3AN2B

The structure of the centromeric nucleosome containing cenp-a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2B00
4XZQD 3AZJA 2F8NA 2HIOC 2NZDD 5B31D 3VH6T 3AZMA 1BH9B 1P3KC 1EQZC 4J8UB 3AV2B 3KXBB 3MVDA 5B1LB 1M18C 3AYWA 2RVQC 3AZHA 5B32A 3KWQD 3REJA 5BNXB 3AN2C 3MGQD 1P34D 3R45A 2YFVB 3NQUA 5JRGA 1P3OB 3AZLB 3C1CB 4G92C 3KWQB 5BNVA 1M1AB 3AV1A 3X1SB 3W96D 1AOIB 1P3GD 1KX4D 2BYKA 5BT1D 3W98C 4UUZB 5GT3D 1P3IA 3UT9C 1S32D 3B6GD 4H9QA 1KX4B 3X1UB 1BFMA 3O62C 3AZKA 1P3PC 1A7WA 3LZ0D 2CV5A 3REIA 4ZUXD 2PYOD 5GT3B 3B6GB 5G49B 3LJAA 4XZQA 2IO5C 1M19D 5B24B 1B67A 3LZ0B 3REKC 3AZJC 5AV5A 4ZUXB 3AZMC 4M6BA 3AZFA 1U35D 3UTAA 3WTPA 4AWLB 5B0YB 3AYWC 1M19B 3MNNB 5B32C 3REJC 2YFWA 4E45A 3AZGD 3X1VB 4EO5B 5JRGC 5GT0D 5B1MD 1P3LD 3AFAB 3AZED 5B33A 1P3GA 3WKJD 3WA9A 3AV1C 3AZGB 2AROD 4H9NA 1KX5C 2BYMA 5GT0B 3W97D 4KGCD 1P3LB 4J8WA 5B32G 1S32A 3UTBD 3LZ1A 3MGSA 4XUJC 2AROB 4WU9A 4KGCB 3X1TD 3AZKC 2PYOA 2CV5C 3REIC 2CWEA 3UTBB 2HIOB 3LJAC 4NE5A 5DNMA 3X1TB 1P3FC 1HTAA 5AV5C 3RELD 5CPJD 3UTAC 1WWSA 3WTPC 4R8PC 5B2ID 5DNNA 3W99A 1N1JB 3B0CT 3AZND 5CPID 4KUDA 1ID3D 1BH8B 3RELB 4JJND 4G92B 2LY8A 5AVBA 1HQ3A 4WU8C 4H9PA 5B31G 3AZNB 3LELD 5B33C 3TU4A 5AVCD 3C1BD 3WA9C 4X23A 4G91C 3UT9B 2HUEB 4YS3D 4J8WC 1JFIA 5F99A 2NQBD 5CP6A 3MGRC 4YM6D 4Z66A 3REKD 3LZ1C 3C1BB 3KUYC 3B6FD 1KU5A 4WU9C 5CPKD 3MGPA 5E5AA 2IO5B 2NQBB 3NQJB 4J8VA 4YM6B 3REHA 3REKB 3AZJB 2F8NB 3AZMB 1TZYA 5DNMC 5AV9A 5CPKB 1TAFB 3KXBD 3AV2D 1P3AA 4KHAB 3AYWB 4QLCC 3AZID 3VH5A 1P3MA 5B2IA 3REJB 5AV6D 5BO0B 5DNNC 5CPIA 3W99C 1ID3A 1KX5D 4KUDC 1P3OD 3AZIB 1ZLAA 3AZLD 3C1CD 5B2JD 5AV6B 5AVBC 5BNVB 1HQ3C 1M1AD 3X1SD 4XUJD 5AVCA 1KX5B 1AOID 2BYKB 3TU4C 4LD9A 4ZBJB 3VH6A 4X23C 5B2JB 4YS3A 1KX3A 4XUJB 1P3BA 4H9QB 1F66D 5CP6C 3X1UD 3B6FA 4WNNA 5KDMA 4J8XA 3V9RA 4Z66C 5GXQA 2L5AA 2CV5B 3MGPC 5E5AC 5AY8A 1F66B 4Z5TD 4J8VC 3WAAD 4E44A 3REHC 1BH9A 1P3FB 5B24D 5AV5B 4J8UA 3AV2A 5B40A 4H9SA 1TZYC 5B1LA 3UTAB 5AV9C 1P3AC 4R8PB 5B0YD 4DRAA 5BNXA 4HGAC 4Z5TB 3WAAB 3MNND 5B31A 1P3MC 2NZDA 1P3OA 5B0ZD 3MVDC 3X1VD 4WU8B 3KWQA 3AZHC 1ZLAC 3MGQA 1P34A 3AFAD 1M1AA 4CSRA 5B0ZB 4G91B 5AV8D 2FJ7D 4LD9C 3A6ND 1KX3C 3MGRB 3W96A 3VH5W 1KX4A 3KUYB 1P3BC 2F8NK 4WU9B 5AV8B 2FJ7B 4J8XC 5GT3A 5GXQC 5GSUD 3A6NB 3B6GA 4WV4B 4H9OB 1P3IC 4H9RB 2HIOD 5AY8C 3LZ0A 1P3KD 1EQZD 4ZUXA 5C3IC 5GSUB 1M18D 4QLCB 5B40C 2RVQD 5B1LC 3VH6W 1M19A 3AN2D 4XZQC 5DNNB 1P3KB 3W99B 4Z2MH 1EQZB 2NZDC 5B31C 1U35A 1M18B 3AZFC 3AN2B 3KWQC 4CAYA 1ULYA 3MGQC 1P34C 3AZGA 5GT0A 3W98D 5B1MA 1P3LA 3AZEA 3UT9D 1JFIB 3WKJA 5CP6B 2AROA 3W96C 3O62D 1P3GC 1P3PD 1KX4C 3W97A 3W98B 4KGCA 5BT1C 3UTBA 5E5AB 5GT3C 3KSYA 1S32C 2HIOA 3O62B 3REHB 1P3PB 3AZJD 2F8ND 3MGSC 3X1TA 2JSSA 3AZMD 5FUGB 3LZ0C 4Z2MG 4ZUXC 1P3AB 2PYOC 1F1EA 3AYWD 4HGAB 4AWLC 1P3MB 5B32D 3REJD 1M19C 1N1JA 4NE6A 1WWIA 3MVDB 3RELA 5CPJA 1U35C 5JRGD 3AZHB 5B32B 3AZNA 3R45B 3AV1D 3NQUB 1H3OA 4JJNA 5JRGB 3AZGC 4LD9B 3UT9A 5BS7A 5B1MC 1P3LC 1P3ID 3AZEC 4NE3A 3AV1B 3LELA 3WKJC 3C1BA 4WNNB 4J8XB 3AZKD 3V9RB 5GXQB 4NFTA 2CV5D 3W97C 4KGCC 3REID 1P3IB 3UTBC 2NQBA 3LJAD 4YM6A 5AY8B 3REKA 5F99C 3AZKB 3B0DC 5C3IB 3WTPE 1P3FD 3REIB 5AV5D 3X1TC 1TAFA 5B40B 5CPKA 3AZFD 4KHAA 3UTAD 3WTPD 4R8PD 3LJAB 4XZQB 5JA4A 2NZDB 5B31B 5BO0A 3KXBA 3AZFB 3WTPB 3AZIA 3RELC 5CPJC 4WU8D 3B0CW 5AV6A 3MGQB 1P34B 5B2IC 2YFVA 4CSRB 5B33D 2YFWB 3AZNC 1KX5A 3WA9D 5CPIC 1ID3C 3AZLA 4JJNC 3C1CA 2F8NH 5B2JA 4J8WD 5BS7C 2HUEC 3X1SA 4XUJA 5B33B 3W96B 3MGRD 1P3GB 1AOIA 3LZ1D 3WA9B 3LELC 3MGSD 3KUYD 4H9NB 5AVCC 4WU9D 3C1BC 2BYMB 4UUZA 4J8WB 1S32B 4YS3C 3LZ1B 1F66A 2NQBC 3X1UA 3MGSB 4YM6C 1P3FA 5DNMD 2PYOB 3B6FC 5CPKC 5G49A 4QLCD 4R8PA 4Z5TA 3WAAA 5B24A 5DNMB 5DNND 3W99D 1U35B 1Q9CA 4KUDD 4J8UC 3AV2C 3KXBC 4H9SC 5B0YA 4WU8A 5CHLB 3AZIC 5AVBD 3MNNA 1HQ3D 2F8NG 4CAYB 5AV6C 4KUDB 5B0ZA 3TU4D 3X1VA 4X23D 1P3OC 5B1MB 5AVBB 3AZLC 1HQ3B 4ZBJC 4H9PB 3AFAA 5B2JC 3C1CC 3AZEB 3MGRA 3WKJB 1M1AC 5F99D 3KUYA 3X1SC 5CP6D 3B0BA 3TU4B 4WZSB 4Z66D 5AV8A 1AOIC 2FJ7A 3W97B 1R4VA 4X23B 3A6NA 3MGPD 5E5AD 4H9OA 5F99B 4H9RA 4J8VD 3B0DB 3REHD 4Z66B 1F66C 3X1UC 1TZYD 5GSUA 5AV9D 4QLCA 3MGPB 1P3AD 3B6GC 4J8VB 1P3MD 1P3KA 4Z5TC 3WAAC 1EQZA 5B24C 1TZYB 1M18A 5AV9B 5CPJB 3MVDD 3AZHD 5B0YC 3AN2A 1ZLAD 5B2IB 1B6WA 3MNNC 5CPIB 1ID3B 1BH8A 1H3OB 4JJNB 4DRBA 5B0ZC 4LD9D 3X1VC 4EO5C 1ZLAB 1KX3D 3AFAC 3LELB 1P3BD 5AVCB 3W98A 3VH5T 4J8XD 5GXQD 5AV8C 2FJ7C 5GT0C 4YS3B 1KX3B 3A6NC 3O62A 1P3PA 1P3BB 5AY8D 3B6FB 5KDMB 2AROC 5FUGA 4J8UD 5B40D 5B1LD 5GSUC 3NQJA 5JA4B
