2YFWA

Heterotetramer structure of kluyveromyces lactis cse4,h4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
78
Chain Sequence
DLLISRMPFARLVKEVTDQFTTEEPLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIRGQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
total genus 26
structure length 78
sequence length 79
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfwA00
5GXQA 2NQBB 2F8NA 5JRGC 5CP6B 3R45B 4ZUXD 5KDMA 4H9QA 5AV9C 1F1EA 4NE6A 4EO5C 5B0YA 1N1JB 3X1VB 4LD9C 1P3PD 5B24D 4XUJC 3LELD 3UTBD 2IO5B 4ZUXC 1P3GD 2NZDC 1WWIA 1U35A 5B1LC 3VH5A 1P3PC 3C1BA 1M18B 1BH9B 1KX3A 3LELC 1JFIB 2BYKA 3UTBC 1BH8A 1P3MD 1P3ID 4H9NA 1P3OB 3KSYA 3WA9B 5GT0B 3B6FA 3W96B 3X1UD 5B24A 3A6NB 1P3IC 4CAYB 1P3GA 3AZFD 5AY8C 4WU9C 2YFVB 2LY8A 3AZIB 3O62B 4J8WB 3AZJB 3AZHC 5B32B 3AZEC 2F8NH 5AVBB 1M19B 3AZFC 1HQ3A 3NQUA 3LJAD 4KGCB 5DNMA 4J8VC 5JRGB 5AV6A 3WTPA 3MGRC 5AV9B 3AN2A 4EO5B 4WU8C 3LJAC 5B0ZA 4LD9B 3AZKD 3LZ0D 3X1TC 4XUJB 4WNNB 4ZUXB 2NZDB 1KX5D 5B1LB 5B33C 2F8NG 1P3PB 1P3FA 5B2IA 3AZMD 5AV5D 3REHA 3LZ0C 5B32G 4UUZB 3LELB 3UTBB 1M1AC 3W99A 2FJ7D 1KU5A 1KX5C 2HIOC 3AZLD 1ID3A 5C3IC 4DRBA 4XZQD 3LZ1D 4Z5TD 1P3MB 3KXBA 1P3IB 4NE3A 5CPID 1P3AD 5E5AA 4AWLC 3AZLC 3WKJD 5AY8B 3C1CD 4X23A 1S32C 5CPKD 3B6GB 5AV5A 4XZQC 3AZHB 4Z5TC 1P34A 3AZEB 1F66A 4JJND 3VH5T 4QLCA 3RELA 4R8PA 3AZFB 4J8VB 5CPKC 5GT3D 5BNXA 3AFAC 4ZBJC 3KWQA 3MGRB 5CPIA 5AV8D 1TAFA 4WU8B 3LJAB 3WTPE 4J8XC 4LD9D 4J8UD 5GT3C 3UTAD 1EQZC 5G49B 3X1TB 4WV4B 4KUDC 5JA4B 5B40D 3WAAA 3MGQA 2CV5D 3UT9A 1P3OC 3REKD 5B33B 4WZSB 1R4VA 4J8UC 3AZGA 3AZKB 3UTAC 1KX4C 3LZ0B 2PYOC 1M1AB 3B6GA 5BNVA 1H3OA 5B40C 1KX5B 2HIOB 5B0YD 3REKC 5GXQC 5CP6A 3W97C 3AV2D 3VH6W 5C3IB 1N1JA 4E44A 4NFTA 5B0YC 1U35D 4AWLB 3AZLB 1M19C 3C1BD 1S32B 5GSUD 5CHLB 1KX3D 4XZQB 3V9RB 4H9RA 4Z5TB 2BYMA 