3AN2B

The structure of the centromeric nucleosome containing cenp-a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2B00
5AVBD 4EO5B 1M19D 1P3IC 5B31C 3AZJC 3LJAA 1P3ID 3W98B 3AZNC 3WKJA 5B31D 3LZ1C 3AZJD 3REJC 3AZMC 3AZND 4J8UA 3W97B 3LZ1D 1TZYC 3VH5A 3AZEB 3X1SC 3AZMD 1HQ3D 3W98A 3WTPA 1ULYA 3VH6W 1TZYD 4M6BA 4DRAA 3WAAC 3TU4B 1WWIA 2AROC 3MGSC 3AZEA 3WTPE 1TAFB 4Z66C 1EQZC 2AROD 3MGSD 5B0ZC 4Z66D 1EQZD 4NE3A 3TU4A 3C1BC 5GT0C 1KX3C 1TAFA 4WU8C 1P3AC 5CPJC 3MVDB 3REKB 4H9SA 2HIOC 5GT0D 3C1BD 1KX3D 1AOIB 2PYOC 1P3AD 4KUDB 4XUJB 2HIOD 2L5AA 2PYOD 1S32B 3MVDA 3REKA 3VH5T 4KUDA 4XUJA 3LZ0C 5AVBB 5BS7C 1M19B 1F66C 5B2JC 3AZKA 1F66D 3VH6T 5B2JD 5F99D 1P3IB 5B31B 5AVBA 1M19A 3AZJB 3AZNB 3LZ1B 1ID3B 3AZMB 4E45A 1HQ3B 1P3IA 5B33C 1TZYB 5B31A 3AZJA 3X1TD 5B33D 3AZNA 2NZDC 3LZ1A 4UUZB 3AZMA 3X1VD 1HQ3A 4CAYB 2AROB 1TZYA 4YM6D 3MGSB 2F8NH 4Z66B 5B24D 4J8VC 1EQZB 3AZLD 4UUZA 2FJ7D 4J8VD 1M1AB 3WAAA 4CAYA 2AROA 5AVCC 4NE5A 3MGSA 3C1BB 5GT0B 1KX3B 4Z66A 1P3AB 2RVQC 1EQZA 5AVCD 3W98C 2HIOB 2PYOB 2LY8A 5AV5C 3W97C 3C1BA 5JA4B 5GT0A 1KX3A 1P3AA 5CPJA 3AZFB 5AV5D 5AV8D 2HIOA 3AV1C 2PYOA 1P3KC 3AV1D 5C3IC 5B2JB 1F66B 5JA4A 1P3KD 5F99B 4G92B 3B0CW 5CP6D 4NE6A 5BS7A 3O62C 5B2JA 1F66A 5F99A 4J8WD 3KUYD 4WNNB 3O62D 3MVDC 3X1TB 3REKC 5B33B 4ZBJB 1AOIC 3AZHD 5KDMB 1P3GC 4LD9D 3X1VB 4WNNA 1S32C 1P3GD 4YM6B 3B6GC 5B32G 3X1TA 5B24B 5B33A 1S32D 5KDMA 5CPIC 3B6GD 3AZLB 2FJ7B 4H9PB 5AVBC 3X1VA 4J8VB 2NZDA 5CPID 5AV6B 3B6FC 1P3BD 1A7WA 5B24A 5AVCB 3B6FD 3AZLA 4H9PA 4J8VA 3VH5W 2BYKB 3REHC 3B0CT 1KU5A 4JJNB 3AN2A 1ID3C 5AV5B 5AV8B 1HQ3C 5AVCA 3REHD 5BT1D 1ID3D 3W99C 3X1UD 3AV1B 5B1LC 1P3KB 1P3OC 3W99D 4Z2MH 5AV5A 5B1LD 3W97A 2HUEC 5C3IB 5CP6B 1P3OD 1WWSA 2BYMB 3AV1A 5CPKC 1P3KA 4J8WB 3KUYB 5B40C 5E5AD 1M1AC 3O62B 5CPKD 5B40D 1M1AD 2BYMA 2YFWB 3AZHB 4QLCB 5AY8C 5B2IC 3KXBC 3KWQC 3REID 4LD9B 3KUYA 1B67A 3O62A 2IO5B 5AY8D 5B2ID 3KXBD 3KWQD 3LELD 1P3GB 1HTAA 1Q9CA 2YFWA 3AZFC 3B6GB 4J8XC 4LD9A 1AOIA 5CPIB 3AZFD 3AZIC 1P3GA 1P3BB 4J8XD 3MNNC 1JFIB 1S32A 5F99C 3AZID 3B6FB 4G92C 3B6GA 3MNND 2YFVB 4YS3D 5CPIA 4E44A 1P3PD 5BNVB 3B6FA 3REHB 2YFVA 3R45B 3X1TC 4Z5TD 3X1UB 4XZQC 5AV9D 3W99B 3RELB 5G49B 3X1VC 5BNVA 5B1LB 4XZQD 3MGRD 3REHA 1P3OB 3R45A 4YM6C 1ID3A 2HUEB 3X1UA 5B24C 4H9QB 1F1EA 3MGQD 3W99A 3AZLC 2FJ7C 5G49A 5B1LA 5E5AB 5CPKB 1P3OA 5AV6C 4WZSB 5B40B 5GT3D 1N1JB 5AV6D 4H9QA 3REIB 1U35C 2JSSA 5E5AA 3LELB 5B2IB 5AY8B 3KXBB 3KWQB 5CPKA 1H3OB 4NFTA 1U35D 5B40A 5GSUC 4JJNC 1M1AA 2F8NG 5AV8C 5JRGC 3REIA 5FUGB 5GSUD 4JJND 3LELA 5AY8A 5JRGD 5B2IA 3KXBA 3KWQA 1H3OA 4J8XB 3NQJB 3UT9C 4CSRB 3AZIB 3MNNB 4ZUXC 5CP6C 4X23C 3UTAC 3UT9D 4YS3B 5FUGA 3AZFA 3UTAD 4ZUXD 4X23D 4J8XA 4HGAC 1KX5C 3NQJA 1P3PB 4CSRA 1BFMA 3AZIA 4J8WC 3KUYC 3MNNA 1KX5D 4YS3A 1P3LD 4Z5TB 3WTPD 3AZHC 5AV9B 4QLCC 3AFAC 1P3PA 4LD9C 4XZQB 5B0YD 3MGRB 3WA9D 4QLCD 2IO5C 3AFAD 1M18D 3MGPB 5B32C 4Z5TA 4R8PB 5AV9A 3MGQB 5B32D 4XZQA 3MGRA 4H9RB 1P3BC 1KX4C 5GT3B 4WU9B 4YM6A 1KX4D 3MGQA 5B1MC 1U35B 4H9RA 2FJ7A 5B1MD 2F8NB 5AV6A 5GSUB 1ZLAB 5BT1C 5JRGB 3X1UC 4KGCC 3NQUB 1U35A 1P3MC 3RELC 5DNMC 1P3FD 4KGCD 2BYKA 3UT9B 1P3MD 5GSUA 4JJNA 3RELD 5DNMD 2CV5C 3UTAB 4ZUXB 5AV8A 5JRGA 4X23B 3NQUA 2CV5D 4HGAB 4J8UB 1KX5B 5E5AC 3UT9A 1P3LB 3UTAA 3WTPB 5CP6A 4ZUXA 4X23A 5B31G 3REIC 3WA9B 4Z2MG 1BH9B 5B0YB 1KX5A 3AFAB 3LELC 1M18B 4G91C 1P3LA 4J8WA 3REJD 3X1SD 5B32B 3C1CC 3WA9A 5B0YA 1BH9A 3AZHA 4QLCA 3AFAA 3VH6A 1M18A 3C1CD 3WAAD 1KX4B 5B32A 4YS3C 5B0ZD 5B1MB 1P34C 3AZGC 1P3PC 1P3BA 1KX4A 1BH8B 1P34D 3AZGD 4WU8D 1JFIA 3B0DC 5CPJD 3AYWC 3A6NC 4Z5TC 2NQBC 5AV9C 3UTBC 5B1MA 3AYWD 3A6ND 3W96C 4DRBA 1P3FB 2NQBD 4KGCB 3MGRC 4KHAB 3AZKB 3UTBD 1BH8A 1P3MB 5DNMB 3MGPC 3W96D 4R8PC 3MGPD 4AWLC 2CV5B 3MGQC 4KGCA 1P3FA 3LZ0D 4R8PD 4KHAA 1P3MA 3RELA 5DNMA 5BNXB 5GT3C 4WU9C 3V9RB 2CV5A 5DNNC 2F8NK 4WU9D 1R4VA 3REJB 5DNND 5BNXA 4H9OB 4G91B 3AV2C 3X1SB 3V9RA 2CWEA 4H9NB 1ZLAC 1N1JA 2F8ND 3AV2D 3KSYA 3C1CB 5GXQC 3AN2C 1ZLAD 3REJA 3WAAB 2NZDD 4H9OA 3AN2D 5GXQD 3X1SA 4H9NA 3LJAC 5B0ZB 3WKJC 3C1CA 4ZBJC 4EO5C 3LJAD 3WKJD 4J8UC 1P34B 3AZGB 4WU8B 1P3LC 5CPJB 5BO0B 4J8UD 5B0ZA 3WTPC 3B0DB 2RVQD 3A6NB 3AYWB 2NQBB 3W98D 3WA9C 5B0YC 3UTBB 1P34A 1M18C 3AZGA 4WU8A 3W96B 3AZEC 5BO0A 3W97D 3AZED 3AYWA 3A6NA 2NQBA 3LZ0B 3UTBA 4AWLB 3TU4C 3W96A 3TU4D 3MGPA 4H9SC 3LZ0A 4R8PA 5DNNB 4WV4B 5GT3A 4WU9A 3AV2B 3MVDD 4KUDC 5CHLB 4XUJC 3REKD 5DNNA 1AOID 1B6WA 2NZDB 4KUDD 1P3FC 4XUJD 3AN2B 5GXQB 3AZKC 2F8NA 3AV2A 3AZKD 1ZLAA 1M19C 3LJAB 3WKJB 3B0BA 5GXQA
