GA 3EPKA 3P5JB 3AZND 2BYKB 3X1SB 1F66A 5GXQD 4J8UC 2HIOB 5AV5D 1ID3B 5AY8A 4DRBA 5C3IC 5B0YD 4J8WC 3AYWC 2DF4C 1Z2CB 5AVCD 4M6BA 3REHD 5AV5C 5GT0A 3MNNA 4E44A 5DNNB 4Z2MG 5AV9A 4H9NB 1AOIB 5AV8D 5CP6A 5B0YC 3C1CD 2FJ7A 5GT3C 5F99D 4X23D 3LZ0D 3AZFA 4KHAB 1M19D 2L5AA 3AV1B 4EO5B 1U35D 5AV8C 4ZBJB 3C1CC 3AZMA 1M18D 4XZQA 2AROA 5B2JA 5F99C 5JRGC 3AZGB 4X23C 3REKB 1P3MD 4YM6D 2Y2MA 3W98D 4XUJD 2NQBA 1P3BD 3KWQD 5B0ZB 1U35C 3B6GA 1T3UA 5CPKD 2J8PA 5BNXB 1P3MC 3KUYD 1P3OD 3W98C 3EPJA 1P3BC 3KWQC 3REIB 1ID3A 3C1BB 3MGRD 3UTBD 2FFFB 2PYOD 4WU8D 4G91B 4R8PD 4Z2MH 5DNNA 4H9NA 1AOIA 4LD9B 3WAAD 1ULYA 1P3KC 2JSSA 3LELB 3WKJD 3NQJB 4KHAA 2PYOC 4WU8C 4R8PC 1KX5D 1HTAA 4JJNC 3WAAC 4WU9D 3NQUB 3AZGA 3WKJC 3REKA 1M1AB 5E5AD 2ZY2A 1BH8B 5B0ZA 1KX5C 4HGAC 5B31G 5AV6B 4Z66D 1P3PB 3KXBD 1P3GD 1TZYB 4NE6A 3KFUG 5B24B 5BNXA 4AWLC 4G92B 5B33C 3MGPD 1BH9B 1HQ3D 1KX4B 3REIA 3C1BA 2Y2KA 4Z66C 1P3GC 4H9QB 3H0RC 3WTPC 3X1UD 5BS7C 4ZUXD 3W97B 4LD9A 2NZDD 5AVBD 2YFVB 4QLCA 4DRAA 5CPJD 3X1UC 3NQJA 3UT9A 3R45B 3AFAD 4YS3D 5B2IB 4ZUXC 2NZDC 2ZM5A 5AVBC 3AN2B 1EQZC 3AZKB 3MVDB 3NQUA 3VH6W 1JFIA 3AZEB 1S32C 1M1AA 5CPJC 1F66B 3O62D 4YS3C 3REJB 1BH8A 5B1LC 1P3PC 1KX3A 1ZLAD 3WA9A 5AV6A 3X1VD 1WWIA 5GSUD 4J8XD 2Y2JA 2HUEB 3AZJD 4Z5TD 5B31D 1ZLAC 1KX4A 3X1TD 3MNNB 5GT0B 1A7WA 3X1VC 5CP6B 5GSUC 1P34D 2FJ7B 3TU4B 2Y2LA 1P3AD 2RIQA 3AZJC 4Z5TC 5B31C 1P3ID 3W97A 3MGQB 3W96D 5B40C 2YFVA 4H9OB 3R45A 3UTAC 2NQBB 3RELA 5G49A 3W96C 2XD1A 5AY8D 3A6NB 2F8NK 3AN2A 3AZNB 3AZLB 5KDMB 3LZ1D 1W2EA 3MVDA 4J8WD 5GXQB 3AZKA 3AZEA 5BT1D 3MGSD 1Q9CA 2Y2NA 5DNMB 3REJA 4KUDA 5AY8C 4J8VB 3LZ1C 4UUZA 5GT3D 2JE5A 3AZFD 2W8SA 3EG5B 5BT1C 3MGSC 5GT0C 5AV9C 2FJ7C 3AZMD 2AROD 5B32B 4H9RA 3TU4A 1M19B 3B0DB 5JRGD 3AZFC 2F8NG 5CPIA 3MGQA 1M18B 3B6GD 3AZMC 4XZQC 2AROC 5B2JC 4YM6B 4XUJB 3X1SD 1P3LB 4H9OA 2G5HC 2HIOD 1ID3D 3A6NA 5CPKB 3B6GC 3AZNA 3AZLA 5KDMA 3KUYB 1P3OB 5GXQA 3X1SC 2CV5B 5DNMA 2HIOC 2ZY4A 2F8NB 1ID3C 1AOID 3MGRB 3LJAB 5CHLB 4KGCB 4J8VA 3UTBB 5AVCA 3REHA 1P3KD 3AV1D 5DNNC 1AOIC 5F99A 4JJND 5B32A 3LZ0A 3AZGD 3REKD 2Y2IA 2RVQD 4QLCB 3AV2B 4H9SC 1M19A 3UT9B 3AV1C 5B0ZD 4EO5C 4ZBJC 3AZIB 1M18A 4WU9B 1BFMA 4YM6A 3EPLA 1PZRA 5E5AB 4CAYB 3REKC 2RVQC 4XUJA 3AZGC 1P3BA 1P3LA 3KWQA 1JFIB 5B33D 5B0ZC 3C1BD 1KX3B 3KXBB 3WA9B 5CPKA 3KUYA 1P3OA 3MGPB 2CV5A 1HQ3B 3WTPD 2IO5B 2F8NA 3REIC 3C1BC 3B6FB 3MGRA 3LJAA 4KGCA 3UTBA 5B1MB 3W99B 3LELD 2PYOA 5BNVB 1P3FB 4R8PA 4G91C 3WAAA 4LD9C 3WKJA 2VQRA 3LELC 1EQZD 3AV2A 3UT9C 3AFAB 1S32D 1KX5A 3RELB 5B1LD 5G49B 3AZIA 4WU9A 1P3PD 3AL0C 1TZYD 4CAYA 5E5AA 5B24D 3VH5W 1M1AC 1KU5A 3O62B 2XD5A 4Z66A 5AV6C 3KXBA 4KUDB 4UPKA 2Y2QA 1TZYC 4J8XB 3VH5A 3VH6A 5B24C 3MGPA 4UUZB 4G92C 1HQ3A 3X1TB 1KX4C 3AZHB 3B6FA 5BO0B 3IP4C 1P34B 5B40D 5B1MA 2DQNC 3W99A 4H9RB 5BNVA 1P3FA 1P3IB 4ZUXA 5B2ID 2NZDA 3WTPE 3UTAD 2YFWB 5AVBA 5CPIB 5FUGA 3W97C 3AZKD 3AZED 4J8UB 3AFAA 4YS3A 1F66D 3REJD 5B2IC 5C3IB 4J8WB 3AYWB 3AN2C 3AZKC 3MVDC 3FDDA 3AZEC 5B32G 3O62A 1F66C 5AV5B 3REJC 3MNND 5GT0D 5AV9D 5B0YB 5CP6D 4J8XA 2FJ7D 3TU4D 3AZJA 2HUEC 4Z5TA 5AVCB 3B0CW 3REHB 3X1TA 3MNNC 3AZHA 5AV8B 3C1CB 5BO0A 1P34A 5CP6C 5F99B 1P3AA 5JRGB 5B2JD 1F1EA 1N1JB 4XZQD 4X23B 3LZ0B 3TU4C 1P3IA 3V9RB 2NQBD 3W96A 5JA4B 3MGQC 1U35B 2YFWA 3AZLD 4DQYB 1P3MB 2UWXA 4E45A 3W98B 2G5IC 4J8UA 5DNMD 2LY8A 1P3BB 3KWQB 2NQBC 3A6NC 3LZ1A 4J8WA 3AYWA 3AZLC 3AZNC 4J8VD 5GXQC 3MGSA 1B67A 4NE5A 5DNMC 5AV5A 5DNND 5B0YA 1R4VA 5GT3A 4J8VC 5B32D 5AVCC 1P3KB 3REHC 3A1KA 2PYOB 4WU8B 4R8PB 4H9PB 2BYMB 5AV8A 3C1CA 4JJNB 3WAAB 5B32C 3LZ0C 5JRGA 1N1JA 4X23A 3H0MC 3B0DC 1M19C 1P3LD 3WKJB 3V9RA 4CSRB 5JA4A 4WNNB 1KX5B 4HGAB 3VH5T 1U35A 1M18C 3VH6T 2F8NH 4WZSB