3MGPC 5B31A 5B1MC 3REJC 1TZYA 1P3LA 3W98A 1BH9A 3B6FD 5CPKB 3AYWA 5B2JD 1ZLAA 3AFAB 3AV2A 4ZBJB 3WA9A 5GT0A 1ULYA 4H9SC 4H9PA 3VH6A 4J8XB 5GT3B 1EQZB 4Z2MG 5B24C 5GSUA 4KUDB 3X1SA 1P3GC 4YM6A 1HQ3D 3NQJB 4J8UB 5DNMD 3UTAB 5AVCD 1KX4B 5AV6D 2PYOB 5B2JA 5AVBA 3AV1A 3WTPD 4M6BA 5B40B 1P3MC 3AN2D 3TU4A 3REKB 1HQ3C 5B0ZD 5GXQB 3W97B 5DNMC 2F8NB 5AV9A 5AV6C 2YFWB 3X1UC 3WTPC 5BO0B 5KDMB 5B0YB 1B6WA 1P3FD 5DNNA 5B2ID 2NZDA 3REHD 5AVCA 3AZNA 3W99D 3MGPB 5B1MB 3REJB 1ID3D 3B0CT 5B2IC 3REHC 1A7WA 3MNND 2BYKB 3W99C 2HUEC 1BH8B 3KXBD 5E5AD 1ID3C 5F99A 4X23D 3AZKC 5B24B 1P3KA 1P34D 5AY8A 4WU9A 1P3GB 1F66D 4QLCD 3RELD 4R8PD 4H9OA 4X23C 3AZHA 3AZMC 5AV5C 3AZEA 1P34C 3MNNA 3B0BA 3KWQD 2FJ7C 3KUYD 2AROA 1HQ3B 3NQUB 5DNMB 3MGRA 5AV6B 3X1UB 3LZ1C 1AOID 3WTPB 4YS3D 3WAAD 3MGQD 3UT9D 5CPJA 5CPIC 1P3AC 3X1TA 3VH6T 3WKJC 3C1CC 3REIA 3AZGD 4G91C 3MGSA 3B6GD 3WAAC 3MGQC 2JSSA 5FUGB 2NQBD 4JJNC 5BT1D 3KUYA 5CP6D 5B2IB 1M1AA 3REHB 4CSRB 2HIOA 1P3BA 3W99B 2HUEB 1AOIA 4YS3A 1ID3B 5AV8C 4Z66A 3MVDA 3W98D 5B31D 1P3LD 1TZYD 1M18D 2CV5C 2NQBA 4X23B 3AZMB 5AV5B 3AYWD 3R45A 1ZLAD 1P34B 3WA9D 3W98C 5GT0D 1P3LC 1TZYC 3X1VA 2FJ7B 3A6ND 3AYWC 1ZLAC 3AV2C 3LZ1B 3X1SD 4YM6D 4J8XA 3AZID 5CPIB 1U35C 1P3AB 1TAFB 1M18A 1JFIA 3C1BC 3WKJB 3C1CB 4KUDA 4G91B 5GSUC 1KX3C 5AVBD 1P3OA 3AV1D 3X1SC 3WAAB 3MGQB 4YM6C 3TU4D 4JJNB 3W96A 5JRGD 3B6FC 3A6NA 5AV9D 5B2JC 4CAYA 3AV1C 5BNVB 3W97A 2YFVA 3TU4C 4XUJD 3AZIA 3O62A 4J8WA 4G92C 3AZJA 2YFWA 4KHAB 5AV8B 5DNND 5B32A 5BO0A 2NZDD 3AZND 5BS7A 5B1LD 1M19A 4KGCA 2CV5B 5DNNC 2CWEA 5JRGA 3MGPA 5AVCC 5B1MA 3REJA 3AZNC 4H9RB 1WWSA 2BYMB 3W98B 5B31B 1P3LB 1TZYB 1Q9CA 4H9QB 3AN2C 4LD9A 5F99D 4XUJA 5B0ZC 4WNNA 3AYWB 1HTAA 4ZUXA 1ZLAB 3AV2B 1P3KD 4NE5A 5B1LA 5AY8D 4H9SA 4WU9D 1P3PA 5F99C 1U35B 3AZHD 4H9PB 2L5AA 4UUZA 3LELA 3C1BB 