chains in the Genus database with same CATH superfamily
5AVBD 4EO5B 3EPJA 1M19D 1P3IC 5B31C 3AZJC 3LJAA 1P3ID 3W98B 3H0MC 3AZNC 3WKJA 5B31D 3LZ1C 3AZJD 3REJC 3AZMC 3AZND 4J8UA 3W97B 3LZ1D 1TZYC 3VH5A 3AZEB 3X1SC 3AZMD 1HQ3D 3W98A 3WTPA 1ULYA 3VH6W 1TZYD 4M6BA 4DRAA 3WAAC 3TU4B 1WWIA 2AROC 3MGSC 3AZEA 2Y2KA 3WTPE 1TAFB 4Z66C 1EQZC 2AROD 3MGSD 5B0ZC 4Z66D 1EQZD 4NE3A 3TU4A 3C1BC 5GT0C 1KX3C 1TAFA 4WU8C 1P3AC 5CPJC 3MVDB 3REKB 4H9SA 2HIOC 5GT0D 3C1BD 1KX3D 1AOIB 2PYOC 1P3AD 4KUDB 4XUJB 2HIOD 2L5AA 2ZY4A 2PYOD 1S32B 3MVDA 3REKA 3VH5T 4KUDA 4XUJA 3LZ0C 5AVBB 2DQNC 5BS7C 1M19B 1F66C 5B2JC 3AZKA 1F66D 3VH6T 5B2JD 5F99D 1P3IB 3P5JB 5B31B 5AVBA 1M19A 3AZJB 3AZNB 2Y2NA 3LZ1B 2JCHA 3AZMB 4E45A 1HQ3B 1P3IA 1ID3B 5B33C 2Y2QA 1TZYB 5B31A 3AZJA 3X1TD 3IP4C 5B33D 3AZNA 2NZDC 3LZ1A 4UUZB 3AZMA 3X1VD 1HQ3A 4CAYB 2AROB 1TZYA 4YM6D 3MGSB 4UPKA 2F8NH 4Z66B 5B24D 4J8VC 1EQZB 3AZLD 4UUZA 2FJ7D 4J8VD 1M1AB 3WAAA 4CAYA 3H0RC 2AROA 5AVCC 4NE5A 3MGSA 3C1BB 5GT0B 1KX3B 4Z66A 1P3AB 2RVQC 3A1KA 1EQZA 5AVCD 3W98C 2HIOB 2DF4C 2PYOB 2LY8A 5AV5C 3W97C 3C1BA 5JA4B 5GT0A 1KX3A 1P3AA 5CPJA 3AZFB 5AV5D 5AV8D 2HIOA 3AV1C 2PYOA 1P3KC 3AV1D 5C3IC 5B2JB 1F66B 5JA4A 1P3KD 5F99B 4G92B 3B0CW 5CP6D 4NE6A 5BS7A 3O62C 5B2JA 1F66A 5F99A 2UWXA 4J8WD 3KUYD 2F2AC 4WNNB 3O62D 2Y2LA 3MVDC 3X1TB 3REKC 5B33B 1AOIC 3AZHD 5KDMB 1P3GC 4LD9D 3X1VB 4WNNA 1S32C 1P3GD 4YM6B 3B6GC 2XD1A 5B32G 3X1TA 5B24B 5B33A 1S32D 5KDMA 5CPIC 3B6GD 3AZLB 2FJ7B 4H9PB 5AVBC 3X1VA 4J8VB 2NZDA 5CPID 5AV6B 3B6FC 1P3BD 3EG5B 1A7WA 5B24A 5AVCB 3B6FD 3AZLA 4H9PA 4J8VA 3VH5W 2BYKB 3REHC 3B0CT 1KU5A 4JJNB 3AN2A 1ID3C 5AV5B 5AV8B 1HQ3C 5AVCA 3REHD 3KFUG 2FFFB 5BT1D 1ID3D 3W99C 3X1UD 3AV1B 5B1LC 1P3KB 1P3OC 3W99D 4Z2MH 5AV5A 5B1LD 3W97A 2HUEC 5C3IB 5CP6B 1P3OD 1WWSA 2BYMB 3AV1A 5CPKC 1P3KA 4J8WB 3KUYB 5B40C 5E5AD 1M1AC 3O62B 5CPKD 5B40D 1M1AD 2BYMA 2YFWB 3F6TA 3AZHB 4QLCB 5AY8C 5B2IC 3KXBC 2ZY5A 3KWQC 3A1IA 3REID 4LD9B 3KUYA 1B67A 3O62A 2IO5B 5AY8D 5B2ID 3KXBD 3KWQD 3LELD 1P3GB 1HTAA 1Q9CA 2YFWA 3AZFC 3B6GB 3FDDA 4J8XC 4LD9A 1AOIA 5CPIB 3AZFD 3AZIC 1P3GA 1P3BB 4J8XD 3MNNC 2JE5A 1JFIB 1S32A 5F99C 3AZID 3B6FB 4G92C 3B6GA 3MNND 2YFVB 4YS3D 5CPIA 2VQRA 4E44A 1P3PD 5BNVB 3B6FA 3REHB 2YFVA 3R45B 3X1TC 4Z5TD 3X1UB 4XZQC 5AV9D 3W99B 3RELB 5G49B 3X1VC 5BNVA 5B1LB 4XZQD 3MGRD 3REHA 1P3OB 3R45A 4YM6C 1ID3A 2HUEB 3X1UA 5B24C 4H9QB 1F1EA 3MGQD 3W99A 3AZLC 2FJ7C 5G49A 5B1LA 5E5AB 5CPKB 1P3OA 5AV6C 4WZSB 5B40B 5GT3D 1N1JB 5AV6D 2RIQA 4H9QA 3REIB 1U35C 2JSSA 5E5AA 3LELB 5B2IB 5AY8B 3KXBB 3H0LC 3KWQB 1H3OB 4NFTA 5CPKA 1U35D 5B40A 5GSUC 4JJNC 1M1AA 2F8NG 5AV8C 5JRGC 3REIA 5FUGB 5GSUD 4JJND 3LELA 5AY8A 5JRGD 5B2IA 3KXBA 3KWQA 1H3OA 4J8XB 3NQJB 3UT9C 4CSRB 3AZIB 3MNNB 4ZUXC 5CP6C 4X23C 3UTAC 3UT9D 4YS3B 5FUGA 3AZFA 3UTAD 4ZUXD 4X23D 1W2EA 4J8XA 4HGAC 1KX5C 3NQJA 2ZY2A 2Y2HA 4CSRA 1P3PB 1BFMA 3AZIA 4J8WC 3KUYC 3MNNA 1KX5D 4YS3A 1P3LD 4Z5TB 3WTPD 1PZRA 3AZHC 5AV9B 4QLCC 3AFAC 1P3PA 4LD9C 4XZQB 5B0YD 3MGRB 3WA9D 4QLCD 2IO5C 3AFAD 1M18D 3MGPB 5B32C 4Z5TA 4R8PB 5AV9A 3EPKA 3MGQB 5B32D 2J8PA 4XZQA 2Y2GA 3MGRA 4H9RB 1P3BC 1KX4C 5GT3B 4WU9B 4WJ3C 4YM6A 1KX4D 3MGQA 5B1MC 2ZM5A 1U35B 4H9RA 2FJ7A 5B1MD 2F8NB 5AV6A 5GSUB 1ZLAB 5BT1C 2Y2PA 5JRGB 3X1UC 4KGCC 3NQUB 1U35A 1P3MC 3RELC 5DNMC 1P3FD 4KGCD 2BYKA 3UT9B 1P3MD 5GSUA 4JJNA 3RELD 5DNMD 2CV5C 3UTAB 4ZUXB 5AV8A 5JRGA 4X23B 3NQUA 5GXQA 2CV5D 4HGAB 1Z2CB 4J8UB 5E5AC 1KX5B 3UT9A 1P3LB 3UTAA 3WTPB 5CP6A 4ZUXA 4X23A 5B31G 3REIC 3WA9B 4Z2MG 1BH9B 5B0YB 3EPLA 1KX5A 3AFAB 3LELC 1M18B 4G91C 1P3LA 3EPHA 4J8WA 3REJD 5B32B 3X1SD 3C1CC 3WA9A 5B0YA 1BH9A 3AZHA 4QLCA 3AFAA 3VH6A 1M18A 3C1CD 3WAAD 1T3UA 2G5IC 1KX4B 5B32A 4YS3C 2G5HC 5B0ZD 5B1MB 1P34C 3AZGC 3AL0C 1P3PC 1P3BA 1KX4A 1BH8B 1P34D 3AZGD 4WU8D 1JFIA 3B0DC 5CPJD 3AYWC 3A6NC 4Z5TC 2NQBC 5AV9C 3UTBC 5B1MA 3AYWD 3A6ND 3W96C 4DRBA 1P3FB 2NQBD 4KGCB 3MGRC 2XD5A 4KHAB 3AZKB 3UTBD 1BH8A 1P3MB 5DNMB 2Y2IA 3MGPC 3W96D 4R8PC 3MGPD 4AWLC 2CV5B 3MGQC 4KGCA 1P3FA 3LZ0D 4R8PD 4KHAA 1P3MA 3RELA 5DNMA 5BNXB 5GT3C 4WU9C 3V9RB 2CV5A 5DNNC 2F8NK 4WU9D 1R4VA 3REJB 5DNND 5BNXA 4H9OB 4G91B 2Y2JA 3AV2C 3X1SB 3V9RA 2CWEA 4H9NB 1ZLAC 1N1JA 2F8ND 3AV2D 3KSYA 3C1CB 5GXQC 3AN2C 1ZLAD 3REJA 3WAAB 2NZDD 4H9OA 3AN2D 5GXQD 3X1SA 4H9NA 4DQYB 3LJAC 5B0ZB 3WKJC 3C1CA 4ZBJC 4EO5C 3LJAD 2Y2MA 3WKJD 2BG1A 4J8UC 1P34B 3AZGB 4WU8B 1P3LC 5CPJB 5BO0B 4J8UD 5B0ZA 3WTPC 3B0DB 2RVQD 3A6NB 3AYWB 2NQBB 3W98D 3WA9C 5B0YC 3UTBB 1P34A 1M18C 3AZGA 4WU8A 3W96B 3AZEC 5BO0A 3W97D 2ZY3A 3AZED 3AYWA 3A6NA 2NQBA 3LZ0B 3UTBA 4AWLB 3TU4C 3W96A 3TU4D 3MGPA 4H9SC 2Y2OA 3LZ0A 4R8PA 5DNNB 4WV4B 5GT3A 4WU9A 3AV2B 3MVDD 4KUDC 5CHLB 4XUJC 3REKD 5DNNA 1AOID 1B6WA 2NZDB 4KUDD 1P3FC 4XUJD 3AN2B 5GXQB 3AZKC 2W8SA 2F8NA 3AV2A 3AZKD 1ZLAA 1M19C 3LJAB 3WKJB 3B0BA 4ZBJB