chains in the Genus database with same CATH topology
2BYKA 1WWSA 3X1SA 4YM6C 4XUJC 4AWLB 2CV5D 1P3LC 1P3MA 3W98A 2HIOA 5B33B 4WJ3C 2F8ND 4Z66B 1H3OB 3REID 3LJAD 5CPKC 1P3GB 4KGCD 2JCHA 3KUYC 1P3OC 2CV5C 3WTPB 3F6TA 2CWEA 2Y2PA 4WV4B 3MGRC 3LJAC 4KGCC 4LD9D 3UTBC 1P3KA 4H9SA 4QLCD 3AV2D 3X1UB 3AV1A 4WU8A 3UT9D 4H9PA 4ZUXB 2BYMA 3AZID 4JJNA 2NZDB 5AVBB 5FUGB 1EQZB 1S32B 4QLCC 3AV2C 5CPJB 1M1AD 4CSRA 4YS3B 5B1LB 4WNNA 1KX3D 3AZIC 3WA9D 4WU9C 5AV6D 5E5AC 2BG1A 5B33A 1ZLAB 1KX3C 3KXBC 3WA9C 3B0CT 2ZY5A 1H3OA 3X1VB 1KX4D 3B6FD 1P3GA 5GSUB 5B1MD 3W99D 4NFTA 3MGPC 3WTPA 1HQ3C 3AZJB 2IO5C 4Z5TB 1P3FD 5B31B 5BS7A 3B6FC 5B40B 3B0BA 3W97D 5B1MC 3LELA 1TAFB 3W99C 1P3AB 3X1UA 1P3FC 3UTAB 3W96B 3RELD 1EQZA 3AN2D 1S32A 3MVDD 5CPJA 3AFAC 5B1LA 1P3PA 5AY8B 3RELC 4KUDD 1TZYA 5B24A 3LZ1B 2Y2HA 1BH9A 3O62C 3MGSB 3KSYA 1ZLAA 5AV9B 3AZHD 4KUDC 3X1VA 2F2AC 4J8XC 4H9QA 5GSUA 5GT3B 3AZFB 3X1TC 5B31A 3AZHC 5CPID 1B6WA 5B40A 3MGQD 3AZMB 3A1IA 4XZQB 2AROB 5B2JB 1P34C 1P3AC 3EPHA 1TAFA 4NE3A 4J8UD 1P3IC 2Y2OA 2ZY3A 5B2IA 3UTAA 5CPIC 3B6GB 3AYWD 3A6ND 3H0LC 2Y2GA 3EPKA 3P5JB 3AZND 2BYKB 3X1SB 1F66A 5GXQD 4J8UC 2HIOB 5AV5D 1ID3B 5AY8A 4DRBA 5C3IC 5B0YD 4J8WC 3AYWC 2DF4C 1Z2CB 5AVCD 4M6BA 3REHD 5AV5C 5GT0A 3MNNA 4E44A 5DNNB 4Z2MG 5AV9A 4H9NB 1AOIB 5AV8D 5CP6A 5B0YC 3C1CD 2FJ7A 5GT3C 5F99D 4X23D 3LZ0D 3AZFA 4KHAB 1M19D 2L5AA 3AV1B 4EO5B 1U35D 5AV8C 4ZBJB 3C1CC 3AZMA 1M18D 4XZQA 2AROA 5B2JA 5F99C 5JRGC 3AZGB 4X23C 3REKB 1P3MD 4YM6D 2Y2MA 3W98D 4XUJD 2NQBA 1P3BD 3KWQD 5B0ZB 1U35C 3B6GA 1T3UA 5CPKD 2J8PA 5BNXB 1P3MC 3KUYD 1P3OD 3W98C 3EPJA 1P3BC 3KWQC 3REIB 1ID3A 3C1BB 3MGRD 3UTBD 2FFFB 2PYOD 4WU8D 4G91B 4R8PD 4Z2MH 5DNNA 4H9NA 1AOIA 4LD9B 3WAAD 1ULYA 1P3KC 2JSSA 3LELB 3WKJD 3NQJB 4KHAA 2PYOC 4WU8C 4R8PC 1KX5D 1HTAA 4JJNC 3WAAC 4WU9D 3NQUB 3AZGA 3WKJC 3REKA 1M1AB 5E5AD 2ZY2A 1BH8B 5B0ZA 1KX5C 4HGAC 5B31G 5AV6B 4Z66D 1P3PB 3KXBD 1P3GD 1TZYB 4NE6A 3KFUG 5B24B 5BNXA 4AWLC 4G92B 5B33C 3MGPD 1BH9B 1HQ3D 1KX4B 3REIA 3C1BA 2Y2KA 4Z66C 1P3GC 4H9QB 3H0RC 3WTPC 3X1UD 5BS7C 4ZUXD 3W97B 4LD9A 2NZDD 5AVBD 2YFVB 4QLCA 4DRAA 5CPJD 3X1UC 3NQJA 3UT9A 3R45B 3AFAD 4YS3D 5B2IB 4ZUXC 2NZDC 2ZM5A 5AVBC 3AN2B 1EQZC 3AZKB 3MVDB 3NQUA 3VH6W 1JFIA 3AZEB 1S32C 1M1AA 5CPJC 1F66B 3O62D 4YS3C 3REJB 1BH8A 5B1LC 1P3PC 1KX3A 1ZLAD 3WA9A 5AV6A 3X1VD 1WWIA 5GSUD 4J8XD 2Y2JA 2HUEB 3AZJD 4Z5TD 5B31D 1ZLAC 1KX4A 3X1TD 3MNNB 5GT0B 1A7WA 3X1VC 5CP6B 5GSUC 1P34D 2FJ7B 3TU4B 2Y2LA 1P3AD 2RIQA 3AZJC 4Z5TC 5B31C 1P3ID 3W97A 3MGQB 3W96D 5B40C 2YFVA 4H9OB 3R45A 3UTAC 2NQBB 3RELA 5G49A 3W96C 2XD1A 5AY8D 3A6NB 2F8NK 3AN2A 3AZNB 3AZLB 5KDMB 3LZ1D 1W2EA 3MVDA 4J8WD 5GXQB 3AZKA 3AZEA 5BT1D 3MGSD 1Q9CA 2Y2NA 5DNMB 3REJA 4KUDA 5AY8C 4J8VB 3LZ1C 4UUZA 5GT3D 2JE5A 3AZFD 2W8SA 3EG5B 5BT1C 3MGSC 5GT0C 5AV9C 2FJ7C 3AZMD 2AROD 5B32B 4H9RA 3TU4A 1M19B 3B0DB 5JRGD 3AZFC 2F8NG 5CPIA 3MGQA 1M18B 3B6GD 3AZMC 4XZQC 2AROC 5B2JC 4YM6B 4XUJB 3X1SD 1P3LB 4H9OA 2G5HC 2HIOD 1ID3D 3A6NA 5CPKB 3B6GC 3AZNA 3AZLA 5KDMA 3KUYB 1P3OB 5GXQA 3X1SC 2CV5B 5DNMA 2HIOC 2ZY4A 2F8NB 1ID3C 1AOID 3MGRB 3LJAB 5CHLB 4KGCB 4J8VA 3UTBB 5AVCA 3REHA 1P3KD 3AV1D 5DNNC 1AOIC 5F99A 4JJND 5B32A 3LZ0A 3AZGD 3REKD 2Y2IA 2RVQD 4QLCB 3AV2B 4H9SC 1M19A 3UT9B 3AV1C 5B0ZD 4EO5C 4ZBJC 3AZIB 1M18A 4WU9B 1BFMA 4YM6A 3EPLA 1PZRA 5E5AB 4CAYB 3REKC 2RVQC 4XUJA 3AZGC 1P3BA 1P3LA 3KWQA 1JFIB 5B33D 5B0ZC 3C1BD 1KX3B 3KXBB 3WA9B 5CPKA 3KUYA 1P3OA 3MGPB 2CV5A 1HQ3B 3WTPD 2IO5B 2F8NA 3REIC 3C1BC 3B6FB 3MGRA 3LJAA 4KGCA 3UTBA 5B1MB 3W99B 3LELD 2PYOA 5BNVB 1P3FB 4R8PA 4G91C 3WAAA 4LD9C 3WKJA 2VQRA 3LELC 1EQZD 3AV2A 3UT9C 3AFAB 1S32D 1KX5A 3RELB 5B1LD 5G49B 3AZIA 4WU9A 1P3PD 3AL0C 1TZYD 