chains in the Genus database with same CATH superfamily
4XZQD 3AZJA 2F8NA 2HIOC 2NZDD 5B31D 3VH6T 3AZMA 1BH9B 1P3KC 1EQZC 4J8UB 3AV2B 3KXBB 3MVDA 5B1LB 1M18C 3AYWA 2DF4C 2RVQC 3AZHA 5B32A 3KWQD 3REJA 5BNXB 3AN2C 3MGQD 2Y2JA 1P34D 3R45A 2YFVB 3NQUA 5JRGA 1P3OB 3AZLB 3C1CB 4G92C 3KWQB 5BNVA 1M1AB 3AV1A 3X1SB 3W96D 1AOIB 1P3GD 1KX4D 2BYKA 5BT1D 3W98C 4UUZB 5GT3D 1P3IA 3UT9C 1S32D 3B6GD 3H0RC 3EPJA 4H9QA 1KX4B 3X1UB 1BFMA 3O62C 3AZKA 1P3PC 1A7WA 3LZ0D 2CV5A 3REIA 4ZUXD 2PYOD 5GT3B 2DQNC 3B6GB 5G49B 3LJAA 4XZQA 2IO5C 1M19D 5B24B 1B67A 2BG1A 3LZ0B 3REKC 3AZJC 5AV5A 4ZUXB 3AZMC 4M6BA 3AZFA 1U35D 3UTAA 3WTPA 4AWLB 5B0YB 3AYWC 2Y2LA 2ZY3A 1M19B 3MNNB 5B32C 3REJC 2YFWA 4E45A 3AZGD 3X1VB 2Y2GA 4EO5B 1T3UA 5JRGC 5GT0D 5B1MD 1P3LD 3AFAB 3AZED 5B33A 1P3GA 3WKJD 3WA9A 3AV1C 3AZGB 2AROD 4H9NA 1KX5C 2BYMA 5GT0B 3W97D 4KGCD 1P3LB 4J8WA 5B32G 1S32A 3UTBD 3LZ1A 3MGSA 4XUJC 2AROB 4WU9A 4KGCB 3X1TD 3AZKC 2PYOA 2CV5C 3REIC 2CWEA 3UTBB 2ZM5A 2HIOB 3LJAC 4NE5A 5DNMA 2G5HC 3X1TB 1P3FC 3H0LC 1HTAA 5AV5C 3RELD 5CPJD 3UTAC 1WWSA 3WTPC 4R8PC 5B2ID 5DNNA 3W99A 2Y2HA 1N1JB 3B0CT 3AZND 5CPID 4KUDA 1ID3D 1BH8B 3RELB 4JJND 4G92B 2LY8A 5AVBA 1HQ3A 4WU8C 4H9PA 5B31G 3AZNB 3LELD 5B33C 3TU4A 5AVCD 3C1BD 3WA9C 2XD1A 3A1IA 4X23A 4G91C 3UT9B 3H0MC 2HUEB 4YS3D 4J8WC 1JFIA 5F99A 2W8SA 5CP6A 2NQBD 1Z2CB 2ZY5A 4YM6D 4Z66A 3MGRC 3LZ1C 3C1BB 3REKD 3KUYC 3B6FD 1KU5A 4WU9C 5CPKD 3MGPA 5E5AA 2IO5B 2NQBB 3NQJB 4J8VA 4YM6B 3REHA 3REKB 3AZJB 2F8NB 3AZMB 1TZYA 5DNMC 5AV9A 5CPKB 1TAFB 3KXBD 3AV2D 1P3AA 4KHAB 3AYWB 4QLCC 3AZID 3VH5A 1P3MA 5B2IA 3REJB 5AV6D 1PZRA 5BO0B 5DNNC 5CPIA 3W99C 1ID3A 1KX5D 4KUDC 1P3OD 3AZIB 1ZLAA 3AZLD 3C1CD 5B2JD 5AV6B 5AVBC 5BNVB 1HQ3C 1M1AD 3X1SD 4XUJD 5AVCA 1KX5B 1AOID 2BYKB 2JE5A 3TU4C 4LD9A 4ZBJB 3VH6A 4X23C 5B2JB 4YS3A 1KX3A 4XUJB 1P3BA 4H9QB 1F66D 5CP6C 3X1UD 3B6FA 4WNNA 5KDMA 4J8XA 3V9RA 4Z66C 5GXQA 2L5AA 2CV5B 3MGPC 5E5AC 2FFFB 5AY8A 1F66B 4Z5TD 3EPLA 4J8VC 3WAAD 4E44A 3REHC 1BH9A 1P3FB 5B24D 5AV5B 4J8UA 3AV2A 5B40A 4H9SA 1TZYC 5B1LA 3UTAB 5AV9C 1P3AC 4R8PB 5B0YD 4DRAA 5BNXA 4HGAC 4Z5TB 3WAAB 3MNND 5B31A 1P3MC 2NZDA 2Y2KA 2JCHA 1P3OA 5B0ZD 3MVDC 3X1VD 4WU8B 3KWQA 3AZHC 1ZLAC 3MGQA 1P34A 3AFAD 1M1AA 4CSRA 2Y2QA 5B0ZB 4G91B 5AV8D 2FJ7D 4LD9C 3F6TA 3FDDA 3A6ND 1KX3C 3MGRB 3W96A 3VH5W 1KX4A 3KUYB 1P3BC 2F8NK 1W2EA 4WU9B 5AV8B 2FJ7B 4J8XC 5GT3A 5GXQC 5GSUD 3A6NB 3B6GA 4WV4B 3IP4C 4H9OB 1P3IC 3AL0C 4H9RB 2HIOD 5AY8C 3LZ0A 1P3KD 1EQZD 4ZUXA 2RIQA 5C3IC 5GSUB 1M18D 4QLCB 5B40C 2RVQD 5B1LC 3VH6W 1M19A 3AN2D 4XZQC 5DNNB 1P3KB 3W99B 4Z2MH 1EQZB 2NZDC 5B31C 1U35A 1M18B 3AZFC 3AN2B 3KWQC 4CAYA 1ULYA 2ZY4A 3MGQC 1P34C 3AZGA 5GT0A 3W98D 5B1MA 1P3LA 3AZEA 3UT9D 1JFIB 3WKJA 5CP6B 2VQRA 4UPKA 2AROA 3W96C 3O62D 1P3GC 1P3PD 1KX4C 3W97A 3W98B 4KGCA 5BT1C 3UTBA 5E5AB 5GT3C 3KSYA 1S32C 2HIOA 3O62B 3REHB 1P3PB 3AZJD 2F8ND 3MGSC 3X1TA 2JSSA 3AZMD 5FUGB 3LZ0C 4Z2MG 4ZUXC 1P3AB 2PYOC 1F1EA 3AYWD 4HGAB 4AWLC 1P3MB 5B32D 3REJD 1M19C 1N1JA 4NE6A 1WWIA 3MVDB 3RELA 5CPJA 1U35C 5JRGD 3AZHB 5B32B 3EG5B 3AZNA 3R45B 3AV1D 3NQUB 1H3OA 4JJNA 5JRGB 3AZGC 4LD9B 2J8PA 3UT9A 5BS7A 5B1MC 1P3LC 1P3ID 3AZEC 4NE3A 3AV1B 3LELA 4DQYB 3WKJC 3C1BA 4WNNB 4J8XB 3AZKD 3V9RB 5GXQB 4NFTA 2CV5D 3W97C 4KGCC 3REID 1P3IB 3UTBC 2NQBA 3LJAD 4YM6A 5AY8B 3REKA 5F99C 3AZKB 3B0DC 5C3IB 3WTPE 1P3FD 3REIB 5AV5D 3X1TC 1TAFA 5B40B 5CPKA 3AZFD 4KHAA 3UTAD 3WTPD 4R8PD 3LJAB 4XZQB 5JA4A 2NZDB 5B31B 5BO0A 3KXBA 3AZFB 3WTPB 3AZIA 3RELC 5CPJC 4WU8D 3B0CW 5AV6A 3MGQB 1P34B 5B2IC 2YFVA 4CSRB 5B33D 2YFWB 3AZNC 1KX5A 3WA9D 5CPIC 2G5IC 1ID3C 3AZLA 4JJNC 2F2AC 3C1CA 2F8NH 5B2JA 4J8WD 5BS7C 2HUEC 3X1SA 4XUJA 5B33B 3W96B 3MGRD 1P3GB 1AOIA 3LZ1D 3WA9B 3LELC 3MGSD 3KUYD 4H9NB 5AVCC 4WU9D 3C1BC 2BYMB 4UUZA 4J8WB 1S32B 4YS3C 3LZ1B 1F66A 2NQBC 3X1UA 3MGSB 4WJ3C 4YM6C 1P3FA 5DNMD 2PYOB 3B6FC 5CPKC 5G49A 4QLCD 4R8PA 4Z5TA 3WAAA 2XD5A 5B24A 5DNMB 5DNND 3W99D 1U35B 1Q9CA 4KUDD 4J8UC 3AV2C 3KXBC 4H9SC 5B0YA 4WU8A 5CHLB 3AZIC 5AVBD 3MNNA 1HQ3D 2F8NG 4CAYB 5AV6C 2Y2MA 4KUDB 2ZY2A 5B0ZA 3TU4D 3X1VA 4X23D 1P3OC 5B1MB 5AVBB 3AZLC 1HQ3B 4ZBJC 4H9PB 3AFAA 5B2JC 3C1CC 3AZEB 3EPHA 3MGRA 3WKJB 1M1AC 5F99D 3KUYA 3X1SC 5CP6D 3B0BA 3TU4B 4WZSB 4Z66D 5AV8A 1AOIC 2FJ7A 3W97B 1R4VA 4X23B 3A6NA 3MGPD 5E5AD 4H9OA 5F99B 4H9RA 4J8VD 3B0DB 3REHD 4Z66B 1F66C 3X1UC 1TZYD 5GSUA 5AV9D 2Y2IA 4QLCA 3MGPB 1P3AD 3B6GC 4J8VB 1P3MD 1P3KA 4Z5TC 3WAAC 1EQZA 5B24C 1TZYB 1M18A 5AV9B 3A1KA 2Y2PA 2Y2NA 5CPJB 3MVDD 3AZHD 5B0YC 3AN2A 1ZLAD 5B2IB 1B6WA 3MNNC 5CPIB 2UWXA 1ID3B 3KFUG 1BH8A 1H3OB 4JJNB 4DRBA 5B0ZC 4LD9D 3X1VC 4EO5C 1ZLAB 3EPKA 1KX3D 3AFAC 3LELB 1P3BD 5AVCB 2Y2OA 3W98A 3VH5T 4J8XD 5GXQD 5AV8C 2FJ7C 5GT0C 3P5JB 4YS3B 1KX3B 3A6NC 3O62A 1P3PA 1P3BB 5AY8D 3B6FB 5KDMB 2AROC 5FUGA 4J8UD 5B40D 5B1LD 5GSUC 3NQJA 5JA4B