chains in the Genus database with same CATH topology
5AVBD 4EO5B 3EPJA 1M19D 1P3IC 5B31C 3AZJC 3LJAA 1P3ID 3W98B 3H0MC 3AZNC 3WKJA 5B31D 3LZ1C 3AZJD 3REJC 3AZMC 3AZND 4J8UA 3W97B 3LZ1D 1TZYC 3VH5A 3AZEB 3X1SC 3AZMD 1HQ3D 3W98A 3WTPA 1ULYA 3VH6W 1TZYD 4M6BA 4DRAA 3WAAC 3TU4B 1WWIA 2AROC 3MGSC 3AZEA 2Y2KA 3WTPE 1TAFB 4Z66C 1EQZC 2AROD 3MGSD 5B0ZC 4Z66D 1EQZD 4NE3A 3TU4A 3C1BC 5GT0C 1KX3C 1TAFA 4WU8C 1P3AC 5CPJC 3MVDB 3REKB 4H9SA 2HIOC 5GT0D 3C1BD 1KX3D 1AOIB 2PYOC 1P3AD 4KUDB 4XUJB 2HIOD 2L5AA 2ZY4A 2PYOD 1S32B 3MVDA 3REKA 3VH5T 4KUDA 4XUJA 3LZ0C 5AVBB 2DQNC 5BS7C 1M19B 1F66C 5B2JC 3AZKA 1F66D 3VH6T 5B2JD 5F99D 1P3IB 3P5JB 5B31B 5AVBA 1M19A 3AZJB 3AZNB 2Y2NA 3LZ1B 2JCHA 3AZMB 4E45A 1HQ3B 1P3IA 1ID3B 5B33C 2Y2QA 1TZYB 5B31A 3AZJA 3X1TD 3IP4C 5B33D 3AZNA 2NZDC 3LZ1A 4UUZB 3AZMA 3X1VD 1HQ3A 4CAYB 2AROB 1TZYA 4YM6D 3MGSB 4UPKA 2F8NH 4Z66B 5B24D 4J8VC 1EQZB 3AZLD 4UUZA 2FJ7D 4J8VD 1M1AB 3WAAA 4CAYA 3H0RC 2AROA 5AVCC 4NE5A 3MGSA 3C1BB 5GT0B 1KX3B 4Z66A 1P3AB 2RVQC 3A1KA 1EQZA 5AVCD 3W98C 2HIOB 2DF4C 2PYOB 2LY8A 5AV5C 3W97C 3C1BA 5JA4B 5GT0A 1KX3A 1P3AA 5CPJA 3AZFB 5AV5D 5AV8D 2HIOA 3AV1C 2PYOA 1P3KC 3AV1D 5C3IC 5B2JB 1F66B 5JA4A 1P3KD 5F99B 4G92B 3B0CW 5CP6D 4NE6A 5BS7A 3O62C 5B2JA 1F66A 5F99A 2UWXA 4J8WD 3KUYD 2F2AC 4WNNB 3O62D 2Y2LA 3MVDC 3X1TB 3REKC 5B33B 1AOIC 3AZHD 5KDMB 1P3GC 4LD9D 3X1VB 4WNNA 1S32C 1P3GD 4YM6B 3B6GC 2XD1A 5B32G 3X1TA 5B24B 5B33A 1S32D 5KDMA 5CPIC 3B6GD 3AZLB 2FJ7B 4H9PB 5AVBC 3X1VA 4J8VB 2NZDA 5CPID 5AV6B 3B6FC 1P3BD 3EG5B 1A7WA 5B24A 5AVCB 3B6FD 3AZLA 4H9PA 4J8VA 3VH5W 2BYKB 3REHC 3B0CT 1KU5A 4JJNB 3AN2A 1ID3C 5AV5B 5AV8B 1HQ3C 5AVCA 3REHD 3KFUG 2FFFB 5BT1D 1ID3D 3W99C 3X1UD 3AV1B 5B1LC 1P3KB 1P3OC 3W99D 4Z2MH 5AV5A 5B1LD 3W97A 2HUEC 5C3IB 5CP6B 1P3OD 1WWSA 2BYMB 3AV1A 5CPKC 1P3KA 4J8WB 3KUYB 5B40C 5E5AD 1M1AC 3O62B 5CPKD 5B40D 1M1AD 2BYMA 2YFWB 3F6TA 3AZHB 4QLCB 5AY8C 5B2IC 3KXBC 2ZY5A 3KWQC 3A1IA 3REID 4LD9B 3KUYA 1B67A 3O62A 2IO5B 5AY8D 5B2ID 3KXBD 3KWQD 3LELD 1P3GB 1HTAA 1Q9CA 2YFWA 3AZFC 3B6GB 3FDDA 4J8XC 4LD9A 1AOIA 5CPIB 3AZFD 3AZIC 1P3GA 1P3BB 4J8XD 3MNNC 2JE5A 1JFIB 1S32A 5F99C 3AZID 3B6FB 4G92C 3B6GA 3MNND 2YFVB 4YS3D 5CPIA 2VQRA 4E44A 1P3PD 5BNVB 3B6FA 3REHB 2YFVA 3R45B 3X1TC 4Z5TD 3X1UB 4XZQC 5AV9D 3W99B 3RELB 5G49B 3X1VC 5BNVA 5B1LB 4XZQD 3MGRD 3REHA 1P3OB 3R45A 4YM6C 1ID3A 2HUEB 3X1UA 5B24C 4H9QB 1F1EA 3MGQD 3W99A 3AZLC 2FJ7C 5G49A 5B1LA 5E5AB 5CPKB 1P3OA 5AV6C 4WZSB 5B40B 5GT3D 1N1JB 5AV6D 2RIQA 4H9QA 3REIB 1U35C 2JSSA 5E5AA 3LELB 5B2IB 5AY8B 3KXBB 3H0LC 3KWQB 1H3OB 4NFTA 5CPKA 1U35D 5B40A 5GSUC 4JJNC 1M1AA 2F8NG 5AV8C 5JRGC 3REIA 5FUGB 5GSUD 4JJND 3LELA 5AY8A 5JRGD 5B2IA 3KXBA 3KWQA 1H3OA 4J8XB 3NQJB 3UT9C 4CSRB 3AZIB 3MNNB 4ZUXC 5CP6C 4X23C 3UTAC 3UT9D 4YS3B 5FUGA 3AZFA 3UTAD 4ZUXD 4X23D 1W2EA 4J8XA 4HGAC 1KX5C 3NQJA 2ZY2A 2Y2HA 4CSRA 1P3PB 1BFMA 3AZIA 4J8WC 3KUYC 3MNNA 1KX5D 4YS3A 1P3LD 4Z5TB 3WTPD 1PZRA 3AZHC 5AV9B 4QLCC 3AFAC 1P3PA 4LD9C 4XZQB 5B0YD 3MGRB 3WA9D 4QLCD 2IO5C 3AFAD 1M18D 3MGPB 5B32C 4Z5TA 4R8PB 5AV9A 3EPKA 3MGQB 5B32D 2J8PA 4XZQA 2Y2GA 3MGRA 4H9RB 1P3BC 1KX4C 5GT3B 4WU9B 4WJ3C 4YM6A 1KX4D 3MGQA 5B1MC 2ZM5A 1U35B 4H9RA 2FJ7A 5B1MD 2F8NB 5AV6A 5GSUB 1ZLAB 5BT1C 2Y2PA 5JRGB 3X1UC 4KGCC 3NQUB 1U35A 1P3MC 3RELC 5DNMC 1P3FD 4KGCD 2BYKA 3UT9B 1P3MD 5GSUA 4JJNA 3RELD 5DNMD 2CV5C 3UTAB 4ZUXB 5AV8A 5JRGA 4X23B 3NQUA 5GXQA 2CV5D 4HGAB 1Z2CB 4J8UB 5E5AC 1KX5B 3UT9A 1P3LB 3UTAA 3WTPB 5CP6A 4ZUXA 4X23A 5B31G 3REIC 3WA9B 4Z2MG 1BH9B 5B0YB 3EPLA 1KX5A 3AFAB 3LELC 1M18B 4G91C 1P3LA 3EPHA 4J8WA 3REJD 5B32B 3X1SD 3C1CC 3WA9A 5B0YA 1BH9A 3AZHA 4QLCA 3AFAA 3VH6A 1M18A 3C1CD 3WAAD 1T3UA 2G5IC 1KX4B 5B32A 4YS3C 2G5HC 5B0ZD 5B1MB 1P34C 3AZGC 3AL0C 1P3PC 1P3BA 1KX4A 1BH8B 1P34D 3AZGD 4WU8D 1JFIA 3B0DC 5CPJD 3AYWC 3A6NC 4Z5TC 2NQBC 5AV9C 3UTBC 5B1MA 3AYWD 3A6ND 3W96C 