4CAYA 5E5AA 5B24D 3VH5W 1M1AC 1KU5A 3O62B 2XD5A 4Z66A 5AV6C 3KXBA 4KUDB 4UPKA 2Y2QA 1TZYC 4J8XB 3VH5A 3VH6A 5B24C 3MGPA 4UUZB 4G92C 1HQ3A 3X1TB 1KX4C 3AZHB 3B6FA 5BO0B 3IP4C 1P34B 5B40D 5B1MA 2DQNC 3W99A 4H9RB 5BNVA 1P3FA 1P3IB 4ZUXA 5B2ID 2NZDA 3WTPE 3UTAD 2YFWB 5AVBA 5CPIB 5FUGA 3W97C 3AZKD 3AZED 4J8UB 3AFAA 4YS3A 1F66D 3REJD 5B2IC 5C3IB 4J8WB 3AYWB 3AN2C 3AZKC 3MVDC 3FDDA 3AZEC 5B32G 3O62A 1F66C 5AV5B 3REJC 3MNND 5GT0D 5AV9D 5B0YB 5CP6D 4J8XA 2FJ7D 3TU4D 3AZJA 2HUEC 4Z5TA 5AVCB 3B0CW 3REHB 3X1TA 3MNNC 3AZHA 5AV8B 3C1CB 5BO0A 1P34A 5CP6C 5F99B 1P3AA 5JRGB 5B2JD 1F1EA 1N1JB 4XZQD 4X23B 3LZ0B 3TU4C 1P3IA 3V9RB 2NQBD 3W96A 5JA4B 3MGQC 1U35B 2YFWA 3AZLD 4DQYB 1P3MB 2UWXA 4E45A 3W98B 2G5IC 4J8UA 5DNMD 2LY8A 1P3BB 3KWQB 2NQBC 3A6NC 3LZ1A 4J8WA 3AYWA 3AZLC 3AZNC 4J8VD 5GXQC 3MGSA 1B67A 4NE5A 5DNMC 5AV5A 5DNND 5B0YA 1R4VA 5GT3A 4J8VC 5B32D 5AVCC 1P3KB 3REHC 3A1KA 2PYOB 4WU8B 4R8PB 4H9PB 2BYMB 5AV8A 3C1CA 4JJNB 3WAAB 5B32C 3LZ0C 5JRGA 1N1JA 4X23A 3H0MC 3B0DC 1M19C 1P3LD 3WKJB 3V9RA 4CSRB 5JA4A 4WNNB 1KX5B 4HGAB 3VH5T 1U35A 1M18C 3VH6T 2F8NH 4WZSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK A;  1WWS A;  3X1S A;  4YM6 C;  4XUJ C;  4AWL B;  2CV5 D;  1P3L C;  1P3M A;  3W98 A;  2HIO A;  5B33 B;  2F8N D;  4Z66 B;  1H3O B;  3REI D;  3LJA D;  5CPK C;  1P3G B;  4KGC D;  3KUY C;  1P3O C;  2CV5 C;  3WTP B;  2CWE A;  4WV4 B;  3MGR C;  3LJA C;  4KGC C;  4LD9 D;  3UTB C;  1P3K A;  4H9S A;  4QLC D;  3AV2 D;  3X1U B;  3AV1 A;  4WU8 A;  3UT9 D;  4H9P A;  4ZUX B;  2BYM A;  3AZI D;  4JJN A;  2NZD B;  5AVB B;  5FUG B;  1EQZ B;  1S32 B;  4QLC C;  3AV2 C;  5CPJ B;  1M1A D;  4CSR A;  4YS3 B;  5B1L B;  4WNN A;  1KX3 D;  3AZI C;  3WA9 D;  4WU9 C;  5AV6 D;  5E5A C;  5B33 A;  1ZLA B;  1KX3 C;  3KXB C;  3WA9 C;  3B0C T;  3X1V B;  1H3O A;  1KX4 D;  3B6F D;  1P3G A;  5GSU B;  5B1M D;  3W99 D;  4NFT A;  3MGP C;  3WTP A;  1HQ3 C;  3AZJ B;  2IO5 C;  4Z5T B;  1P3F D;  5B31 B;  5BS7 A;  3B6F C;  5B40 B;  3B0B A;  3W97 D;  5B1M C;  3LEL A;  1TAF B;  3W99 C;  1P3A B;  3X1U A;  1P3F C;  3UTA B;  3W96 B;  3REL D;  1EQZ A;  3AN2 D;  1S32 A;  3MVD D;  5CPJ A;  3AFA C;  5B1L A;  1P3P A;  5AY8 B;  3REL C;  4KUD D;  1TZY A;  5B24 A;  3LZ1 B;  1BH9 A;  3O62 C;  3MGS B;  3KSY A;  1ZLA A;  5AV9 B;  3AZH D;  4KUD C;  3X1V A;  4J8X C;  4H9Q A;  5GSU A;  5GT3 B;  3AZF B;  3X1T C;  5B31 A;  3AZH C;  5CPI D;  1B6W A;  5B40 A;  3MGQ D;  3AZM B;  1P34 C;  4XZQ B;  2ARO B;  5B2J B;  1P3A C;  1TAF A;  4NE3 A;  4J8U D;  1P3I C;  5B2I A;  3UTA A;  5CPI C;  3B6G B;  3AYW D;  3A6N D;  3AZN D;  2BYK B;  3X1S B;  1F66 A;  5GXQ D;  4J8U C;  2HIO B;  5AV5 D;  1ID3 B;  5AY8 A;  4DRB A;  5C3I C;  5B0Y D;  4J8W C;  3AYW C;  5AVC D;  4M6B A;  3REH D;  5AV5 C;  5GT0 A;  3MNN A;  4E44 A;  5DNN B;  4Z2M G;  5AV9 A;  4H9N B;  1AOI B;  5AV8 D;  5CP6 A;  5B0Y C;  3C1C D;  2FJ7 A;  5GT3 C;  5F99 D;  4X23 D;  3LZ0 D;  3AZF A;  4KHA B;  1M19 D;  2L5A A;  3AV1 B;  4EO5 B;  1U35 D;  5AV8 C;  4ZBJ B;  3C1C C;  3AZM A;  1M18 D;  4XZQ A;  2ARO A;  5B2J A;  5F99 C;  5JRG C;  3AZG B;  4X23 C;  3REK B;  1P3M D;  4YM6 D;  3W98 D;  4XUJ D;  2NQB A;  1P3B D;  3KWQ D;  5B0Z B;  1U35 C;  3B6G A;  5CPK D;  5BNX B;  1P3M C;  3KUY D;  1P3O D;  3W98 C;  1P3B C;  3KWQ C;  3REI B;  1ID3 A;  3C1B B;  3MGR D;  3UTB D;  2PYO D;  4WU8 D;  4G91 B;  4R8P D;  4Z2M H;  5DNN A;  4H9N A;  1AOI A;  4LD9 B;  3WAA D;  1ULY A;  1P3K C;  2JSS A;  3LEL B;  3WKJ D;  3NQJ B;  4KHA A;  2PYO C;  4WU8 C;  4R8P C;  1KX5 D;  1HTA A;  4JJN C;  3WAA C;  4WU9 D;  3NQU B;  3AZG A;  3WKJ C;  3REK A;  1M1A B;  5E5A D;  1BH8 B;  5B0Z A;  1KX5 C;  4HGA C;  5B31 