chains in the Genus database with same CATH topology
4XZQD 3AZJA 2F8NA 2HIOC 2NZDD 5B31D 3VH6T 3AZMA 1BH9B 1P3KC 1EQZC 4J8UB 3AV2B 3KXBB 3MVDA 5B1LB 1M18C 3AYWA 2DF4C 2RVQC 3AZHA 5B32A 3KWQD 3REJA 5BNXB 3AN2C 3MGQD 2Y2JA 1P34D 3R45A 2YFVB 3NQUA 5JRGA 1P3OB 3AZLB 3C1CB 4G92C 3KWQB 5BNVA 1M1AB 3AV1A 3X1SB 3W96D 1AOIB 1P3GD 1KX4D 2BYKA 5BT1D 3W98C 4UUZB 5GT3D 1P3IA 3UT9C 1S32D 3B6GD 3H0RC 3EPJA 4H9QA 1KX4B 3X1UB 1BFMA 3O62C 3AZKA 1P3PC 1A7WA 3LZ0D 2CV5A 3REIA 4ZUXD 2PYOD 5GT3B 2DQNC 3B6GB 5G49B 3LJAA 4XZQA 2IO5C 1M19D 5B24B 1B67A 2BG1A 3LZ0B 3REKC 3AZJC 5AV5A 4ZUXB 3AZMC 4M6BA 3AZFA 1U35D 3UTAA 3WTPA 4AWLB 5B0YB 3AYWC 2Y2LA 2ZY3A 1M19B 3MNNB 5B32C 3REJC 2YFWA 4E45A 3AZGD 3X1VB 2Y2GA 4EO5B 1T3UA 5JRGC 5GT0D 5B1MD 1P3LD 3AFAB 3AZED 5B33A 1P3GA 3WKJD 3WA9A 3AV1C 3AZGB 2AROD 4H9NA 1KX5C 2BYMA 5GT0B 3W97D 4KGCD 1P3LB 4J8WA 5B32G 1S32A 3UTBD 3LZ1A 3MGSA 4XUJC 2AROB 4WU9A 4KGCB 3X1TD 3AZKC 2PYOA 2CV5C 3REIC 2CWEA 3UTBB 2ZM5A 2HIOB 3LJAC 4NE5A 5DNMA 2G5HC 3X1TB 1P3FC 3H0LC 1HTAA 5AV5C 3RELD 5CPJD 3UTAC 1WWSA 3WTPC 4R8PC 5B2ID 5DNNA 3W99A 2Y2HA 1N1JB 3B0CT 3AZND 5CPID 4KUDA 1ID3D 1BH8B 3RELB 4JJND 4G92B 2LY8A 5AVBA 1HQ3A 4WU8C 4H9PA 5B31G 3AZNB 3LELD 5B33C 3TU4A 5AVCD 3C1BD 3WA9C 2XD1A 3A1IA 4X23A 4G91C 3UT9B 3H0MC 2HUEB 4YS3D 4J8WC 1JFIA 5F99A 2W8SA 5CP6A 2NQBD 1Z2CB 2ZY5A 4YM6D 4Z66A 3MGRC 3LZ1C 3C1BB 3REKD 3KUYC 3B6FD 1KU5A 4WU9C 5CPKD 3MGPA 5E5AA 2IO5B 2NQBB 3NQJB 4J8VA 4YM6B 3REHA 3REKB 3AZJB 2F8NB 3AZMB 1TZYA 5DNMC 5AV9A 5CPKB 1TAFB 3KXBD 3AV2D 1P3AA 4KHAB 3AYWB 4QLCC 3AZID 3VH5A 1P3MA 5B2IA 3REJB 5AV6D 1PZRA 5BO0B 5DNNC 5CPIA 3W99C 1ID3A 1KX5D 4KUDC 1P3OD 3AZIB 1ZLAA 3AZLD 3C1CD 5B2JD 5AV6B 5AVBC 5BNVB 1HQ3C 1M1AD 3X1SD 4XUJD 5AVCA 1KX5B 1AOID 2BYKB 2JE5A 3TU4C 4LD9A 4ZBJB 3VH6A 4X23C 5B2JB 4YS3A 1KX3A 4XUJB 1P3BA 4H9QB 1F66D 5CP6C 3X1UD 3B6FA 4WNNA 5KDMA 4J8XA 3V9RA 4Z66C 5GXQA 2L5AA 2CV5B 3MGPC 5E5AC 2FFFB 5AY8A 1F66B 4Z5TD 3EPLA 4J8VC 3WAAD 4E44A 3REHC 1BH9A 1P3FB 5B24D 5AV5B 4J8UA 3AV2A 5B40A 4H9SA 1TZYC 5B1LA 3UTAB 5AV9C 1P3AC 4R8PB 5B0YD 4DRAA 5BNXA 4HGAC 4Z5TB 3WAAB 3MNND 5B31A 1P3MC 2NZDA 2Y2KA 2JCHA 1P3OA 5B0ZD 3MVDC 3X1VD 4WU8B 3KWQA 3AZHC 1ZLAC 3MGQA 1P34A 3AFAD 1M1AA 4CSRA 2Y2QA 5B0ZB 4G91B 5AV8D 2FJ7D 4LD9C 3F6TA 3FDDA 3A6ND 1KX3C 3MGRB 3W96A 3VH5W 1KX4A 3KUYB 1P3BC 2F8NK 1W2EA 4WU9B 5AV8B 2FJ7B 4J8XC 5GT3A 5GXQC 5GSUD 3A6NB 3B6GA 4WV4B 3IP4C 4H9OB 1P3IC 3AL0C 4H9RB 2HIOD 5AY8C 3LZ0A 1P3KD 1EQZD 4ZUXA 2RIQA 5C3IC 5GSUB 1M18D 4QLCB 5B40C 2RVQD 5B1LC 3VH6W 1M19A 3AN2D 4XZQC 5DNNB 1P3KB 3W99B 4Z2MH 1EQZB 2NZDC 5B31C 1U35A 1M18B 3AZFC 3AN2B 3KWQC 4CAYA 1ULYA 2ZY4A 3MGQC 1P34C 3AZGA 5GT0A 3W98D 5B1MA 1P3LA 3AZEA 3UT9D 1JFIB 3WKJA 5CP6B 2VQRA 4UPKA 2AROA 3W96C 3O62D 1P3GC 1P3PD 1KX4C 3W97A 3W98B 4KGCA 5BT1C 3UTBA 5E5AB 5GT3C 3KSYA 1S32C 2HIOA 3O62B 3REHB 1P3PB 3AZJD 2F8ND 3MGSC 3X1TA 2JSSA 3AZMD 5FUGB 3LZ0C 4Z2MG 4ZUXC 1P3AB 2PYOC 1F1EA 3AYWD 4HGAB 4AWLC 1P3MB 5B32D 3REJD 1M19C 1N1JA 4NE6A 1WWIA 3MVDB 3RELA 5CPJA 1U35C 5JRGD 3AZHB 5B32B 3EG5B 3AZNA 3R45B 3AV1D 3NQUB 1H3OA 4JJNA 5JRGB 3AZGC 4LD9B 2J8PA 3UT9A 5BS7A 5B1MC 1P3LC 1P3ID 3AZEC 4NE3A 3AV1B 3LELA 4DQYB 3WKJC 3C1BA 4WNNB 4J8XB 3AZKD 3V9RB 5GXQB 4NFTA 2CV5D 3W97C 4KGCC 3REID 1P3IB 3UTBC 2NQBA 3LJAD 4YM6A 5AY8B 3REKA 5F99C 3AZKB 3B0DC 5C3IB 3WTPE 1P3FD 3REIB 5AV5D 3X1TC 1TAFA 5B40B 5CPKA 3AZFD 4KHAA 3UTAD 3WTPD 4R8PD 3LJAB 4XZQB 5JA4A 2NZDB 5B31B 5BO0A 3KXBA 3AZFB 3WTPB 3AZIA 3RELC 5CPJC 4WU8D 3B0CW 5AV6A 3MGQB 1P34B 5B2IC 2YFVA 4CSRB 5B33D 2YFWB 3AZNC 1KX5A 3WA9D 5CPIC 2G5IC 1ID3C 3AZLA 4JJNC 2F2AC 3C1CA 2F8NH 5B2JA 4J8WD 5BS7C 2HUEC 3X1SA 4XUJA 5B33B 3W96B 3MGRD 1P3GB 1AOIA 3LZ1D 3WA9B 3LELC 3MGSD 3KUYD 4H9NB 5AVCC 4WU9D 3C1BC 2BYMB 4UUZA 4J8WB 1S32B 4YS3C 3LZ1B 1F66A 2NQBC 3X1UA 3MGSB 4WJ3C 4YM6C 1P3FA 5DNMD 2PYOB 3B6FC 5CPKC 5G49A 