4DRBA 1P3FB 2NQBD 4KGCB 3MGRC 2XD5A 4KHAB 3AZKB 3UTBD 1BH8A 1P3MB 5DNMB 2Y2IA 3MGPC 3W96D 4R8PC 3MGPD 4AWLC 2CV5B 3MGQC 4KGCA 1P3FA 3LZ0D 4R8PD 4KHAA 1P3MA 3RELA 5DNMA 5BNXB 5GT3C 4WU9C 3V9RB 2CV5A 5DNNC 2F8NK 4WU9D 1R4VA 3REJB 5DNND 5BNXA 4H9OB 4G91B 2Y2JA 3AV2C 3X1SB 3V9RA 2CWEA 4H9NB 1ZLAC 1N1JA 2F8ND 3AV2D 3KSYA 3C1CB 5GXQC 3AN2C 1ZLAD 3REJA 3WAAB 2NZDD 4H9OA 3AN2D 5GXQD 3X1SA 4H9NA 4DQYB 3LJAC 5B0ZB 3WKJC 3C1CA 4ZBJC 4EO5C 3LJAD 2Y2MA 3WKJD 2BG1A 4J8UC 1P34B 3AZGB 4WU8B 1P3LC 5CPJB 5BO0B 4J8UD 5B0ZA 3WTPC 3B0DB 2RVQD 3A6NB 3AYWB 2NQBB 3W98D 3WA9C 5B0YC 3UTBB 1P34A 1M18C 3AZGA 4WU8A 3W96B 3AZEC 5BO0A 3W97D 2ZY3A 3AZED 3AYWA 3A6NA 2NQBA 3LZ0B 3UTBA 4AWLB 3TU4C 3W96A 3TU4D 3MGPA 4H9SC 2Y2OA 3LZ0A 4R8PA 5DNNB 4WV4B 5GT3A 4WU9A 3AV2B 3MVDD 4KUDC 5CHLB 4XUJC 3REKD 5DNNA 1AOID 1B6WA 2NZDB 4KUDD 1P3FC 4XUJD 3AN2B 5GXQB 3AZKC 2W8SA 2F8NA 3AV2A 3AZKD 1ZLAA 1M19C 3LJAB 3WKJB 3B0BA 4ZBJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB D;  4EO5 B;  1M19 D;  1P3I C;  5B31 C;  3AZJ C;  3LJA A;  1P3I D;  3W98 B;  3AZN C;  3WKJ A;  5B31 D;  3LZ1 C;  3AZJ D;  3REJ C;  3AZM C;  3AZN D;  4J8U A;  3W97 B;  3LZ1 D;  1TZY C;  3VH5 A;  3AZE B;  3X1S C;  3AZM D;  1HQ3 D;  3W98 A;  3WTP A;  1ULY A;  3VH6 W;  1TZY D;  4M6B A;  4DRA A;  3WAA C;  3TU4 B;  1WWI A;  2ARO C;  3MGS C;  3AZE A;  3WTP E;  1TAF B;  4Z66 C;  1EQZ C;  2ARO D;  3MGS D;  5B0Z C;  4Z66 D;  1EQZ D;  4NE3 A;  3TU4 A;  3C1B C;  5GT0 C;  1KX3 C;  1TAF A;  4WU8 C;  1P3A C;  5CPJ C;  3MVD B;  3REK B;  4H9S A;  2HIO C;  5GT0 D;  3C1B D;  1KX3 D;  1AOI B;  2PYO C;  1P3A D;  4KUD B;  4XUJ B;  2HIO D;  2L5A A;  2PYO D;  1S32 B;  3MVD A;  3REK A;  3VH5 T;  4KUD A;  4XUJ A;  3LZ0 C;  5AVB B;  5BS7 C;  1M19 B;  1F66 C;  5B2J C;  3AZK A;  1F66 D;  3VH6 T;  5B2J D;  5F99 D;  1P3I B;  5B31 B;  5AVB A;  1M19 A;  3AZJ B;  3AZN B;  3LZ1 B;  1ID3 B;  3AZM B;  4E45 A;  1HQ3 B;  1P3I A;  5B33 C;  1TZY B;  5B31 A;  3AZJ A;  3X1T D;  5B33 D;  3AZN A;  2NZD C;  3LZ1 A;  4UUZ B;  3AZM A;  3X1V D;  1HQ3 A;  4CAY B;  2ARO B;  1TZY A;  4YM6 D;  3MGS B;  2F8N H;  4Z66 B;  5B24 D;  4J8V C;  1EQZ B;  3AZL D;  4UUZ A;  2FJ7 D;  4J8V D;  1M1A B;  3WAA A;  4CAY A;  2ARO A;  5AVC C;  4NE5 A;  3MGS A;  3C1B B;  5GT0 B;  1KX3 B;  4Z66 A;  1P3A B;  2RVQ C;  1EQZ A;  5AVC D;  3W98 C;  2HIO B;  2PYO B;  2LY8 A;  5AV5 C;  3W97 C;  3C1B A;  5JA4 B;  5GT0 A;  1KX3 A;  1P3A A;  5CPJ A;  3AZF B;  5AV5 D;  5AV8 D;  2HIO A;  3AV1 C;  2PYO A;  1P3K C;  3AV1 D;  5C3I C;  5B2J B;  1F66 B;  5JA4 A;  1P3K D;  5F99 B;  4G92 B;  3B0C W;  5CP6 D;  4NE6 A;  5BS7 A;  3O62 C;  5B2J A;  1F66 A;  5F99 A;  4J8W D;  3KUY D;  4WNN B;  3O62 D;  3MVD C;  3X1T B;  3REK C;  5B33 B;  4ZBJ B;  1AOI C;  3AZH D;  5KDM B;  1P3G C;  4LD9 D;  3X1V B;  4WNN A;  1S32 C;  1P3G D;  4YM6 B;  3B6G C;  5B32 G;  3X1T A;  5B24 B;  5B33 A;  1S32 D;  5KDM A;  5CPI C;  3B6G D;  3AZL B;  2FJ7 B;  4H9P B;  5AVB C;  3X1V A;  4J8V B;  2NZD A;  5CPI D;  5AV6 B;  3B6F C;  1P3B D;  1A7W A;  5B24 A;  5AVC B;  3B6F D;  3AZL A;  4H9P A;  4J8V A;  3VH5 W;  2BYK B;  3REH C;  3B0C T;  1KU5 A;  4JJN B;  3AN2 A;  1ID3 C;  5AV5 B;  5AV8 B;  1HQ3 C;  5AVC A;  3REH D;  5BT1 D;  1ID3 D;  3W99 C;  3X1U D;  3AV1 B;  5B1L C;  1P3K B;  1P3O C;  3W99 D;  4Z2M H;  5AV5 A;  5B1L D;  3W97 A;  2HUE C;  5C3I B;  5CP6 B;  1P3O D;  1WWS A;  2BYM B;  3AV1 A;  5CPK C;  1P3K A;  4J8W B;  3KUY B;  5B40 C;  5E5A D;  1M1A C;  3O62 B;  5CPK D;  5B40 D;  1M1A D;  2BYM A;  2YFW B;  3AZH B;  4QLC B;  5AY8 C;  5B2I C;  3KXB C;  3KWQ C;  3REI D;  4LD9 B;  3KUY A;  1B67 A;  3O62 A;  2IO5 B;  5AY8 D;  5B2I D;  3KXB D;  3KWQ D;  3LEL D;  1P3G B;  1HTA A;  1Q9C A;  2YFW A;  3AZF C;  3B6G B;  4J8X C;  4LD9 A;  1AOI A;  5CPI B;  3AZF D;  3AZI C;  1P3G A;  1P3B B;  4J8X D;  3MNN C;  1JFI B;  1S32 A;  5F99 C;  3AZI D;  3B6F B;  4G92 C;  3B6G A;  3MNN D;  2YFV B;  4YS3 D;  5CPI A;  4E44 A;  1P3P D;  5BNV B;  3B6F A;  3REH B;  2YFV A;  3R45 B;  3X1T C;  4Z5T D;  3X1U B;  4XZQ C;  5AV9 D;  3W99 B;  3REL B;  5G49 B;  3X1V C;  5BNV A;  5B1L B;  4XZQ D;  3MGR D;  3REH A;  1P3O B;  3R45 A;  4YM6 C;  1ID3 A;  2HUE B;  3X1U A;  5B24 C;  4H9Q B;  1F1E A;  3MGQ D;  3W99 A;  3AZL C;  2FJ7 C;  5G49 A;  5B1L A;  5E5A B;  5CPK B;  1P3O A;  5AV6 C;  4WZS B;  5B40 B;  5GT3 D;  1N1J B;  5AV6 D;  