G;  5AV6 B;  4Z66 D;  1P3P B;  3KXB D;  1P3G D;  1TZY B;  4NE6 A;  5B24 B;  5BNX A;  4AWL C;  4G92 B;  5B33 C;  3MGP D;  1BH9 B;  1HQ3 D;  1KX4 B;  3REI A;  3C1B A;  4Z66 C;  1P3G C;  4H9Q B;  3WTP C;  3X1U D;  5BS7 C;  4ZUX D;  3W97 B;  4LD9 A;  2NZD D;  5AVB D;  2YFV B;  4QLC A;  4DRA A;  5CPJ D;  3X1U C;  3NQJ A;  3UT9 A;  3R45 B;  3AFA D;  4YS3 D;  5B2I B;  4ZUX C;  2NZD C;  5AVB C;  3AN2 B;  1EQZ C;  3AZK B;  3MVD B;  3NQU A;  3VH6 W;  1JFI A;  3AZE B;  1S32 C;  1M1A A;  5CPJ C;  1F66 B;  3O62 D;  4YS3 C;  3REJ B;  1BH8 A;  5B1L C;  1P3P C;  1KX3 A;  1ZLA D;  3WA9 A;  5AV6 A;  3X1V D;  1WWI A;  5GSU D;  4J8X D;  2HUE B;  3AZJ D;  4Z5T D;  5B31 D;  1ZLA C;  1KX4 A;  3X1T D;  3MNN B;  5GT0 B;  1A7W A;  3X1V C;  5CP6 B;  5GSU C;  1P34 D;  2FJ7 B;  3TU4 B;  1P3A D;  3AZJ C;  4Z5T C;  5B31 C;  1P3I D;  3W97 A;  3MGQ B;  3W96 D;  5B40 C;  2YFV A;  4H9O B;  3R45 A;  3UTA C;  2NQB B;  3REL A;  5G49 A;  3W96 C;  5AY8 D;  3A6N B;  2F8N K;  3AN2 A;  3AZN B;  3AZL B;  5KDM B;  3LZ1 D;  3MVD A;  4J8W D;  3AZK A;  5GXQ B;  3AZE A;  5BT1 D;  3MGS D;  1Q9C A;  5DNM B;  3REJ A;  4KUD A;  5AY8 C;  4J8V B;  3LZ1 C;  4UUZ A;  5GT3 D;  3AZF D;  5BT1 C;  3MGS C;  5GT0 C;  5AV9 C;  2FJ7 C;  3AZM D;  2ARO D;  5B32 B;  4H9R A;  3TU4 A;  1M19 B;  3B0D B;  5JRG D;  3AZF C;  2F8N G;  5CPI A;  3MGQ A;  1M18 B;  3B6G D;  3AZM C;  4XZQ C;  2ARO C;  5B2J C;  4YM6 B;  4XUJ B;  3X1S D;  1P3L B;  4H9O A;  2HIO D;  1ID3 D;  3A6N A;  5CPK B;  3B6G C;  3AZN A;  3AZL A;  5KDM A;  3KUY B;  1P3O B;  5GXQ A;  3X1S C;  2CV5 B;  5DNM A;  2HIO C;  2F8N B;  1ID3 C;  1AOI D;  3MGR B;  3LJA B;  5CHL B;  4KGC B;  4J8V A;  3UTB B;  5AVC A;  3REH A;  1P3K D;  3AV1 D;  5DNN C;  1AOI C;  5F99 A;  4JJN D;  5B32 A;  3LZ0 A;  3AZG D;  3REK D;  1M19 A;  2RVQ D;  4QLC B;  3AV2 B;  4H9S C;  3UT9 B;  3AV1 C;  5B0Z D;  4EO5 C;  4ZBJ C;  3AZI B;  1M18 A;  4WU9 B;  1BFM A;  4YM6 A;  3AZG C;  4CAY B;  5E5A B;  3REK C;  2RVQ C;  4XUJ A;  1JFI B;  1P3B A;  1P3L A;  3KWQ A;  5B33 D;  5B0Z C;  3C1B D;  1KX3 B;  3KXB B;  3WA9 B;  5CPK A;  3KUY A;  1P3O A;  3MGP B;  2CV5 A;  1HQ3 B;  3WTP D;  2IO5 B;  2F8N A;  3REI C;  3C1B C;  3B6F B;  3MGR A;  3LJA A;  4KGC A;  3UTB A;  5B1M B;  3W99 B;  3LEL D;  2PYO A;  5BNV B;  1P3F B;  4R8P A;  4G91 C;  3WAA A;  4LD9 C;  3WKJ A;  3LEL C;  1EQZ D;  3AV2 A;  3UT9 C;  3AFA B;  1S32 D;  1KX5 A;  3REL B;  5B1L D;  5G49 B;  3AZI A;  4WU9 A;  1P3P D;  1TZY D;  4CAY A;  5E5A A;  5B24 D;  3VH5 W;  1M1A C;  1KU5 A;  3O62 B;  4Z66 A;  5AV6 C;  3KXB A;  4KUD B;  1TZY C;  4J8X B;  3VH5 A;  3VH6 A;  5B24 C;  3MGP A;  4UUZ B;  4G92 C;  1HQ3 A;  3X1T B;  1KX4 C;  3AZH B;  3B6F A;  5BO0 B;  1P34 B;  5B40 D;  5B1M A;  3W99 A;  4H9R B;  5BNV A;  1P3F A;  1P3I B;  4ZUX A;  5B2I D;  2NZD A;  3WTP E;  3UTA D;  2YFW B;  5AVB A;  5CPI B;  5FUG A;  3W97 C;  3AZK D;  3AZE D;  4J8U B;  3AFA A;  4YS3 A;  1F66 D;  3REJ D;  5B2I C;  5C3I B;  4J8W B;  3AYW B;  3AN2 C;  3AZK C;  3MVD C;  3AZE C;  5B32 G;  3O62 A;  1F66 C;  5AV5 B;  3REJ C;  3MNN D;  5GT0 D;  5AV9 D;  5B0Y B;  5CP6 D;  4J8X A;  2FJ7 D;  3TU4 D;  3AZJ A;  2HUE C;  4Z5T A;  5AVC B;  3B0C W;  3REH B;  3X1T A;  3MNN C;  3AZH A;  5AV8 B;  3C1C B;  5BO0 A;  1P34 A;  5CP6 C;  5F99 B;  1P3A A;  5JRG B;  5B2J D;  1F1E A;  1N1J B;  4XZQ D;  4X23 B;  3LZ0 B;  3TU4 C;  1P3I A;  3V9R B;  2NQB D;  3W96 A;  5JA4 B;  3MGQ C;  1U35 B;  2YFW A;  3AZL D;  1P3M B;  4E45 A;  3W98 B;  4J8U A;  5DNM D;  2LY8 A;  1P3B B;  3KWQ B;  2NQB C;  3A6N C;  3LZ1 A;  4J8W A;  3AYW A;  3AZL C;  3AZN C;  4J8V D;  5GXQ C;  3MGS A;  1B67 A;  4NE5 A;  5DNM C;  5AV5 A;  5DNN D;  5B0Y A;  1R4V A;  5GT3 A;  4J8V C;  5B32 D;  5AVC C;  1P3K B;  3REH C;  2PYO B;  4WU8 B;  4R8P B;  4H9P B;  2BYM B;  5AV8 A;  3C1C A;  4JJN B;  3WAA B;  5B32 C;  3LZ0 C;  5JRG A;  1N1J A;  4X23 A;  1M19 C;  3B0D C;  3WKJ B;  1P3L D;  3V9R A;  4CSR B;  5JA4 A;  4WNN B;  1KX5 B;  4HGA B;  3VH5 T;  1U35 A;  1M18 C;  3VH6 T;  2F8N H;  4WZS B; 