4QLCD 4R8PA 4Z5TA 3WAAA 2XD5A 5B24A 5DNMB 5DNND 3W99D 1U35B 1Q9CA 4KUDD 4J8UC 3AV2C 3KXBC 4H9SC 5B0YA 4WU8A 5CHLB 3AZIC 5AVBD 3MNNA 1HQ3D 2F8NG 4CAYB 5AV6C 2Y2MA 4KUDB 2ZY2A 5B0ZA 3TU4D 3X1VA 4X23D 1P3OC 5B1MB 5AVBB 3AZLC 1HQ3B 4ZBJC 4H9PB 3AFAA 5B2JC 3C1CC 3AZEB 3EPHA 3MGRA 3WKJB 1M1AC 5F99D 3KUYA 3X1SC 5CP6D 3B0BA 3TU4B 4WZSB 4Z66D 5AV8A 1AOIC 2FJ7A 3W97B 1R4VA 4X23B 3A6NA 3MGPD 5E5AD 4H9OA 5F99B 4H9RA 4J8VD 3B0DB 3REHD 4Z66B 1F66C 3X1UC 1TZYD 5GSUA 5AV9D 2Y2IA 4QLCA 3MGPB 1P3AD 3B6GC 4J8VB 1P3MD 1P3KA 4Z5TC 3WAAC 1EQZA 5B24C 1TZYB 1M18A 5AV9B 3A1KA 2Y2PA 2Y2NA 5CPJB 3MVDD 3AZHD 5B0YC 3AN2A 1ZLAD 5B2IB 1B6WA 3MNNC 5CPIB 2UWXA 1ID3B 3KFUG 1BH8A 1H3OB 4JJNB 4DRBA 5B0ZC 4LD9D 3X1VC 4EO5C 1ZLAB 3EPKA 1KX3D 3AFAC 3LELB 1P3BD 5AVCB 2Y2OA 3W98A 3VH5T 4J8XD 5GXQD 5AV8C 2FJ7C 5GT0C 3P5JB 4YS3B 1KX3B 3A6NC 3O62A 1P3PA 1P3BB 5AY8D 3B6FB 5KDMB 2AROC 5FUGA 4J8UD 5B40D 5B1LD 5GSUC 3NQJA 5JA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  3AZJ A;  2F8N A;  2HIO C;  2NZD D;  5B31 D;  3VH6 T;  3AZM A;  1BH9 B;  1P3K C;  1EQZ C;  4J8U B;  3AV2 B;  3KXB B;  3MVD A;  5B1L B;  1M18 C;  3AYW A;  2RVQ C;  3AZH A;  5B32 A;  3KWQ D;  3REJ A;  5BNX B;  3AN2 C;  3MGQ D;  1P34 D;  3R45 A;  2YFV B;  3NQU A;  5JRG A;  1P3O B;  3AZL B;  3C1C B;  4G92 C;  3KWQ B;  5BNV A;  1M1A B;  3AV1 A;  3X1S B;  3W96 D;  1AOI B;  1P3G D;  1KX4 D;  2BYK A;  5BT1 D;  3W98 C;  4UUZ B;  5GT3 D;  1P3I A;  3UT9 C;  1S32 D;  3B6G D;  4H9Q A;  1KX4 B;  3X1U B;  1BFM A;  3O62 C;  3AZK A;  1P3P C;  1A7W A;  3LZ0 D;  2CV5 A;  3REI A;  4ZUX D;  2PYO D;  5GT3 B;  3B6G B;  5G49 B;  3LJA A;  4XZQ A;  2IO5 C;  1M19 D;  5B24 B;  1B67 A;  3LZ0 B;  3REK C;  3AZJ C;  5AV5 A;  4ZUX B;  3AZM C;  4M6B A;  3AZF A;  1U35 D;  3UTA A;  3WTP A;  4AWL B;  5B0Y B;  3AYW C;  1M19 B;  3MNN B;  5B32 C;  3REJ C;  2YFW A;  4E45 A;  3AZG D;  3X1V B;  4EO5 B;  5JRG C;  5GT0 D;  5B1M D;  1P3L D;  3AFA B;  3AZE D;  5B33 A;  1P3G A;  3WKJ D;  3WA9 A;  3AV1 C;  3AZG B;  2ARO D;  4H9N A;  1KX5 C;  2BYM A;  5GT0 B;  3W97 D;  4KGC D;  1P3L B;  4J8W A;  5B32 G;  1S32 A;  3UTB D;  3LZ1 A;  3MGS A;  4XUJ C;  2ARO B;  4WU9 A;  4KGC B;  3X1T D;  3AZK C;  2PYO A;  2CV5 C;  3REI C;  2CWE A;  3UTB B;  2HIO B;  3LJA C;  4NE5 A;  5DNM A;  3X1T B;  1P3F C;  1HTA A;  5AV5 C;  3REL D;  5CPJ D;  3UTA C;  1WWS A;  3WTP C;  4R8P C;  5B2I D;  5DNN A;  3W99 A;  1N1J B;  3B0C T;  3AZN D;  5CPI D;  4KUD A;  1ID3 D;  1BH8 B;  3REL B;  4JJN D;  4G92 B;  2LY8 A;  5AVB A;  1HQ3 A;  4WU8 C;  4H9P A;  5B31 G;  3AZN B;  3LEL D;  5B33 C;  3TU4 A;  5AVC D;  3C1B D;  3WA9 C;  4X23 A;  4G91 C;  3UT9 B;  2HUE B;  4YS3 D;  4J8W C;  1JFI A;  5F99 A;  2NQB D;  5CP6 A;  3MGR C;  4YM6 D;  4Z66 A;  3REK D;  3LZ1 C;  3C1B B;  3KUY C;  3B6F D;  1KU5 A;  4WU9 C;  5CPK D;  3MGP A;  5E5A A;  2IO5 B;  2NQB B;  3NQJ B;  4J8V A;  4YM6 B;  3REH A;  3REK B;  3AZJ B;  2F8N B;  3AZM B;  1TZY A;  5DNM C;  5AV9 A;  5CPK B;  1TAF B;  3KXB D;  3AV2 D;  1P3A A;  4KHA B;  3AYW B;  4QLC C;  3AZI D;  3VH5 A;  1P3M A;  5B2I A;  3REJ B;  5AV6 D;  5BO0 B;  5DNN C;  5CPI A;  3W99 C;  1ID3 A;  1KX5 D;  4KUD C;  1P3O D;  3AZI B;  1ZLA A;  3AZL D;  3C1C D;  5B2J D;  5AV6 B;  5AVB C;  5BNV B;  1HQ3 C;  1M1A D;  3X1S D;  4XUJ D;  5AVC A;  1KX5 B;  1AOI D;  2BYK B;  3TU4 C;  4LD9 A;  4ZBJ B;  3VH6 A;  4X23 C;  5B2J B;  4YS3 A;  1KX3 A;  4XUJ B;  1P3B A;  4H9Q B;  1F66 D;  5CP6 C;  3X1U D;  3B6F A;  4WNN A;  5KDM A;  4J8X A;  3V9R A;  4Z66 C;  5GXQ A;  2L5A A;  2CV5 B;  3MGP C;  5E5A C;  5AY8 A;  1F66 B;  4Z5T D;  4J8V C;  3WAA D;  4E44 A;  3REH C;  1BH9 A;  1P3F B;  5B24 D;  5AV5 B;  4J8U A;  3AV2 A;  5B40 A;  4H9S A;  1TZY C;  5B1L A;  3UTA B;  5AV9 C;  1P3A C;  4R8P B;  5B0Y D;  4DRA A;  5BNX A;  4HGA C;  4Z5T B;  3WAA B;  3MNN D;  5B31 A;  1P3M C;  2NZD A;  1P3O A;  5B0Z D;  3MVD C;  3X1V D;  4WU8 B;  3KWQ A;  3AZH C;  1ZLA C;  3MGQ A;  1P34 A;  3AFA D;  1M1A A;  4CSR A;  5B0Z B;  4G91 B;  5AV8 D;  2FJ7 D;  4LD9 C;  3A6N D;  1KX3 C;  3MGR B;  3W96 A;  3VH5 W;  1KX4 A;  3KUY B;  1P3B C;  2F8N K;  4WU9 B;  5AV8 B;  2FJ7 B;  4J8X C;  5GT3 A;  5GXQ C;  5GSU D;  3A6N B;  3B6G A;  4WV4 B;  4H9O B;  1P3I C;  4H9R B;  2HIO D;  5AY8 C;  3LZ0 A;  1P3K D;  1EQZ D;  4ZUX A;  5C3I C;  5GSU B;  1M18 D;  4QLC B;  5B40 C;  2RVQ D;  5B1L C;  3VH6 W;  