4H9Q A;  3REI B;  1U35 C;  2JSS A;  5E5A A;  3LEL B;  5B2I B;  5AY8 B;  3KXB B;  3KWQ B;  5CPK A;  1H3O B;  4NFT A;  1U35 D;  5B40 A;  5GSU C;  4JJN C;  1M1A A;  2F8N G;  5AV8 C;  5JRG C;  3REI A;  5FUG B;  5GSU D;  4JJN D;  3LEL A;  5AY8 A;  5JRG D;  5B2I A;  3KXB A;  3KWQ A;  1H3O A;  4J8X B;  3NQJ B;  3UT9 C;  4CSR B;  3AZI B;  3MNN B;  4ZUX C;  5CP6 C;  4X23 C;  3UTA C;  3UT9 D;  4YS3 B;  5FUG A;  3AZF A;  3UTA D;  4ZUX D;  4X23 D;  4J8X A;  4HGA C;  1KX5 C;  3NQJ A;  1P3P B;  4CSR A;  1BFM A;  3AZI A;  4J8W C;  3KUY C;  3MNN A;  1KX5 D;  4YS3 A;  1P3L D;  4Z5T B;  3WTP D;  3AZH C;  5AV9 B;  4QLC C;  3AFA C;  1P3P A;  4LD9 C;  4XZQ B;  5B0Y D;  3MGR B;  3WA9 D;  4QLC D;  2IO5 C;  3AFA D;  1M18 D;  3MGP B;  5B32 C;  4Z5T A;  4R8P B;  5AV9 A;  3MGQ B;  5B32 D;  4XZQ A;  3MGR A;  4H9R B;  1P3B C;  1KX4 C;  5GT3 B;  4WU9 B;  4YM6 A;  1KX4 D;  3MGQ A;  5B1M C;  1U35 B;  4H9R A;  2FJ7 A;  5B1M D;  2F8N B;  5AV6 A;  5GSU B;  1ZLA B;  5BT1 C;  5JRG B;  3X1U C;  4KGC C;  3NQU B;  1U35 A;  1P3M C;  3REL C;  5DNM C;  1P3F D;  4KGC D;  2BYK A;  3UT9 B;  1P3M D;  5GSU A;  4JJN A;  3REL D;  5DNM D;  2CV5 C;  3UTA B;  4ZUX B;  5AV8 A;  5JRG A;  4X23 B;  3NQU A;  2CV5 D;  4HGA B;  4J8U B;  1KX5 B;  5E5A C;  3UT9 A;  1P3L B;  3UTA A;  3WTP B;  5CP6 A;  4ZUX A;  4X23 A;  5B31 G;  3REI C;  3WA9 B;  4Z2M G;  1BH9 B;  5B0Y B;  1KX5 A;  3AFA B;  3LEL C;  1M18 B;  4G91 C;  1P3L A;  4J8W A;  3REJ D;  3X1S D;  5B32 B;  3C1C C;  3WA9 A;  5B0Y A;  1BH9 A;  3AZH A;  4QLC A;  3AFA A;  3VH6 A;  1M18 A;  3C1C D;  3WAA D;  1KX4 B;  5B32 A;  4YS3 C;  5B0Z D;  5B1M B;  1P34 C;  3AZG C;  1P3P C;  1P3B A;  1KX4 A;  1BH8 B;  1P34 D;  3AZG D;  4WU8 D;  1JFI A;  3B0D C;  5CPJ D;  3AYW C;  3A6N C;  4Z5T C;  2NQB C;  5AV9 C;  3UTB C;  5B1M A;  3AYW D;  3A6N D;  3W96 C;  4DRB A;  1P3F B;  2NQB D;  4KGC B;  3MGR C;  4KHA B;  3AZK B;  3UTB D;  1BH8 A;  1P3M B;  5DNM B;  3MGP C;  3W96 D;  4R8P C;  3MGP D;  4AWL C;  2CV5 B;  3MGQ C;  4KGC A;  1P3F A;  3LZ0 D;  4R8P D;  4KHA A;  1P3M A;  3REL A;  5DNM A;  5BNX B;  5GT3 C;  4WU9 C;  3V9R B;  2CV5 A;  5DNN C;  2F8N K;  4WU9 D;  1R4V A;  3REJ B;  5DNN D;  5BNX A;  4H9O B;  4G91 B;  3AV2 C;  3X1S B;  3V9R A;  2CWE A;  4H9N B;  1ZLA C;  1N1J A;  2F8N D;  3AV2 D;  3KSY A;  3C1C B;  5GXQ C;  3AN2 C;  1ZLA D;  3REJ A;  3WAA B;  2NZD D;  4H9O A;  3AN2 D;  5GXQ D;  3X1S A;  4H9N A;  3LJA C;  5B0Z B;  3WKJ C;  3C1C A;  4ZBJ C;  4EO5 C;  3LJA D;  3WKJ D;  4J8U C;  1P34 B;  3AZG B;  4WU8 B;  1P3L C;  5CPJ B;  5BO0 B;  4J8U D;  5B0Z A;  3WTP C;  3B0D B;  2RVQ D;  3A6N B;  3AYW B;  2NQB B;  3W98 D;  3WA9 C;  5B0Y C;  3UTB B;  1P34 A;  1M18 C;  3AZG A;  4WU8 A;  3W96 B;  3AZE C;  5BO0 A;  3W97 D;  3AZE D;  3AYW A;  3A6N A;  2NQB A;  3LZ0 B;  3UTB A;  4AWL B;  3TU4 C;  3W96 A;  3TU4 D;  3MGP A;  4H9S C;  3LZ0 A;  4R8P A;  5DNN B;  4WV4 B;  5GT3 A;  4WU9 A;  3AV2 B;  3MVD D;  4KUD C;  5CHL B;  4XUJ C;  3REK D;  5DNN A;  1AOI D;  1B6W A;  2NZD B;  4KUD D;  1P3F C;  4XUJ D;  3AN2 B;  5GXQ B;  3AZK C;  2F8N A;  3AV2 A;  3AZK D;  1ZLA A;  1M19 C;  3LJA B;  3WKJ B;  3B0B A;  5GXQ A; 
#chains in the Genus database with same CATH topology
 5AVB D;  4EO5 B;  3EPJ A;  1M19 D;  1P3I C;  5B31 C;  3AZJ C;  3LJA A;  1P3I D;  3W98 B;  3H0M C;  3AZN C;  3WKJ A;  5B31 D;  3LZ1 C;  3AZJ D;  3REJ C;  3AZM C;  3AZN D;  4J8U A;  3W97 B;  3LZ1 D;  1TZY C;  3VH5 A;  3AZE B;  3X1S C;  3AZM D;  1HQ3 D;  3W98 A;  3WTP A;  1ULY A;  3VH6 W;  1TZY D;  4M6B A;  4DRA A;  3WAA C;  3TU4 B;  1WWI A;  2ARO C;  3MGS C;  3AZE A;  2Y2K A;  3WTP E;  1TAF B;  4Z66 C;  1EQZ C;  2ARO D;  3MGS D;  5B0Z C;  4Z66 D;  1EQZ D;  4NE3 A;  3TU4 A;  3C1B C;  5GT0 C;  1KX3 C;  1TAF A;  4WU8 C;  1P3A C;  5CPJ C;  3MVD B;  3REK B;  4H9S A;  2HIO C;  5GT0 D;  3C1B D;  1KX3 D;  1AOI B;  2PYO C;  1P3A D;  4KUD B;  4XUJ B;  2HIO D;  2L5A A;  2ZY4 A;  2PYO D;  1S32 B;  3MVD A;  3REK A;  3VH5 T;  4KUD A;  4XUJ A;  3LZ0 C;  5AVB B;  2DQN C;  5BS7 C;  1M19 B;  1F66 C;  5B2J C;  3AZK A;  1F66 D;  3VH6 T;  5B2J D;  5F99 D;  1P3I B;  3P5J B;  5B31 B;  5AVB A;  1M19 A;  3AZJ B;  3AZN B;  2Y2N A;  3LZ1 B;  2JCH A;  3AZM B;  4E45 A;  1HQ3 B;  1P3I A;  1ID3 B;  5B33 C;  2Y2Q A;  1TZY B;  5B31 A;  3AZJ A;  3X1T D;  3IP4 C;  5B33 D;  3AZN A;  2NZD C;  3LZ1 A;  4UUZ B;  3AZM