#chains in the Genus database with same CATH topology
 2BYK A;  1WWS A;  3X1S A;  4YM6 C;  4XUJ C;  4AWL B;  2CV5 D;  1P3L C;  1P3M A;  3W98 A;  2HIO A;  5B33 B;  4WJ3 C;  2F8N D;  4Z66 B;  1H3O B;  3REI D;  3LJA D;  5CPK C;  1P3G B;  4KGC D;  2JCH A;  3KUY C;  1P3O C;  2CV5 C;  3WTP B;  3F6T A;  2CWE A;  2Y2P A;  4WV4 B;  3MGR C;  3LJA C;  4KGC C;  4LD9 D;  3UTB C;  1P3K A;  4H9S A;  4QLC D;  3AV2 D;  3X1U B;  3AV1 A;  4WU8 A;  3UT9 D;  4H9P A;  4ZUX B;  2BYM A;  3AZI D;  4JJN A;  2NZD B;  5AVB B;  5FUG B;  1EQZ B;  1S32 B;  4QLC C;  3AV2 C;  5CPJ B;  1M1A D;  4CSR A;  4YS3 B;  5B1L B;  4WNN A;  1KX3 D;  3AZI C;  3WA9 D;  4WU9 C;  5AV6 D;  5E5A C;  2BG1 A;  5B33 A;  1ZLA B;  1KX3 C;  3KXB C;  3WA9 C;  3B0C T;  2ZY5 A;  1H3O A;  3X1V B;  1KX4 D;  3B6F D;  1P3G A;  5GSU B;  5B1M D;  3W99 D;  4NFT A;  3MGP C;  3WTP A;  1HQ3 C;  3AZJ B;  2IO5 C;  4Z5T B;  1P3F D;  5B31 B;  5BS7 A;  3B6F C;  5B40 B;  3B0B A;  3W97 D;  5B1M C;  3LEL A;  1TAF B;  3W99 C;  1P3A B;  3X1U A;  1P3F C;  3UTA B;  3W96 B;  3REL D;  1EQZ A;  3AN2 D;  1S32 A;  3MVD D;  5CPJ A;  3AFA C;  5B1L A;  1P3P A;  5AY8 B;  3REL C;  4KUD D;  1TZY A;  5B24 A;  3LZ1 B;  2Y2H A;  1BH9 A;  3O62 C;  3MGS B;  3KSY A;  1ZLA A;  5AV9 B;  3AZH D;  4KUD C;  3X1V A;  2F2A C;  4J8X C;  4H9Q A;  5GSU A;  5GT3 B;  3AZF B;  3X1T C;  5B31 A;  3AZH C;  5CPI D;  1B6W A;  5B40 A;  3MGQ D;  3AZM B;  3A1I A;  4XZQ B;  2ARO B;  5B2J B;  1P34 C;  1P3A C;  3EPH A;  1TAF A;  4NE3 A;  4J8U D;  1P3I C;  2Y2O A;  2ZY3 A;  5B2I A;  3UTA A;  5CPI C;  3B6G B;  3AYW D;  3A6N D;  3H0L C;  2Y2G A;  3EPK A;  3P5J B;  3AZN D;  2BYK B;  3X1S B;  1F66 A;  5GXQ D;  4J8U C;  2HIO B;  5AV5 D;  1ID3 B;  5AY8 A;  4DRB A;  5C3I C;  5B0Y D;  4J8W C;  3AYW C;  2DF4 C;  1Z2C B;  5AVC D;  4M6B A;  3REH D;  5AV5 C;  5GT0 A;  3MNN A;  4E44 A;  5DNN B;  4Z2M G;  5AV9 A;  4H9N B;  1AOI B;  5AV8 D;  5CP6 A;  5B0Y C;  3C1C D;  2FJ7 A;  5GT3 C;  5F99 D;  4X23 D;  3LZ0 D;  3AZF A;  4KHA B;  1M19 D;  2L5A A;  3AV1 B;  4EO5 B;  1U35 D;  5AV8 C;  4ZBJ B;  3C1C C;  3AZM A;  1M18 D;  4XZQ A;  2ARO A;  5B2J A;  5F99 C;  5JRG C;  3AZG B;  4X23 C;  3REK B;  1P3M D;  4YM6 D;  2Y2M A;  3W98 D;  4XUJ D;  2NQB A;  1P3B D;  3KWQ D;  5B0Z B;  1U35 C;  3B6G A;  1T3U A;  5CPK D;  2J8P A;  5BNX B;  1P3M C;  3KUY D;  1P3O D;  3W98 C;  3EPJ A;  1P3B C;  3KWQ C;  3REI B;  1ID3 A;  3C1B B;  3MGR D;  3UTB D;  2FFF B;  2PYO D;  4WU8 D;  4G91 B;  4R8P D;  4Z2M H;  5DNN A;  4H9N A;  1AOI A;  4LD9 B;  3WAA D;  1ULY A;  1P3K C;  2JSS A;  3LEL B;  3WKJ D;  3NQJ B;  4KHA A;  2PYO C;  4WU8 C;  4R8P C;  1KX5 D;  1HTA A;  4JJN C;  3WAA C;  4WU9 D;  3NQU B;  3AZG A;  3WKJ C;  3REK A;  1M1A B;  5E5A D;  2ZY2 A;  1BH8 B;  5B0Z A;  1KX5 C;  4HGA C;  5B31 G;  5AV6 B;  4Z66 D;  1P3P B;  3KXB D;  1P3G D;  1TZY B;  4NE6 A;  3KFU G;  5B24 B;  5BNX A;  4AWL C;  4G92 B;  5B33 C;  3MGP D;  1BH9 B;  1HQ3 D;  1KX4 B;  3REI A;  3C1B A;  2Y2K A;  4Z66 C;  1P3G C;  4H9Q B;  3H0R C;  3WTP C;  3X1U D;  5BS7 C;  4ZUX D;  3W97 B;  4LD9 A;  2NZD D;  5AVB D;  2YFV B;  4QLC A;  4DRA A;  5CPJ D;  3X1U C;  3NQJ A;  3UT9 A;  3R45 B;  3AFA D;  4YS3 D;  5B2I B;  4ZUX C;  2NZD C;  2ZM5 A;  5AVB C;  3AN2 B;  1EQZ C;  3AZK B;  3MVD B;  3NQU A;  3VH6 W;  