1M19 A;  3AN2 D;  4XZQ C;  5DNN B;  1P3K B;  3W99 B;  4Z2M H;  1EQZ B;  2NZD C;  5B31 C;  1U35 A;  1M18 B;  3AZF C;  3AN2 B;  3KWQ C;  4CAY A;  1ULY A;  3MGQ C;  1P34 C;  3AZG A;  5GT0 A;  3W98 D;  5B1M A;  1P3L A;  3AZE A;  3UT9 D;  1JFI B;  3WKJ A;  5CP6 B;  2ARO A;  3W96 C;  3O62 D;  1P3G C;  1P3P D;  1KX4 C;  3W97 A;  3W98 B;  4KGC A;  5BT1 C;  3UTB A;  5E5A B;  5GT3 C;  3KSY A;  1S32 C;  2HIO A;  3O62 B;  3REH B;  1P3P B;  3AZJ D;  2F8N D;  3MGS C;  3X1T A;  2JSS A;  3AZM D;  5FUG B;  3LZ0 C;  4Z2M G;  4ZUX C;  1P3A B;  2PYO C;  1F1E A;  3AYW D;  4HGA B;  4AWL C;  1P3M B;  5B32 D;  3REJ D;  1M19 C;  1N1J A;  4NE6 A;  1WWI A;  3MVD B;  3REL A;  5CPJ A;  1U35 C;  5JRG D;  3AZH B;  5B32 B;  3AZN A;  3R45 B;  3AV1 D;  3NQU B;  1H3O A;  4JJN A;  5JRG B;  3AZG C;  4LD9 B;  3UT9 A;  5BS7 A;  5B1M C;  1P3L C;  1P3I D;  3AZE C;  4NE3 A;  3AV1 B;  3LEL A;  3WKJ C;  3C1B A;  4WNN B;  4J8X B;  3AZK D;  3V9R B;  5GXQ B;  4NFT A;  2CV5 D;  3W97 C;  4KGC C;  3REI D;  1P3I B;  3UTB C;  2NQB A;  3LJA D;  4YM6 A;  5AY8 B;  3REK A;  5F99 C;  3AZK B;  3B0D C;  5C3I B;  3WTP E;  1P3F D;  3REI B;  5AV5 D;  3X1T C;  1TAF A;  5B40 B;  5CPK A;  3AZF D;  4KHA A;  3UTA D;  3WTP D;  4R8P D;  3LJA B;  4XZQ B;  5JA4 A;  2NZD B;  5B31 B;  5BO0 A;  3KXB A;  3AZF B;  3WTP B;  3AZI A;  3REL C;  5CPJ C;  4WU8 D;  3B0C W;  5AV6 A;  3MGQ B;  1P34 B;  5B2I C;  2YFV A;  4CSR B;  5B33 D;  2YFW B;  3AZN C;  1KX5 A;  3WA9 D;  5CPI C;  1ID3 C;  3AZL A;  4JJN C;  3C1C A;  2F8N H;  5B2J A;  4J8W D;  5BS7 C;  2HUE C;  3X1S A;  4XUJ A;  5B33 B;  3W96 B;  3MGR D;  1P3G B;  1AOI A;  3LZ1 D;  3WA9 B;  3LEL C;  3MGS D;  3KUY D;  4H9N B;  5AVC C;  4WU9 D;  3C1B C;  2BYM B;  4UUZ A;  4J8W B;  1S32 B;  4YS3 C;  3LZ1 B;  1F66 A;  2NQB C;  3X1U A;  3MGS B;  4YM6 C;  1P3F A;  5DNM D;  2PYO B;  3B6F C;  5CPK C;  5G49 A;  4QLC D;  4R8P A;  4Z5T A;  3WAA A;  5B24 A;  5DNM B;  5DNN D;  3W99 D;  1U35 B;  1Q9C A;  4KUD D;  4J8U C;  3AV2 C;  3KXB C;  4H9S C;  5B0Y A;  4WU8 A;  5CHL B;  3AZI C;  5AVB D;  3MNN A;  1HQ3 D;  2F8N G;  4CAY B;  5AV6 C;  4KUD B;  5B0Z A;  3TU4 D;  3X1V A;  4X23 D;  1P3O C;  5B1M B;  5AVB B;  3AZL C;  1HQ3 B;  4ZBJ C;  4H9P B;  3AFA A;  5B2J C;  3C1C C;  3AZE B;  3MGR A;  3WKJ B;  1M1A C;  5F99 D;  3KUY A;  3X1S C;  5CP6 D;  3B0B A;  3TU4 B;  4WZS B;  4Z66 D;  5AV8 A;  1AOI C;  2FJ7 A;  3W97 B;  1R4V A;  4X23 B;  3A6N A;  3MGP D;  5E5A D;  4H9O A;  5F99 B;  4H9R A;  4J8V D;  3B0D B;  3REH D;  4Z66 B;  1F66 C;  3X1U C;  1TZY D;  5GSU A;  5AV9 D;  4QLC A;  3MGP B;  1P3A D;  3B6G C;  4J8V B;  1P3M D;  1P3K A;  4Z5T C;  3WAA C;  1EQZ A;  5B24 C;  1TZY B;  1M18 A;  5AV9 B;  5CPJ B;  3MVD D;  3AZH D;  5B0Y C;  3AN2 A;  1ZLA D;  5B2I B;  1B6W A;  3MNN C;  5CPI B;  1ID3 B;  1BH8 A;  1H3O B;  4JJN B;  4DRB A;  5B0Z C;  4LD9 D;  3X1V C;  4EO5 C;  1ZLA B;  1KX3 D;  3AFA C;  3LEL B;  1P3B D;  5AVC B;  3W98 A;  3VH5 T;  4J8X D;  5GXQ D;  5AV8 C;  2FJ7 C;  5GT0 C;  4YS3 B;  1KX3 B;  3A6N C;  3O62 A;  1P3P A;  1P3B B;  5AY8 D;  3B6F B;  5KDM B;  2ARO C;  5FUG A;  4J8U D;  5B40 D;  5B1L D;  5GSU C;  3NQJ A;  5JA4 B; 
#chains in the Genus database with same CATH topology
 4XZQ D;  3AZJ A;  2F8N A;  2HIO C;  2NZD D;  5B31 D;  3VH6 T;  3AZM A;  1BH9 B;  1P3K C;  1EQZ C;  4J8U B;  3AV2 B;  3KXB B;  3MVD A;  5B1L B;  1M18 C;  3AYW A;  2DF4 C;  2RVQ C;  3AZH A;  5B32 A;  3KWQ D;  3REJ A;  5BNX B;  3AN2 C;  3MGQ D;  2Y2J A;  1P34 D;  3R45 A;  2YFV B;  3NQU A;  5JRG A;  1P3O B;  3AZL B;  3C1C B;  4G92 C;  3KWQ B;  5BNV A;  1M1A B;  3AV1 A;  3X1S B;  3W96 D;  1AOI B;  1P3G D;  1KX4 D;  2BYK A;  5BT1 D;  3W98 C;  4UUZ B;  5GT3 D;  1P3I A;  3UT9 C;  1S32 D;  3B6G D;  3H0R C;  3EPJ A;  4H9Q A;  1KX4 B;  3X1U B;  1BFM A;  3O62 C;  3AZK A;  1P3P C;  1A7W A;  3LZ0 D;  2CV5 A;  3REI A;  4ZUX D;  2PYO D;  5GT3 B;  2DQN C;  3B6G B;  5G49 B;  3LJA A;  4XZQ A;  2IO5 C;  1M19 D;  5B24 B;  1B67 A;  2BG1 A;  3LZ0 B;  3REK C;  3AZJ C;  5AV5 A;  4ZUX B;  3AZM C;  4M6B A;  3AZF A;  1U35 D;  3UTA A;  3WTP A;  4AWL B;  5B0Y B;  3AYW C;  2Y2L A;  2ZY3 A;  1M19 B;  3MNN B;  5B32 C;  3REJ C;  2YFW A;  4E45 A;  3AZG D;  3X1V B;  2Y2G A;  4EO5 B;  1T3U A;  5JRG C;  5GT0 D;  5B1M D;  1P3L D;  3AFA B;  3AZE D;  5B33 A;  1P3G A;  3WKJ D;  3WA9 A;  3AV1 C;  3AZG B;  2ARO D;  4H9N