A;  3X1V D;  1HQ3 A;  4CAY B;  2ARO B;  1TZY A;  4YM6 D;  3MGS B;  4UPK A;  2F8N H;  4Z66 B;  5B24 D;  4J8V C;  1EQZ B;  3AZL D;  4UUZ A;  2FJ7 D;  4J8V D;  1M1A B;  3WAA A;  4CAY A;  3H0R C;  2ARO A;  5AVC C;  4NE5 A;  3MGS A;  3C1B B;  5GT0 B;  1KX3 B;  4Z66 A;  1P3A B;  2RVQ C;  3A1K A;  1EQZ A;  5AVC D;  3W98 C;  2HIO B;  2DF4 C;  2PYO B;  2LY8 A;  5AV5 C;  3W97 C;  3C1B A;  5JA4 B;  5GT0 A;  1KX3 A;  1P3A A;  5CPJ A;  3AZF B;  5AV5 D;  5AV8 D;  2HIO A;  3AV1 C;  2PYO A;  1P3K C;  3AV1 D;  5C3I C;  5B2J B;  1F66 B;  5JA4 A;  1P3K D;  5F99 B;  4G92 B;  3B0C W;  5CP6 D;  4NE6 A;  5BS7 A;  3O62 C;  5B2J A;  1F66 A;  5F99 A;  2UWX A;  4J8W D;  3KUY D;  2F2A C;  4WNN B;  3O62 D;  2Y2L A;  3MVD C;  3X1T B;  3REK C;  5B33 B;  1AOI C;  3AZH D;  5KDM B;  1P3G C;  4LD9 D;  3X1V B;  4WNN A;  1S32 C;  1P3G D;  4YM6 B;  3B6G C;  2XD1 A;  5B32 G;  3X1T A;  5B24 B;  5B33 A;  1S32 D;  5KDM A;  5CPI C;  3B6G D;  3AZL B;  2FJ7 B;  4H9P B;  5AVB C;  3X1V A;  4J8V B;  2NZD A;  5CPI D;  5AV6 B;  3B6F C;  1P3B D;  3EG5 B;  1A7W A;  5B24 A;  5AVC B;  3B6F D;  3AZL A;  4H9P A;  4J8V A;  3VH5 W;  2BYK B;  3REH C;  3B0C T;  1KU5 A;  4JJN B;  3AN2 A;  1ID3 C;  5AV5 B;  5AV8 B;  1HQ3 C;  5AVC A;  3REH D;  3KFU G;  2FFF B;  5BT1 D;  1ID3 D;  3W99 C;  3X1U D;  3AV1 B;  5B1L C;  1P3K B;  1P3O C;  3W99 D;  4Z2M H;  5AV5 A;  5B1L D;  3W97 A;  2HUE C;  5C3I B;  5CP6 B;  1P3O D;  1WWS A;  2BYM B;  3AV1 A;  5CPK C;  1P3K A;  4J8W B;  3KUY B;  5B40 C;  5E5A D;  1M1A C;  3O62 B;  5CPK D;  5B40 D;  1M1A D;  2BYM A;  2YFW B;  3F6T A;  3AZH B;  4QLC B;  5AY8 C;  5B2I C;  3KXB C;  2ZY5 A;  3KWQ C;  3A1I A;  3REI D;  4LD9 B;  3KUY A;  1B67 A;  3O62 A;  2IO5 B;  5AY8 D;  5B2I D;  3KXB D;  3KWQ D;  3LEL D;  1P3G B;  1HTA A;  1Q9C A;  2YFW A;  3AZF C;  3B6G B;  3FDD A;  4J8X C;  4LD9 A;  1AOI A;  5CPI B;  3AZF D;  3AZI C;  1P3G A;  1P3B B;  4J8X D;  3MNN C;  2JE5 A;  1JFI B;  1S32 A;  5F99 C;  3AZI D;  3B6F B;  4G92 C;  3B6G A;  3MNN D;  2YFV B;  4YS3 D;  5CPI A;  2VQR A;  4E44 A;  1P3P D;  5BNV B;  3B6F A;  3REH B;  2YFV A;  3R45 B;  3X1T C;  4Z5T D;  3X1U B;  4XZQ C;  5AV9 D;  3W99 B;  3REL B;  5G49 B;  3X1V C;  5BNV A;  5B1L B;  4XZQ D;  3MGR D;  3REH A;  1P3O B;  3R45 A;  4YM6 C;  1ID3 A;  2HUE B;  3X1U A;  5B24 C;  4H9Q B;  1F1E A;  3MGQ D;  3W99 A;  3AZL C;  2FJ7 C;  5G49 A;  5B1L A;  5E5A B;  5CPK B;  1P3O A;  5AV6 C;  4WZS B;  5B40 B;  5GT3 D;  1N1J B;  5AV6 D;  2RIQ A;  4H9Q A;  3REI B;  1U35 C;  2JSS A;  5E5A A;  3LEL B;  5B2I B;  5AY8 B;  3KXB B;  3H0L C;  3KWQ B;  1H3O B;  4NFT A;  5CPK A;  1U35 D;  5B40 A;  5GSU C;  4JJN C;  1M1A A;  2F8N G;  5AV8 C;  5JRG C;  3REI A;  5FUG B;  5GSU D;  4JJN D;  3LEL A;  5AY8 A;  5JRG D;  5B2I A;  3KXB A;  3KWQ A;  1H3O A;  4J8X B;  3NQJ B;  3UT9 C;  4CSR B;  3AZI B;  3MNN B;  4ZUX C;  5CP6 C;  4X23 C;  3UTA C;  3UT9 D;  4YS3 B;  5FUG A;  3AZF A;  3UTA D;  4ZUX D;  4X23 D;  1W2E A;  4J8X A;  4HGA C;  1KX5 C;  3NQJ A;  2ZY2 A;  2Y2H A;  4CSR A;  1P3P B;  1BFM A;  3AZI A;  4J8W C;  3KUY C;  3MNN A;  1KX5 D;  4YS3 A;  1P3L D;  4Z5T B;  3WTP D;  1PZR A;  3AZH C;  5AV9 B;  4QLC C;  3AFA C;  1P3P A;  4LD9 C;  4XZQ B;  5B0Y D;  3MGR B;  3WA9 D;  4QLC D;  2IO5 C;  3AFA D;  1M18 D;  3MGP B;  5B32 C;  4Z5T A;  4R8P B;  5AV9 A;  3EPK A;  3MGQ B;  5B32 D;  2J8P A;  4XZQ A;  2Y2G A;  3MGR A;  4H9R B;  1P3B C;  1KX4 C;  5GT3 B;  4WU9 B;  4WJ3 C;  4YM6 A;  1KX4 D;  3MGQ A;  5B1M C;  2ZM5 A;  1U35 B;  4H9R A;  2FJ7 A;  5B1M D;  2F8N B;  5AV6 A;  5GSU B;  1ZLA B;  5BT1 C;  2Y2P A;  5JRG B;  3X1U C;  4KGC C;  3NQU B;  1U35 A;  1P3M C;  3REL C;  5DNM C;  1P3F D;  4KGC D;  2BYK A;  3UT9 B;  1P3M D;  5GSU A;  4JJN A;  3REL D;  5DNM D;  2CV5 C;  3UTA B;  4ZUX B;  5AV8 A;  5JRG A;  4X23 B;  3NQU A;  5GXQ A;  2CV5 D;  4HGA B;  1Z2C B;  4J8U B;  5E5A C;  1KX5 B;  3UT9 A;  1P3L B;  3UTA A;  3WTP B;  5CP6 A;  4ZUX A;  4X23 A;  5B31 G;  3REI C;  3WA9 B;  4Z2M G;  1BH9 B;  5B0Y B;  3EPL A;  1KX5 A;  3AFA B;  3LEL C;  1M18 B;  4G91 C;  1P3L A;  3EPH A;  4J8W A;  3REJ D;  5B32 B;  3X1S D;  3C1C C;  3WA9 A;  5B0Y A;  1BH9 A;  3AZH A;  4QLC A;  3AFA A;  3VH6 A;  1M18 A;  3C1C D;  3WAA D;  1T3U A;  2G5I C;  1KX4 B;  5B32 A;  4YS3 C;  2G5H C;  5B0Z D;  5B1M B;  1P34 C;  3AZG C;  3AL0 C;  1P3P C;  1P3B A;  1KX4 A;  1BH8 B;  