1JFI A;  3AZE B;  1S32 C;  1M1A A;  5CPJ C;  1F66 B;  3O62 D;  4YS3 C;  3REJ B;  1BH8 A;  5B1L C;  1P3P C;  1KX3 A;  1ZLA D;  3WA9 A;  5AV6 A;  3X1V D;  1WWI A;  5GSU D;  4J8X D;  2Y2J A;  2HUE B;  3AZJ D;  4Z5T D;  5B31 D;  1ZLA C;  1KX4 A;  3X1T D;  3MNN B;  5GT0 B;  1A7W A;  3X1V C;  5CP6 B;  5GSU C;  1P34 D;  2FJ7 B;  3TU4 B;  2Y2L A;  1P3A D;  2RIQ A;  3AZJ C;  4Z5T C;  5B31 C;  1P3I D;  3W97 A;  3MGQ B;  3W96 D;  5B40 C;  2YFV A;  4H9O B;  3R45 A;  3UTA C;  2NQB B;  3REL A;  5G49 A;  3W96 C;  2XD1 A;  5AY8 D;  3A6N B;  2F8N K;  3AN2 A;  3AZN B;  3AZL B;  5KDM B;  3LZ1 D;  1W2E A;  3MVD A;  4J8W D;  5GXQ B;  3AZK A;  3AZE A;  5BT1 D;  3MGS D;  1Q9C A;  2Y2N A;  5DNM B;  3REJ A;  4KUD A;  5AY8 C;  4J8V B;  3LZ1 C;  4UUZ A;  5GT3 D;  2JE5 A;  3AZF D;  2W8S A;  3EG5 B;  5BT1 C;  3MGS C;  5GT0 C;  5AV9 C;  2FJ7 C;  3AZM D;  2ARO D;  5B32 B;  4H9R A;  3TU4 A;  1M19 B;  3B0D B;  5JRG D;  3AZF C;  2F8N G;  5CPI A;  3MGQ A;  1M18 B;  3B6G D;  3AZM C;  4XZQ C;  2ARO C;  5B2J C;  4YM6 B;  4XUJ B;  3X1S D;  1P3L B;  4H9O A;  2G5H C;  2HIO D;  1ID3 D;  3A6N A;  5CPK B;  3B6G C;  3AZN A;  3AZL A;  5KDM A;  3KUY B;  1P3O B;  5GXQ A;  3X1S C;  2CV5 B;  5DNM A;  2HIO C;  2ZY4 A;  2F8N B;  1ID3 C;  1AOI D;  3MGR B;  3LJA B;  5CHL B;  4KGC B;  4J8V A;  3UTB B;  5AVC A;  3REH A;  1P3K D;  3AV1 D;  5DNN C;  1AOI C;  5F99 A;  4JJN D;  5B32 A;  3LZ0 A;  3AZG D;  3REK D;  2Y2I A;  2RVQ D;  4QLC B;  3AV2 B;  4H9S C;  1M19 A;  3UT9 B;  3AV1 C;  5B0Z D;  4EO5 C;  4ZBJ C;  3AZI B;  1M18 A;  4WU9 B;  1BFM A;  4YM6 A;  3EPL A;  1PZR A;  5E5A B;  4CAY B;  3REK C;  2RVQ C;  4XUJ A;  3AZG C;  1P3B A;  1P3L A;  3KWQ A;  1JFI B;  5B33 D;  5B0Z C;  3C1B D;  1KX3 B;  3KXB B;  3WA9 B;  5CPK A;  3KUY A;  1P3O A;  3MGP B;  2CV5 A;  1HQ3 B;  3WTP D;  2IO5 B;  2F8N A;  3REI C;  3C1B C;  3B6F B;  3MGR A;  3LJA A;  4KGC A;  3UTB A;  5B1M B;  3W99 B;  3LEL D;  2PYO A;  5BNV B;  1P3F B;  4R8P A;  4G91 C;  3WAA A;  4LD9 C;  3WKJ A;  2VQR A;  3LEL C;  1EQZ D;  3AV2 A;  3UT9 C;  3AFA B;  1S32 D;  1KX5 A;  3REL B;  5B1L D;  5G49 B;  3AZI A;  4WU9 A;  1P3P D;  3AL0 C;  1TZY D;  4CAY A;  5E5A A;  5B24 D;  3VH5 W;  1M1A C;  1KU5 A;  3O62 B;  2XD5 A;  4Z66 A;  5AV6 C;  3KXB A;  4KUD B;  4UPK A;  2Y2Q A;  1TZY C;  4J8X B;  3VH5 A;  3VH6 A;  5B24 C;  3MGP A;  4UUZ B;  4G92 C;  1HQ3 A;  3X1T B;  1KX4 C;  3AZH B;  3B6F A;  5BO0 B;  3IP4 C;  1P34 B;  5B40 D;  5B1M A;  2DQN C;  3W99 A;  4H9R B;  5BNV A;  1P3F A;  1P3I B;  4ZUX A;  5B2I D;  2NZD A;  3WTP E;  3UTA D;  2YFW B;  5AVB A;  5CPI B;  5FUG A;  3W97 C;  3AZK D;  3AZE D;  4J8U B;  3AFA A;  4YS3 A;  1F66 D;  3REJ D;  5B2I C;  5C3I B;  4J8W B;  3AYW B;  3AN2 C;  3AZK C;  3MVD C;  3FDD A;  3AZE C;  5B32 G;  3O62 A;  1F66 C;  5AV5 B;  3REJ C;  3MNN D;  5GT0 D;  5AV9 D;  5B0Y B;  5CP6 D;  4J8X A;  2FJ7 D;  3TU4 D;  3AZJ A;  2HUE C;  4Z5T A;  5AVC B;  3B0C W;  3REH B;  3X1T A;  3MNN C;  3AZH A;  5AV8 B;  3C1C B;  5BO0 A;  1P34 A;  5CP6 C;  5F99 B;  1P3A A;  5JRG B;  5B2J D;  1F1E A;  1N1J B;  4XZQ D;  4X23 B;  3LZ0 B;  3TU4 C;  1P3I A;  3V9R B;  2NQB D;  3W96 A;  5JA4 B;  3MGQ C;  1U35 B;  2YFW A;  3AZL D;  4DQY B;  1P3M B;  2UWX A;  4E45 A;  3W98 B;  2G5I C;  4J8U A;  5DNM D;  2LY8 A;  1P3B B;  3KWQ B;  2NQB C;  3A6N C;  3LZ1 A;  4J8W A;  3AYW A;  3AZL C;  3AZN C;  4J8V D;  5GXQ C;  3MGS A;  1B67 A;  4NE5 A;  5DNM C;  5AV5 A;  5DNN D;  5B0Y A;  1R4V A;  5GT3 A;  4J8V C;  5B32 D;  5AVC C;  1P3K B;  3REH C;  3A1K A;  2PYO B;  4WU8 B;  4R8P B;  4H9P B;  2BYM B;  5AV8 A;  3C1C A;  4JJN B;  3WAA B;  5B32 C;  3LZ0 C;  5JRG A;  1N1J A;  4X23 A;  3H0M C;  3B0D C;  1M19 C;  1P3L D;  3WKJ B;  3V9R A;  4CSR B;  5JA4 A;  4WNN B;  1KX5 B;  4HGA B;  3VH5 T;  1U35 A;  1M18 C;  3VH6 T;  2F8N H;  4WZS B; 