A;  1KX5 C;  2BYM A;  5GT0 B;  3W97 D;  4KGC D;  1P3L B;  4J8W A;  5B32 G;  1S32 A;  3UTB D;  3LZ1 A;  3MGS A;  4XUJ C;  2ARO B;  4WU9 A;  4KGC B;  3X1T D;  3AZK C;  2PYO A;  2CV5 C;  3REI C;  2CWE A;  3UTB B;  2ZM5 A;  2HIO B;  3LJA C;  4NE5 A;  5DNM A;  2G5H C;  3X1T B;  1P3F C;  3H0L C;  1HTA A;  5AV5 C;  3REL D;  5CPJ D;  3UTA C;  1WWS A;  3WTP C;  4R8P C;  5B2I D;  5DNN A;  3W99 A;  2Y2H A;  1N1J B;  3B0C T;  3AZN D;  5CPI D;  4KUD A;  1ID3 D;  1BH8 B;  3REL B;  4JJN D;  4G92 B;  2LY8 A;  5AVB A;  1HQ3 A;  4WU8 C;  4H9P A;  5B31 G;  3AZN B;  3LEL D;  5B33 C;  3TU4 A;  5AVC D;  3C1B D;  3WA9 C;  2XD1 A;  3A1I A;  4X23 A;  4G91 C;  3UT9 B;  3H0M C;  2HUE B;  4YS3 D;  4J8W C;  1JFI A;  5F99 A;  2W8S A;  5CP6 A;  2NQB D;  1Z2C B;  2ZY5 A;  4YM6 D;  4Z66 A;  3MGR C;  3LZ1 C;  3C1B B;  3REK D;  3KUY C;  3B6F D;  1KU5 A;  4WU9 C;  5CPK D;  3MGP A;  5E5A A;  2IO5 B;  2NQB B;  3NQJ B;  4J8V A;  4YM6 B;  3REH A;  3REK B;  3AZJ B;  2F8N B;  3AZM B;  1TZY A;  5DNM C;  5AV9 A;  5CPK B;  1TAF B;  3KXB D;  3AV2 D;  1P3A A;  4KHA B;  3AYW B;  4QLC C;  3AZI D;  3VH5 A;  1P3M A;  5B2I A;  3REJ B;  5AV6 D;  1PZR A;  5BO0 B;  5DNN C;  5CPI A;  3W99 C;  1ID3 A;  1KX5 D;  4KUD C;  1P3O D;  3AZI B;  1ZLA A;  3AZL D;  3C1C D;  5B2J D;  5AV6 B;  5AVB C;  5BNV B;  1HQ3 C;  1M1A D;  3X1S D;  4XUJ D;  5AVC A;  1KX5 B;  1AOI D;  2BYK B;  2JE5 A;  3TU4 C;  4LD9 A;  4ZBJ B;  3VH6 A;  4X23 C;  5B2J B;  4YS3 A;  1KX3 A;  4XUJ B;  1P3B A;  4H9Q B;  1F66 D;  5CP6 C;  3X1U D;  3B6F A;  4WNN A;  5KDM A;  4J8X A;  3V9R A;  4Z66 C;  5GXQ A;  2L5A A;  2CV5 B;  3MGP C;  5E5A C;  2FFF B;  5AY8 A;  1F66 B;  4Z5T D;  3EPL A;  4J8V C;  3WAA D;  4E44 A;  3REH C;  1BH9 A;  1P3F B;  5B24 D;  5AV5 B;  4J8U A;  3AV2 A;  5B40 A;  4H9S A;  1TZY C;  5B1L A;  3UTA B;  5AV9 C;  1P3A C;  4R8P B;  5B0Y D;  4DRA A;  5BNX A;  4HGA C;  4Z5T B;  3WAA B;  3MNN D;  5B31 A;  1P3M C;  2NZD A;  2Y2K A;  2JCH A;  1P3O A;  5B0Z D;  3MVD C;  3X1V D;  4WU8 B;  3KWQ A;  3AZH C;  1ZLA C;  3MGQ A;  1P34 A;  3AFA D;  1M1A A;  4CSR A;  2Y2Q A;  5B0Z B;  4G91 B;  5AV8 D;  2FJ7 D;  4LD9 C;  3F6T A;  3FDD A;  3A6N D;  1KX3 C;  3MGR B;  3W96 A;  3VH5 W;  1KX4 A;  3KUY B;  1P3B C;  2F8N K;  1W2E A;  4WU9 B;  5AV8 B;  2FJ7 B;  4J8X C;  5GT3 A;  5GXQ C;  5GSU D;  3A6N B;  3B6G A;  4WV4 B;  3IP4 C;  4H9O B;  1P3I C;  3AL0 C;  4H9R B;  2HIO D;  5AY8 C;  3LZ0 A;  1P3K D;  1EQZ D;  4ZUX A;  2RIQ A;  5C3I C;  5GSU B;  1M18 D;  4QLC B;  5B40 C;  2RVQ D;  5B1L C;  3VH6 W;  1M19 A;  3AN2 D;  4XZQ C;  5DNN B;  1P3K B;  3W99 B;  4Z2M H;  1EQZ B;  2NZD C;  5B31 C;  1U35 A;  1M18 B;  3AZF C;  3AN2 B;  3KWQ C;  4CAY A;  1ULY A;  2ZY4 A;  3MGQ C;  1P34 C;  3AZG A;  5GT0 A;  3W98 D;  5B1M A;  1P3L A;  3AZE A;  3UT9 D;  1JFI B;  3WKJ A;  5CP6 B;  2VQR A;  4UPK A;  2ARO A;  3W96 C;  3O62 D;  1P3G C;  1P3P D;  1KX4 C;  3W97 A;  3W98 B;  4KGC A;  5BT1 C;  3UTB A;  5E5A B;  5GT3 C;  3KSY A;  1S32 C;  2HIO A;  3O62 B;  3REH B;  1P3P B;  3AZJ D;  2F8N D;  3MGS C;  3X1T A;  2JSS A;  3AZM D;  5FUG B;  3LZ0 C;  4Z2M G;  4ZUX C;  1P3A B;  2PYO C;  1F1E A;  3AYW D;  4HGA B;  4AWL C;  1P3M B;  5B32 D;  3REJ D;  1M19 C;  1N1J A;  4NE6 A;  1WWI A;  3MVD B;  3REL A;  5CPJ A;  1U35 C;  5JRG D;  3AZH B;  5B32 B;  3EG5 B;  3AZN A;  3R45 B;  3AV1 D;  3NQU B;  1H3O A;  4JJN A;  5JRG B;  3AZG C;  4LD9 B;  2J8P A;  3UT9 A;  5BS7 A;  5B1M C;  1P3L C;  1P3I D;  3AZE C;  4NE3 A;  3AV1 B;  3LEL A;  4DQY B;  3WKJ C;  3C1B A;  4WNN B;  4J8X B;  3AZK D;  3V9R B;  5GXQ B;  4NFT A;  2CV5 D;  3W97 C;  4KGC C;  3REI D;  1P3I B;  3UTB C;  2NQB A;  3LJA D;  4YM6 A;  5AY8 B;  3REK A;  5F99 C;  3AZK B;  3B0D C;  5C3I B;  3WTP E;  1P3F D;  3REI B;  5AV5 D;  3X1T C;  1TAF A;  5B40 B;  5CPK A;  3AZF D;  4KHA A;  3UTA D;  3WTP D;  4R8P D;  3LJA B;  4XZQ B;  5JA4 A;  2NZD B;  5B31 B;  5BO0 A;  3KXB A;  3AZF B;  3WTP B;  3AZI A;  3REL C;  5CPJ C;  4WU8 D;  3B0C W;  5AV6 A;  3MGQ B;  1P34 B;  5B2I C;  2YFV A;  4CSR B;  5B33 D;  2YFW B;  3AZN C;  1KX5 A;  3WA9 D;  5CPI C;  2G5I C;  1ID3 C;  3AZL A;  4JJN C;  2F2A C;  3C1C A;  2F8N H;  5B2J A;  4J8W D;  5BS7 C;  2HUE C;  3X1S A;  4XUJ A;  5B33 B;  3W96 B;  3MGR D;  1P3G B;  1AOI A;  3LZ1 D;  3WA9 B;  3LEL C;  3MGS D;  3KUY D;  4H9N B;  5AVC C;  4WU9 D;  3C1B C;  2BYM B;  4UUZ A;  