1P34 D;  3AZG D;  4WU8 D;  1JFI A;  3B0D C;  5CPJ D;  3AYW C;  3A6N C;  4Z5T C;  2NQB C;  5AV9 C;  3UTB C;  5B1M A;  3AYW D;  3A6N D;  3W96 C;  4DRB A;  1P3F B;  2NQB D;  4KGC B;  3MGR C;  2XD5 A;  4KHA B;  3AZK B;  3UTB D;  1BH8 A;  1P3M B;  5DNM B;  2Y2I A;  3MGP C;  3W96 D;  4R8P C;  3MGP D;  4AWL C;  2CV5 B;  3MGQ C;  4KGC A;  1P3F A;  3LZ0 D;  4R8P D;  4KHA A;  1P3M A;  3REL A;  5DNM A;  5BNX B;  5GT3 C;  4WU9 C;  3V9R B;  2CV5 A;  5DNN C;  2F8N K;  4WU9 D;  1R4V A;  3REJ B;  5DNN D;  5BNX A;  4H9O B;  4G91 B;  2Y2J A;  3AV2 C;  3X1S B;  3V9R A;  2CWE A;  4H9N B;  1ZLA C;  1N1J A;  2F8N D;  3AV2 D;  3KSY A;  3C1C B;  5GXQ C;  3AN2 C;  1ZLA D;  3REJ A;  3WAA B;  2NZD D;  4H9O A;  3AN2 D;  5GXQ D;  3X1S A;  4H9N A;  4DQY B;  3LJA C;  5B0Z B;  3WKJ C;  3C1C A;  4ZBJ C;  4EO5 C;  3LJA D;  2Y2M A;  3WKJ D;  2BG1 A;  4J8U C;  1P34 B;  3AZG B;  4WU8 B;  1P3L C;  5CPJ B;  5BO0 B;  4J8U D;  5B0Z A;  3WTP C;  3B0D B;  2RVQ D;  3A6N B;  3AYW B;  2NQB B;  3W98 D;  3WA9 C;  5B0Y C;  3UTB B;  1P34 A;  1M18 C;  3AZG A;  4WU8 A;  3W96 B;  3AZE C;  5BO0 A;  3W97 D;  2ZY3 A;  3AZE D;  3AYW A;  3A6N A;  2NQB A;  3LZ0 B;  3UTB A;  4AWL B;  3TU4 C;  3W96 A;  3TU4 D;  3MGP A;  4H9S C;  2Y2O A;  3LZ0 A;  4R8P A;  5DNN B;  4WV4 B;  5GT3 A;  4WU9 A;  3AV2 B;  3MVD D;  4KUD C;  5CHL B;  4XUJ C;  3REK D;  5DNN A;  1AOI D;  1B6W A;  2NZD B;  4KUD D;  1P3F C;  4XUJ D;  3AN2 B;  5GXQ B;  3AZK C;  2W8S A;  2F8N A;  3AV2 A;  3AZK D;  1ZLA A;  1M19 C;  3LJA B;  3WKJ B;  3B0B A;  4ZBJ B; 
#chains in the Genus database with same CATH homology
 5AVB D;  4EO5 B;  3EPJ A;  1M19 D;  1P3I C;  5B31 C;  3AZJ C;  3LJA A;  1P3I D;  3W98 B;  3H0M C;  3AZN C;  3WKJ A;  5B31 D;  3LZ1 C;  3AZJ D;  3REJ C;  3AZM C;  3AZN D;  4J8U A;  3W97 B;  3LZ1 D;  1TZY C;  3VH5 A;  3AZE B;  3X1S C;  3AZM D;  1HQ3 D;  3W98 A;  3WTP A;  1ULY A;  3VH6 W;  1TZY D;  4M6B A;  4DRA A;  3WAA C;  3TU4 B;  1WWI A;  2ARO C;  3MGS C;  3AZE A;  2Y2K A;  3WTP E;  1TAF B;  4Z66 C;  1EQZ C;  2ARO D;  3MGS D;  5B0Z C;  4Z66 D;  1EQZ D;  4NE3 A;  3TU4 A;  3C1B C;  5GT0 C;  1KX3 C;  1TAF A;  4WU8 C;  1P3A C;  5CPJ C;  3MVD B;  3REK B;  4H9S A;  2HIO C;  5GT0 D;  3C1B D;  1KX3 D;  1AOI B;  2PYO C;  1P3A D;  4KUD B;  4XUJ B;  2HIO D;  2L5A A;  2ZY4 A;  2PYO D;  1S32 B;  3MVD A;  3REK A;  3VH5 T;  4KUD A;  4XUJ A;  3LZ0 C;  5AVB B;  2DQN C;  5BS7 C;  1M19 B;  1F66 C;  5B2J C;  3AZK A;  1F66 D;  3VH6 T;  5B2J D;  5F99 D;  1P3I B;  3P5J B;  5B31 B;  5AVB A;  1M19 A;  3AZJ B;  3AZN B;  2Y2N A;  3LZ1 B;  2JCH A;  3AZM B;  4E45 A;  1HQ3 B;  1P3I A;  1ID3 B;  5B33 C;  2Y2Q A;  1TZY B;  5B31 A;  3AZJ A;  3X1T D;  3IP4 C;  5B33 D;  3AZN A;  2NZD C;  3LZ1 A;  4UUZ B;  3AZM A;  3X1V D;  1HQ3 A;  4CAY B;  2ARO B;  1TZY A;  4YM6 D;  3MGS B;  4UPK A;  2F8N H;  4Z66 B;  5B24 D;  4J8V C;  1EQZ B;  3AZL D;  4UUZ A;  2FJ7 D;  4J8V D;  1M1A B;  3WAA A;  4CAY A;  3H0R C;  2ARO A;  5AVC C;  4NE5 A;  3MGS A;  3C1B B;  5GT0 B;  1KX3 B;  4Z66 A;  1P3A B;  2RVQ C;  3A1K A;  1EQZ A;  5AVC D;  3W98 C;  2HIO B;  2DF4 C;  2PYO B;  2LY8 A;  5AV5 C;  3W97 C;  3C1B A;  5JA4 B;  5GT0 A;  1KX3 A;  1P3A A;  5CPJ A;  3AZF B;  5AV5 D;  5AV8 D;  2HIO A;  3AV1 C;  2PYO A;  1P3K C;  3AV1 D;  5C3I C;  5B2J B;  1F66 B;  5JA4 A;  1P3K D;  5F99 B;  4G92 B;  3B0C W;  5CP6 D;  4NE6 A;  5BS7 A;  3O62 C;  5B2J A;  1F66 A;  5F99 A;  2UWX A;  4J8W D;  3KUY D;  2F2A C;  4WNN B;  3O62 D;  2Y2L A;  3MVD C;  3X1T B;  3REK C;  5B33 B;  1AOI C;  3AZH D;  5KDM B;  1P3G C;  4LD9 D;  3X1V B;  4WNN A;  1S32 C;  1P3G D;  4YM6 B;  3B6G C;  2XD1 A;  5B32 G;  3X1T A;  5B24 B;  5B33 A;  1S32 D;  5KDM A;  5CPI C;  3B6G D;  3AZL B;  2FJ7 B;  4H9P B;  5AVB C;  3X1V A;  4J8V B;  2NZD A;  5CPI D;  5AV6 B;  3B6F C;  1P3B D;  3EG5 B;  1A7W A;  5B24 A;  5AVC B;  3B6F D;  3AZL A;  4H9P A;  4J8V A;  3VH5 W;  2BYK B;  3REH C;  3B0C T;  1KU5 A;  4JJN B;  3AN2 A;  1ID3 C;  5AV5 B;  5AV8 B;  1HQ3 C;  5AVC A;  3REH D;  3KFU G;  2FFF B;  5BT1 D;  1ID3 D;  3W99 C;  3X1U D;  3AV1 B;  5B1L C;  1P3K B;  1P3O C;  3W99 D;  4Z2M H;  5AV5 A;  5B1L D;  3W97 A;  2HUE C;  5C3I B;  5CP6 B;  1P3O D;  1WWS A;  2BYM B;  3AV1 A;  5CPK C;  1P3K A;  4J8W B;  3KUY B;  5B40 C;  5E5A D;  1M1A C;  3O62 B;  5CPK D;  5B40 D;  1M1A D;  2BYM A;  2YFW B;  3F6T A;  3AZH B;  4QLC B;  5AY8 C;  5B2I C;  3KXB C;  2ZY5 A;  3KWQ C;  3A1I A;  3REI D;  4LD9 B;  3KUY A;  1B67 A;  3O62 A;  2IO5 B;  5AY8 D;  5B2I D;  3KXB D;  3KWQ D;  3LEL D;  1P3G B;  1HTA A;  1Q9C A;  2YFW A;  3AZF C;  3B6G B;  3FDD A;  4J8X C;  4LD9 A;  1AOI A;  5CPI B;  3AZF D;  3AZI C;  1P3G A;  1P3B B;  4J8X D;  3MNN C;  2JE5 A;  1JFI B;  1S32 A;  5F99 C;  3AZI D;  3B6F B;  4G92 C;  3B6G A;  3MNN D;  2YFV B;  4YS3 D;  5CPI A;  2VQR A;  4E44 A;  1P3P D;  5BNV B;  3B6F A;  3REH B;  2YFV A;  3R45 B;  3X1T C;  4Z5T D;  3X1U B;  4XZQ C;  5AV9 D;  3W99 B;  3REL B;  5G49 B;  3X1V C;  5BNV A;  5B1L B;  4XZQ D;  3MGR D;  3REH A;  1P3O B;  3R45 A;  4YM6 C;  1ID3 A;  2HUE B;  3X1U A;  5B24 C;  4H9Q B;  1F1E A;  3MGQ D;  3W99 A;  3AZL C;  2FJ7 C;  5G49 A;  5B1L A;  5E5A B;  5CPK B;  1P3O A;  5AV6 C;  4WZS B;  5B40 B;  5GT3 D;  1N1J B;  5AV6 D;  2RIQ A;  4H9Q A;  3REI B;  1U35 C;  2JSS A;  5E5A A;  3LEL B;  5B2I B;  5AY8 B;  3KXB B;  3H0L C;  3KWQ B;  1H3O B;  4NFT A;  5CPK A;  1U35 D;  5B40 A;  5GSU C;  4JJN C;  1M1A A;  2F8N G;  5AV8 C;  5JRG C;  3REI A;  5FUG B;  5GSU D;  4JJN D;  3LEL A;  5AY8 A;  5JRG D;  5B2I A;  3KXB A;  3KWQ A;  1H3O A;  4J8X B;  3NQJ B;  3UT9 C;  4CSR B;  3AZI B;  3MNN B;  4ZUX C;  5CP6 C;  4X23 C;  3UTA C;  3UT9 D;  4YS3 B;  5FUG A;  3AZF A;  3UTA D;  4ZUX D;  4X23 D;  1W2E A;  4J8X A;  4HGA C;  1KX5 C;  3NQJ A;  2ZY2 A;  2Y2H A;  4CSR A;  1P3P B;  1BFM A;  3AZI A;  4J8W C;  3KUY C;  3MNN A;  1KX5 D;  4YS3 A;  1P3L D;  4Z5T B;  3WTP D;  1PZR A;  3AZH C;  5AV9 B;  4QLC C;  3AFA C;  1P3P A;  4LD9 C;  4XZQ B;  5B0Y D;  3MGR B;  3WA9 D;  4QLC D;  2IO5 C;  3AFA D;  1M18 D;  3MGP B;  5B32 C;  4Z5T A;  4R8P B;  5AV9 A;  3EPK A;  3MGQ B;  5B32 D;  2J8P A;  4XZQ A;  2Y2G A;  3MGR A;  4H9R B;  1P3B C;  1KX4 C;  5GT3 B;  4WU9 B;  4WJ3 C;  4YM6 A;  1KX4 D;  3MGQ A;  5B1M C;  2ZM5 A;  1U35 B;  4H9R A;  2FJ7 A;  5B1M D;  2F8N B;  5AV6 A;  5GSU B;  1ZLA B;  5BT1 C;  2Y2P A;  5JRG B;  3X1U C;  4KGC C;  3NQU B;  1U35 A;  1P3M C;  3REL C;  5DNM C;  1P3F D;  4KGC D;  2BYK A;  3UT9 B;  1P3M D;  5GSU A;  4JJN A;  3REL D;  5DNM D;  2CV5 C;  3UTA B;  4ZUX B;  5AV8 A;  5JRG A;  4X23 B;  3NQU A;  5GXQ A;  2CV5 D;  4HGA B;  1Z2C B;  4J8U B;  5E5A C;  1KX5 B;  3UT9 A;  1P3L B;  3UTA A;  3WTP B;  5CP6 A;  4ZUX A;  4X23 A;  5B31 G;  3REI C;  3WA9 B;  4Z2M G;  1BH9 B;  5B0Y B;  3EPL A;  1KX5 A;  3AFA B;  3LEL C;  1M18 B;  4G91 C;  1P3L A;  3EPH A;  4J8W A;  3REJ D;  5B32 B;  3X1S D;  3C1C C;  3WA9 A;  5B0Y A;  1BH9 A;  3AZH A;  4QLC A;  3AFA A;  3VH6 A;  1M18 A;  3C1C D;  3WAA D;  1T3U A;  2G5I C;  1KX4 B;  5B32 A;  4YS3 C;  2G5H C;  5B0Z D;  5B1M B;  1P34 C;  3AZG C;  3AL0 C;  1P3P C;  1P3B A;  1KX4 A;  1BH8 B;  1P34 D;  3AZG D;  4WU8 D;  1JFI A;  3B0D C;  5CPJ D;  3AYW C;  3A6N C;  4Z5T C;  2NQB C;  5AV9 C;  3UTB C;  5B1M A;  3AYW D;  3A6N D;  3W96 C;  4DRB A;  1P3F B;  2NQB D;  4KGC B;  3MGR C;  2XD5 A;  4KHA B;  3AZK B;  3UTB D;  1BH8 A;  1P3M B;  5DNM B;  2Y2I A;  3MGP C;  3W96 D;  4R8P C;  3MGP D;  4AWL C;  2CV5 B;  3MGQ C;  4KGC A;  1P3F A;  3LZ0 D;  4R8P D;  4KHA A;  1P3M A;  3REL A;  5DNM A;  5BNX B;  5GT3 C;  4WU9 C;  3V9R B;  2CV5 A;  5DNN C;  2F8N K;  4WU9 D;  1R4V A;  3REJ B;  5DNN D;  5BNX A;  4H9O B;  4G91 B;  2Y2J A;  3AV2 C;  3X1S B;  3V9R A;  2CWE A;  4H9N B;  1ZLA C;  1N1J A;  2F8N D;  3AV2 D;  3KSY A;  3C1C B;  5GXQ C;  3AN2 C;  1ZLA D;  3REJ A;  3WAA B;  2NZD D;  4H9O A;  3AN2 D;  5GXQ D;  3X1S A;  4H9N A;  4DQY B;  3LJA C;  5B0Z B;  3WKJ C;  3C1C A;  4ZBJ C;  4EO5 C;  3LJA D;  2Y2M A;  3WKJ D;  2BG1 A;  4J8U C;  1P34 B;  3AZG B;  4WU8 B;  1P3L C;  5CPJ B;  5BO0 B;  4J8U D;  5B0Z A;  3WTP C;  3B0D B;  2RVQ D;  3A6N B;  3AYW B;  2NQB B;  3W98 D;  3WA9 C;  5B0Y C;  3UTB B;  1P34 A;  1M18 C;  3AZG A;  4WU8 A;  3W96 B;  3AZE C;  5BO0 A;  3W97 D;  2ZY3 A;  3AZE D;  3AYW A;  3A6N A;  2NQB A;  3LZ0 B;  3UTB A;  4AWL B;  3TU4 C;  3W96 A;  3TU4 D;  3MGP A;  4H9S C;  2Y2O A;  3LZ0 A;  4R8P A;  5DNN B;  4WV4 B;  5GT3 A;  4WU9 A;  3AV2 B;  3MVD D;  4KUD C;  5CHL B;  4XUJ C;  3REK D;  5DNN A;  1AOI D;  1B6W A;  2NZD B;  4KUD D;  1P3F C;  4XUJ D;  3AN2 B;  5GXQ B;  3AZK C;  2W8S A;  2F8N A;  3AV2 A;  3AZK D;  1ZLA A;  1M19 C;  3LJA B;  3WKJ B;  3B0B A;  4ZBJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...