#chains in the Genus database with same CATH homology
 2BYK A;  1WWS A;  3X1S A;  4YM6 C;  4XUJ C;  4AWL B;  2CV5 D;  1P3L C;  1P3M A;  3W98 A;  2HIO A;  5B33 B;  4WJ3 C;  2F8N D;  4Z66 B;  1H3O B;  3REI D;  3LJA D;  5CPK C;  1P3G B;  4KGC D;  2JCH A;  3KUY C;  1P3O C;  2CV5 C;  3WTP B;  3F6T A;  2CWE A;  2Y2P A;  4WV4 B;  3MGR C;  3LJA C;  4KGC C;  4LD9 D;  3UTB C;  1P3K A;  4H9S A;  4QLC D;  3AV2 D;  3X1U B;  3AV1 A;  4WU8 A;  3UT9 D;  4H9P A;  4ZUX B;  2BYM A;  3AZI D;  4JJN A;  2NZD B;  5AVB B;  5FUG B;  1EQZ B;  1S32 B;  4QLC C;  3AV2 C;  5CPJ B;  1M1A D;  4CSR A;  4YS3 B;  5B1L B;  4WNN A;  1KX3 D;  3AZI C;  3WA9 D;  4WU9 C;  5AV6 D;  5E5A C;  2BG1 A;  5B33 A;  1ZLA B;  1KX3 C;  3KXB C;  3WA9 C;  3B0C T;  2ZY5 A;  1H3O A;  3X1V B;  1KX4 D;  3B6F D;  1P3G A;  5GSU B;  5B1M D;  3W99 D;  4NFT A;  3MGP C;  3WTP A;  1HQ3 C;  3AZJ B;  2IO5 C;  4Z5T B;  1P3F D;  5B31 B;  5BS7 A;  3B6F C;  5B40 B;  3B0B A;  3W97 D;  5B1M C;  3LEL A;  1TAF B;  3W99 C;  1P3A B;  3X1U A;  1P3F C;  3UTA B;  3W96 B;  3REL D;  1EQZ A;  3AN2 D;  1S32 A;  3MVD D;  5CPJ A;  3AFA C;  5B1L A;  1P3P A;  5AY8 B;  3REL C;  4KUD D;  1TZY A;  5B24 A;  3LZ1 B;  2Y2H A;  1BH9 A;  3O62 C;  3MGS B;  3KSY A;  1ZLA A;  5AV9 B;  3AZH D;  4KUD C;  3X1V A;  2F2A C;  4J8X C;  4H9Q A;  5GSU A;  5GT3 B;  3AZF B;  3X1T C;  5B31 A;  3AZH C;  5CPI D;  1B6W A;  5B40 A;  3MGQ D;  3AZM B;  3A1I A;  4XZQ B;  2ARO B;  5B2J B;  1P34 C;  1P3A C;  3EPH A;  1TAF A;  4NE3 A;  4J8U D;  1P3I C;  2Y2O A;  2ZY3 A;  5B2I A;  3UTA A;  5CPI C;  3B6G B;  3AYW D;  3A6N D;  3H0L C;  2Y2G A;  3EPK A;  3P5J B;  3AZN D;  2BYK B;  3X1S B;  1F66 A;  5GXQ D;  4J8U C;  2HIO B;  5AV5 D;  1ID3 B;  5AY8 A;  4DRB A;  5C3I C;  5B0Y D;  4J8W C;  3AYW C;  2DF4 C;  1Z2C B;  5AVC D;  4M6B A;  3REH D;  5AV5 C;  5GT0 A;  3MNN A;  4E44 A;  5DNN B;  4Z2M G;  5AV9 A;  4H9N B;  1AOI B;  5AV8 D;  5CP6 A;  5B0Y C;  3C1C D;  2FJ7 A;  5GT3 C;  5F99 D;  4X23 D;  3LZ0 D;  3AZF A;  4KHA B;  1M19 D;  2L5A A;  3AV1 B;  4EO5 B;  1U35 D;  5AV8 C;  4ZBJ B;  3C1C C;  3AZM A;  1M18 D;  4XZQ A;  2ARO A;  5B2J A;  5F99 C;  5JRG C;  3AZG B;  4X23 C;  3REK B;  1P3M D;  4YM6 D;  2Y2M A;  3W98 D;  4XUJ D;  2NQB A;  1P3B D;  3KWQ D;  5B0Z B;  1U35 C;  3B6G A;  1T3U A;  5CPK D;  2J8P A;  5BNX B;  1P3M C;  3KUY D;  1P3O D;  3W98 C;  3EPJ A;  1P3B C;  3KWQ C;  3REI B;  1ID3 A;  3C1B B;  3MGR D;  3UTB D;  2FFF B;  2PYO D;  4WU8 D;  4G91 B;  4R8P D;  4Z2M H;  5DNN A;  4H9N A;  1AOI A;  4LD9 B;  3WAA D;  1ULY A;  1P3K C;  2JSS A;  3LEL B;  3WKJ D;  3NQJ B;  4KHA A;  2PYO C;  4WU8 C;  4R8P C;  1KX5 D;  1HTA A;  4JJN C;  3WAA C;  4WU9 D;  3NQU B;  3AZG A;  3WKJ C;  3REK A;  1M1A B;  5E5A D;  2ZY2 A;  1BH8 B;  5B0Z A;  1KX5 C;  4HGA C;  5B31 G;  5AV6 B;  4Z66 D;  1P3P B;  3KXB D;  1P3G D;  1TZY B;  4NE6 A;  3KFU G;  5B24 B;  5BNX A;  4AWL C;  4G92 B;  5B33 C;  3MGP D;  1BH9 B;  1HQ3 D;  1KX4 B;  3REI A;  3C1B A;  2Y2K A;  4Z66 C;  1P3G C;  4H9Q B;  3H0R C;  3WTP C;  3X1U D;  5BS7 C;  4ZUX D;  3W97 B;  4LD9 A;  2NZD D;  5AVB D;  2YFV B;  4QLC A;  4DRA A;  5CPJ D;  3X1U C;  3NQJ A;  3UT9 A;  3R45 B;  3AFA D;  4YS3 D;  5B2I B;  4ZUX C;  2NZD C;  2ZM5 A;  5AVB C;  3AN2 B;  1EQZ C;  3AZK B;  3MVD B;  3NQU A;  3VH6 W;  1JFI A;  3AZE B;  1S32 C;  1M1A A;  5CPJ C;  1F66 B;  3O62 D;  4YS3 C;  3REJ B;  1BH8 A;  5B1L C;  1P3P C;  1KX3 A;  1ZLA D;  3WA9 A;  5AV6 A;  3X1V D;  1WWI A;  5GSU D;  4J8X D;  2Y2J A;  2HUE B;  3AZJ D;  4Z5T D;  5B31 D;  1ZLA C;  1KX4 A;  3X1T D;  3MNN B;  5GT0 B;  1A7W A;  3X1V C;  5CP6 B;  5GSU C;  1P34 D;  2FJ7 B;  3TU4 B;  2Y2L A;  1P3A D;  2RIQ A;  3AZJ C;  4Z5T C;  5B31 C;  1P3I D;  3W97 A;  3MGQ B;  3W96 D;  5B40 C;  2YFV A;  4H9O B;  3R45 A;  3UTA C;  2NQB B;  3REL A;  5G49 A;  3W96 C;  2XD1 A;  5AY8 D;  3A6N B;  2F8N K;  3AN2 A;  3AZN B;  3AZL B;  5KDM B;  3LZ1 D;  1W2E A;  3MVD A;  4J8W D;  5GXQ B;  3AZK A;  3AZE A;  5BT1 D;  3MGS D;  1Q9C A;  2Y2N A;  5DNM B;  3REJ A;  4KUD A;  5AY8 C;  4J8V B;  3LZ1 C;  4UUZ A;  5GT3 D;  2JE5 A;  3AZF D;  2W8S A;  3EG5 B;  5BT1 C;  3MGS C;  5GT0 C;  5AV9 C;  2FJ7 C;  3AZM D;  2ARO D;  5B32 B;  4H9R A;  3TU4 A;  1M19 B;  3B0D B;  5JRG D;  3AZF C;  2F8N G;  5CPI A;  3MGQ A;  1M18 B;  3B6G D;  3AZM C;  4XZQ C;  2ARO C;  5B2J C;  4YM6 B;  4XUJ B;  3X1S D;  1P3L B;  4H9O A;  2G5H C;  2HIO D;  1ID3 D;  3A6N A;  5CPK B;  3B6G C;  3AZN A;  3AZL A;  5KDM A;  3KUY B;  1P3O B;  5GXQ A;  3X1S C;  2CV5 B;  5DNM A;  2HIO C;  2ZY4 A;  2F8N B;  1ID3 C;  1AOI D;  3MGR B;  3LJA B;  5CHL B;  4KGC B;  4J8V A;  3UTB B;  5AVC A;  3REH A;  1P3K D;  3AV1 D;  5DNN C;  1AOI C;  5F99 A;  4JJN D;  5B32 A;  3LZ0 A;  3AZG D;  3REK D;  2Y2I A;  2RVQ D;  4QLC B;  3AV2 B;  4H9S C;  1M19 A;  3UT9 B;  3AV1 C;  5B0Z D;  4EO5 C;  4ZBJ C;  3AZI B;  1M18 A;  4WU9 B;  1BFM A;  4YM6 A;  3EPL A;  1PZR A;  5E5A B;  4CAY B;  3REK C;  2RVQ C;  4XUJ A;  3AZG C;  1P3B A;  1P3L A;  3KWQ A;  1JFI B;  5B33 D;  5B0Z C;  3C1B D;  1KX3 B;  3KXB B;  3WA9 B;  5CPK A;  3KUY A;  1P3O A;  3MGP B;  2CV5 A;  1HQ3 B;  3WTP D;  2IO5 B;  2F8N A;  3REI C;  3C1B C;  3B6F B;  3MGR A;  3LJA A;  4KGC A;  3UTB A;  5B1M B;  3W99 B;  3LEL D;  2PYO A;  5BNV B;  1P3F B;  4R8P A;  4G91 C;  3WAA A;  4LD9 C;  3WKJ A;  2VQR A;  3LEL C;  1EQZ D;  3AV2 A;  3UT9 C;  3AFA B;  1S32 D;  1KX5 A;  3REL B;  5B1L D;  5G49 B;  3AZI A;  4WU9 A;  1P3P D;  3AL0 C;  1TZY D;  4CAY A;  5E5A A;  5B24 D;  3VH5 W;  1M1A C;  1KU5 A;  3O62 B;  2XD5 A;  4Z66 A;  5AV6 C;  3KXB A;  4KUD B;  4UPK A;  2Y2Q A;  1TZY C;  4J8X B;  3VH5 A;  3VH6 A;  5B24 C;  3MGP A;  4UUZ B;  4G92 C;  1HQ3 A;  3X1T B;  1KX4 C;  3AZH B;  3B6F A;  5BO0 B;  3IP4 C;  1P34 B;  5B40 D;  5B1M A;  2DQN C;  3W99 A;  4H9R B;  5BNV A;  1P3F A;  1P3I B;  4ZUX A;  5B2I D;  2NZD A;  3WTP E;  3UTA D;  2YFW B;  5AVB A;  5CPI B;  5FUG A;  3W97 C;  3AZK D;  3AZE D;  4J8U B;  3AFA A;  4YS3 A;  1F66 D;  3REJ D;  5B2I C;  5C3I B;  4J8W B;  3AYW B;  3AN2 C;  3AZK C;  3MVD C;  3FDD A;  3AZE C;  5B32 G;  3O62 A;  1F66 C;  5AV5 B;  3REJ C;  3MNN D;  5GT0 D;  5AV9 D;  5B0Y B;  5CP6 D;  4J8X A;  2FJ7 D;  3TU4 D;  3AZJ A;  2HUE C;  4Z5T A;  5AVC B;  3B0C W;  3REH B;  3X1T A;  3MNN C;  3AZH A;  5AV8 B;  3C1C B;  5BO0 A;  1P34 A;  5CP6 C;  5F99 B;  1P3A A;  5JRG B;  5B2J D;  1F1E A;  1N1J B;  4XZQ D;  4X23 B;  3LZ0 B;  3TU4 C;  1P3I A;  3V9R B;  2NQB D;  3W96 A;  5JA4 B;  3MGQ C;  1U35 B;  2YFW A;  3AZL D;  4DQY B;  1P3M B;  2UWX A;  4E45 A;  3W98 B;  2G5I C;  4J8U A;  5DNM D;  2LY8 A;  1P3B B;  3KWQ B;  2NQB C;  3A6N C;  3LZ1 A;  4J8W A;  3AYW A;  3AZL C;  3AZN C;  4J8V D;  5GXQ C;  3MGS A;  1B67 A;  4NE5 A;  5DNM C;  5AV5 A;  5DNN D;  5B0Y A;  1R4V A;  5GT3 A;  4J8V C;  5B32 D;  5AVC C;  1P3K B;  3REH C;  3A1K A;  2PYO B;  4WU8 B;  4R8P B;  4H9P B;  2BYM B;  5AV8 A;  3C1C A;  4JJN B;  3WAA B;  5B32 C;  3LZ0 C;  5JRG A;  1N1J A;  4X23 A;  3H0M C;  3B0D C;  1M19 C;  1P3L D;  3WKJ B;  3V9R A;  4CSR B;  5JA4 A;  4WNN B;  1KX5 B;  4HGA B;  3VH5 T;  1U35 A;  1M18 C;  3VH6 T;  2F8N H;  4WZS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...