4J8W B;  1S32 B;  4YS3 C;  3LZ1 B;  1F66 A;  2NQB C;  3X1U A;  3MGS B;  4WJ3 C;  4YM6 C;  1P3F A;  5DNM D;  2PYO B;  3B6F C;  5CPK C;  5G49 A;  4QLC D;  4R8P A;  4Z5T A;  3WAA A;  2XD5 A;  5B24 A;  5DNM B;  5DNN D;  3W99 D;  1U35 B;  1Q9C A;  4KUD D;  4J8U C;  3AV2 C;  3KXB C;  4H9S C;  5B0Y A;  4WU8 A;  5CHL B;  3AZI C;  5AVB D;  3MNN A;  1HQ3 D;  2F8N G;  4CAY B;  5AV6 C;  2Y2M A;  4KUD B;  2ZY2 A;  5B0Z A;  3TU4 D;  3X1V A;  4X23 D;  1P3O C;  5B1M B;  5AVB B;  3AZL C;  1HQ3 B;  4ZBJ C;  4H9P B;  3AFA A;  5B2J C;  3C1C C;  3AZE B;  3EPH A;  3MGR A;  3WKJ B;  1M1A C;  5F99 D;  3KUY A;  3X1S C;  5CP6 D;  3B0B A;  3TU4 B;  4WZS B;  4Z66 D;  5AV8 A;  1AOI C;  2FJ7 A;  3W97 B;  1R4V A;  4X23 B;  3A6N A;  3MGP D;  5E5A D;  4H9O A;  5F99 B;  4H9R A;  4J8V D;  3B0D B;  3REH D;  4Z66 B;  1F66 C;  3X1U C;  1TZY D;  5GSU A;  5AV9 D;  2Y2I A;  4QLC A;  3MGP B;  1P3A D;  3B6G C;  4J8V B;  1P3M D;  1P3K A;  4Z5T C;  3WAA C;  1EQZ A;  5B24 C;  1TZY B;  1M18 A;  5AV9 B;  3A1K A;  2Y2P A;  2Y2N A;  5CPJ B;  3MVD D;  3AZH D;  5B0Y C;  3AN2 A;  1ZLA D;  5B2I B;  1B6W A;  3MNN C;  5CPI B;  2UWX A;  1ID3 B;  3KFU G;  1BH8 A;  1H3O B;  4JJN B;  4DRB A;  5B0Z C;  4LD9 D;  3X1V C;  4EO5 C;  1ZLA B;  3EPK A;  1KX3 D;  3AFA C;  3LEL B;  1P3B D;  5AVC B;  2Y2O A;  3W98 A;  3VH5 T;  4J8X D;  5GXQ D;  5AV8 C;  2FJ7 C;  5GT0 C;  3P5J B;  4YS3 B;  1KX3 B;  3A6N C;  3O62 A;  1P3P A;  1P3B B;  5AY8 D;  3B6F B;  5KDM B;  2ARO C;  5FUG A;  4J8U D;  5B40 D;  5B1L D;  5GSU C;  3NQJ A;  5JA4 B; 
#chains in the Genus database with same CATH homology
 4XZQ D;  3AZJ A;  2F8N A;  2HIO C;  2NZD D;  5B31 D;  3VH6 T;  3AZM A;  1BH9 B;  1P3K C;  1EQZ C;  4J8U B;  3AV2 B;  3KXB B;  3MVD A;  5B1L B;  1M18 C;  3AYW A;  2DF4 C;  2RVQ C;  3AZH A;  5B32 A;  3KWQ D;  3REJ A;  5BNX B;  3AN2 C;  3MGQ D;  2Y2J A;  1P34 D;  3R45 A;  2YFV B;  3NQU A;  5JRG A;  1P3O B;  3AZL B;  3C1C B;  4G92 C;  3KWQ B;  5BNV A;  1M1A B;  3AV1 A;  3X1S B;  3W96 D;  1AOI B;  1P3G D;  1KX4 D;  2BYK A;  5BT1 D;  3W98 C;  4UUZ B;  5GT3 D;  1P3I A;  3UT9 C;  1S32 D;  3B6G D;  3H0R C;  3EPJ A;  4H9Q A;  1KX4 B;  3X1U B;  1BFM A;  3O62 C;  3AZK A;  1P3P C;  1A7W A;  3LZ0 D;  2CV5 A;  3REI A;  4ZUX D;  2PYO D;  5GT3 B;  2DQN C;  3B6G B;  5G49 B;  3LJA A;  4XZQ A;  2IO5 C;  1M19 D;  5B24 B;  1B67 A;  2BG1 A;  3LZ0 B;  3REK C;  3AZJ C;  5AV5 A;  4ZUX B;  3AZM C;  4M6B A;  3AZF A;  1U35 D;  3UTA A;  3WTP A;  4AWL B;  5B0Y B;  3AYW C;  2Y2L A;  2ZY3 A;  1M19 B;  3MNN B;  5B32 C;  3REJ C;  2YFW A;  4E45 A;  3AZG D;  3X1V B;  2Y2G A;  4EO5 B;  1T3U A;  5JRG C;  5GT0 D;  5B1M D;  1P3L D;  3AFA B;  3AZE D;  5B33 A;  1P3G A;  3WKJ D;  3WA9 A;  3AV1 C;  3AZG B;  2ARO D;  4H9N A;  1KX5 C;  2BYM A;  5GT0 B;  3W97 D;  4KGC D;  1P3L B;  4J8W A;  5B32 G;  1S32 A;  3UTB D;  3LZ1 A;  3MGS A;  4XUJ C;  2ARO B;  4WU9 A;  4KGC B;  3X1T D;  3AZK C;  2PYO A;  2CV5 C;  3REI C;  2CWE A;  3UTB B;  2ZM5 A;  2HIO B;  3LJA C;  4NE5 A;  5DNM A;  2G5H C;  3X1T B;  1P3F C;  3H0L C;  1HTA A;  5AV5 C;  3REL D;  5CPJ D;  3UTA C;  1WWS A;  3WTP C;  4R8P C;  5B2I D;  5DNN A;  3W99 A;  2Y2H A;  1N1J B;  3B0C T;  3AZN D;  5CPI D;  4KUD A;  1ID3 D;  1BH8 B;  3REL B;  4JJN D;  4G92 B;  2LY8 A;  5AVB A;  1HQ3 A;  4WU8 C;  4H9P A;  5B31 G;  3AZN B;  3LEL D;  5B33 C;  3TU4 A;  5AVC D;  3C1B D;  3WA9 C;  2XD1 A;  3A1I A;  4X23 A;  4G91 C;  3UT9 B;  3H0M C;  2HUE B;  4YS3 D;  4J8W C;  1JFI A;  5F99 A;  2W8S A;  5CP6 A;  2NQB D;  1Z2C B;  2ZY5 A;  4YM6 D;  4Z66 A;  3MGR C;  3LZ1 C;  3C1B B;  3REK D;  3KUY C;  3B6F D;  1KU5 A;  4WU9 C;  5CPK D;  3MGP A;  5E5A A;  2IO5 B;  2NQB B;  3NQJ B;  4J8V A;  4YM6 B;  3REH A;  3REK B;  3AZJ B;  2F8N B;  3AZM B;  1TZY A;  5DNM C;  5AV9 A;  5CPK B;  1TAF B;  3KXB D;  3AV2 D;  1P3A A;  4KHA B;  3AYW B;  4QLC C;  3AZI D;  3VH5 A;  1P3M A;  5B2I A;  3REJ B;  5AV6 D;  1PZR A;  5BO0 B;  5DNN C;  5CPI A;  3W99 C;  1ID3 A;  1KX5 D;  4KUD C;  1P3O D;  3AZI B;  1ZLA A;  3AZL D;  3C1C D;  5B2J D;  5AV6 B;  5AVB C;  5BNV B;  1HQ3 C;  1M1A D;  3X1S D;  4XUJ D;  5AVC A;  1KX5 B;  1AOI D;  2BYK B;  2JE5 A;  3TU4 C;  4LD9 A;  4ZBJ B;  3VH6 A;  4X23 C;  5B2J B;  4YS3 A;  1KX3 A;  4XUJ B;  1P3B A;  4H9Q B;  1F66 D;  5CP6 C;  3X1U D;  3B6F A;  4WNN A;  5KDM A;  4J8X A;  3V9R A;  4Z66 C;  5GXQ A;  2L5A A;  2CV5 B;  3MGP C;  5E5A C;  2FFF B;  5AY8 A;  1F66 B;  4Z5T D;  3EPL A;  4J8V C;  3WAA D;  4E44 A;  3REH C;  1BH9 A;  1P3F B;  5B24 D;  5AV5 B;  4J8U A;  3AV2 A;  5B40 A;  4H9S A;  1TZY C;  5B1L A;  3UTA B;  5AV9 C;  1P3A C;  4R8P B;  5B0Y D;  4DRA A;  5BNX A;  4HGA C;  4Z5T B;  3WAA B;  3MNN D;  5B31 A;  1P3M C;  2NZD A;  2Y2K A;  2JCH A;  1P3O A;  5B0Z D;  3MVD C;  3X1V D;  4WU8 B;  3KWQ A;  3AZH C;  1ZLA C;  3MGQ A;  1P34 A;  3AFA D;  1M1A A;  4CSR A;  2Y2Q A;  5B0Z B;  4G91 B;  5AV8 D;  2FJ7 D;  4LD9 C;  3F6T A;  3FDD A;  3A6N D;  1KX3 C;  3MGR B;  3W96 A;  3VH5 W;  1KX4 A;  3KUY B;  1P3B C;  2F8N K;  1W2E A;  4WU9 B;  5AV8 B;  2FJ7 B;  4J8X C;  5GT3 A;  5GXQ C;  5GSU D;  3A6N B;  3B6G A;  4WV4 B;  3IP4 C;  4H9O B;  1P3I C;  3AL0 C;  4H9R B;  2HIO D;  5AY8 C;  3LZ0 A;  1P3K D;  1EQZ D;  4ZUX A;  2RIQ A;  5C3I C;  5GSU B;  1M18 D;  4QLC B;  5B40 C;  2RVQ D;  5B1L C;  3VH6 W;  1M19 A;  3AN2 D;  4XZQ C;  5DNN B;  1P3K B;  3W99 B;  4Z2M H;  1EQZ B;  2NZD C;  5B31 C;  1U35 A;  1M18 B;  3AZF C;  3AN2 B;  3KWQ C;  4CAY A;  1ULY A;  2ZY4 A;  3MGQ C;  1P34 C;  3AZG A;  5GT0 A;  3W98 D;  5B1M A;  1P3L A;  3AZE A;  3UT9 D;  1JFI B;  3WKJ A;  5CP6 B;  2VQR A;  4UPK A;  2ARO A;  3W96 C;  3O62 D;  1P3G C;  1P3P D;  1KX4 C;  3W97 A;  3W98 B;  4KGC A;  5BT1 C;  3UTB A;  5E5A B;  5GT3 C;  3KSY A;  1S32 C;  2HIO A;  3O62 B;  3REH B;  1P3P B;  3AZJ D;  2F8N D;  3MGS C;  3X1T A;  2JSS A;  3AZM D;  5FUG B;  3LZ0 C;  4Z2M G;  4ZUX C;  1P3A B;  2PYO C;  1F1E A;  3AYW D;  4HGA B;  4AWL C;  1P3M B;  5B32 D;  3REJ D;  1M19 C;  1N1J A;  4NE6 A;  1WWI A;  3MVD B;  3REL A;  5CPJ A;  1U35 C;  5JRG D;  3AZH B;  5B32 B;  3EG5 B;  3AZN A;  3R45 B;  3AV1 D;  3NQU B;  1H3O A;  4JJN A;  5JRG B;  3AZG C;  4LD9 B;  2J8P A;  3UT9 A;  5BS7 A;  5B1M C;  1P3L C;  1P3I D;  3AZE C;  4NE3 A;  3AV1 B;  3LEL A;  4DQY B;  3WKJ C;  3C1B A;  4WNN B;  4J8X B;  3AZK D;  3V9R B;  5GXQ B;  4NFT A;  2CV5 D;  3W97 C;  4KGC C;  3REI D;  1P3I B;  3UTB C;  2NQB A;  3LJA D;  4YM6 A;  5AY8 B;  3REK A;  5F99 C;  3AZK B;  3B0D C;  5C3I B;  3WTP E;  1P3F D;  3REI B;  5AV5 D;  3X1T C;  1TAF A;  5B40 B;  5CPK A;  3AZF D;  4KHA A;  3UTA D;  3WTP D;  4R8P D;  3LJA B;  4XZQ B;  5JA4 A;  2NZD B;  5B31 B;  5BO0 A;  3KXB A;  3AZF B;  3WTP B;  3AZI A;  3REL C;  5CPJ C;  4WU8 D;  3B0C W;  5AV6 A;  3MGQ B;  1P34 B;  5B2I C;  2YFV A;  4CSR B;  5B33 D;  2YFW B;  3AZN C;  1KX5 A;  3WA9 D;  5CPI C;  2G5I C;  1ID3 C;  3AZL A;  4JJN C;  2F2A C;  3C1C A;  2F8N H;  5B2J A;  4J8W D;  5BS7 C;  2HUE C;  3X1S A;  4XUJ A;  5B33 B;  3W96 B;  3MGR D;  1P3G B;  1AOI A;  3LZ1 D;  3WA9 B;  3LEL C;  3MGS D;  3KUY D;  4H9N B;  5AVC C;  4WU9 D;  3C1B C;  2BYM B;  4UUZ A;  4J8W B;  1S32 B;  4YS3 C;  3LZ1 B;  1F66 A;  2NQB C;  3X1U A;  3MGS B;  4WJ3 C;  4YM6 C;  1P3F A;  5DNM D;  2PYO B;  3B6F C;  5CPK C;  5G49 A;  4QLC D;  4R8P A;  4Z5T A;  3WAA A;  2XD5 A;  5B24 A;  5DNM B;  5DNN D;  3W99 D;  1U35 B;  1Q9C A;  4KUD D;  4J8U C;  3AV2 C;  3KXB C;  4H9S C;  5B0Y A;  4WU8 A;  5CHL B;  3AZI C;  5AVB D;  3MNN A;  1HQ3 D;  2F8N G;  4CAY B;  5AV6 C;  2Y2M A;  4KUD B;  2ZY2 A;  5B0Z A;  3TU4 D;  3X1V A;  4X23 D;  1P3O C;  5B1M B;  5AVB B;  3AZL C;  1HQ3 B;  4ZBJ C;  4H9P B;  3AFA A;  5B2J C;  3C1C C;  3AZE B;  3EPH A;  3MGR A;  3WKJ B;  1M1A C;  5F99 D;  3KUY A;  3X1S C;  5CP6 D;  3B0B A;  3TU4 B;  4WZS B;  4Z66 D;  5AV8 A;  1AOI C;  2FJ7 A;  3W97 B;  1R4V A;  4X23 B;  3A6N A;  3MGP D;  5E5A D;  4H9O A;  5F99 B;  4H9R A;  4J8V D;  3B0D B;  3REH D;  4Z66 B;  1F66 C;  3X1U C;  1TZY D;  5GSU A;  5AV9 D;  2Y2I A;  4QLC A;  3MGP B;  1P3A D;  3B6G C;  4J8V B;  1P3M D;  1P3K A;  4Z5T C;  3WAA C;  1EQZ A;  5B24 C;  1TZY B;  1M18 A;  5AV9 B;  3A1K A;  2Y2P A;  2Y2N A;  5CPJ B;  3MVD D;  3AZH D;  5B0Y C;  3AN2 A;  1ZLA D;  5B2I B;  1B6W A;  3MNN C;  5CPI B;  2UWX A;  1ID3 B;  3KFU G;  1BH8 A;  1H3O B;  4JJN B;  4DRB A;  5B0Z C;  4LD9 D;  3X1V C;  4EO5 C;  1ZLA B;  3EPK A;  1KX3 D;  3AFA C;  3LEL B;  1P3B D;  5AVC B;  2Y2O A;  3W98 A;  3VH5 T;  4J8X D;  5GXQ D;  5AV8 C;  2FJ7 C;  5GT0 C;  3P5J B;  4YS3 B;  1KX3 B;  3A6N C;  3O62 A;  1P3P A;  1P3B B;  5AY8 D;  3B6F B;  5KDM B;  2ARO C;  5FUG A;  4J8U D;  5B40 D;  5B1L D;  5GSU C;  3NQJ A;  5JA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...