3UTBA 1P3FC 3AZED 1P3KC 5GSUB 1KX3B 3X1SB 4YM6B 4H9NB 4J8VD 2AROD 3B6FB 3MGRD 1P3MA 1P3IA 5B2JB 3MNNC 5B31G 3AV1B 4WU8D 3KXBC 5CPJD 3TU4B 2AROC 3X1TD 5E5AC 4G92B 3X1UA 3REID 5B33D 3MGSD 3AZFA 5CPJC 1F66C 4J8VA 4QLCC 3RELC 4R8PC 5DNNB 3REIC 1M1AD 5AVCB 3AZNB 5FUGA 2HIOD 1P3BD 3MGSC 4WU8A 3KWQC 3LJAA 3AN2B 3KUYC 4HGAC 4CSRA 5G49A 5B0ZB 2F8NK 4Z66D 3MVDD 5JA4A 1P3BC 1AOIC 5B33A 3B0DC 4YS3C 1S32D 3UT9C 3AZKA 5F99B 3LZ0A 2RVQD 1P3FB 3AZGC 4Z66C 3MVDC 1P3KB 1KX5A 3B6GC 4WU9B 3X1VD 3B0CW 3AZMA 2NQBC 4H9OB 5BT1C 3AFAD 2RVQC 5CP6C 4DRAA 2FJ7A 3MNNB 3AZLA 3X1VC 3KXBB 4J8XD 1EQZD 2AROB 1S32A 5E5AB 4XZQA 3V9RA 3LZ1A 2IO5C 4KUDD 4Z5TA 1P3OD 1P3AA 5B31C 3C1CA 5CPJB 1KX4D 1F66B 3WKJA 1M18C 5CPKA 4QLCB 3RELB 4R8PB 2PYOD 3REIB 3W96D 3AFAA 1BFMA 5BNXB 3MGSB 4JJNA 1B67A 3WA9C 5GXQD 3W97D 5GT0C 3KWQB 2F8ND 4E45A 3KUYB 4HGAB 3W96C 5GT3A 3O62D 4J8WD 3AZJD 1EQZA 5B32D 3A6NC 1P3BB 1M19D 1AOIB 4KHAA 3B0DB 5AV8A 4YS3B 4KGCD 3NQJA 3VH5W 3AZIC 4J8UA 3O62C 4J8WC 3UT9B 3UTAA 3AZJC 1KX4A 5B32C 2PYOA 3AZGB 3MGPD 4Z66B 5B1MD 5BS7C 3MVDB 5B40A 3REJD 2CV5A 5AVBC 3REKA 4Z2MH 1H3OB 4KGCC
chains in the Genus database with same CATH superfamily
5GXQA 2NQBB 2F8NA 5JRGC 5CP6B 3R45B 4ZUXD 2RIQA 5KDMA 4H9QA 5AV9C 1F1EA 4NE6A 4EO5C 5B0YA 1N1JB 3X1VB 4LD9C 1P3PD 1PZRA 5B24D 4XUJC 3LELD 3UTBD 2IO5B 4ZUXC 1P3GD 2NZDC 1WWIA 1U35A 5B1LC 3VH5A 1P3PC 3C1BA 1M18B 1BH9B 1KX3A 1T3UA 3LELC 2BYKA 3UTBC 1JFIB 1BH8A 1P3MD 1P3ID 3FDDA 4H9NA 1P3OB 3KSYA 3WA9B 5GT0B 3B6FA 3W96B 3X1UD 5B24A 3A6NB 2Y2JA 1P3IC 4CAYB 1P3GA 2VQRA 3AZFD 5AY8C 4WU9C 2YFVB 2LY8A 3AZIB 3O62B 4J8WB 3AZJB 3AZHC 5B32B 3AZEC 2F8NH 1Z2CB 5AVBB 1M19B 3AZFC 2Y2KA 1HQ3A 2JE5A 3NQUA 3LJAD 4KGCB 5DNMA 4J8VC 5JRGB 5AV6A 3WTPA 3MGRC 5AV9B 3AN2A 4EO5B 2BG1A 4WU8C 3LJAC 5B0ZA 4LD9B 3AZKD 3LZ0D 3X1TC 4XUJB 4WNNB 4ZUXB 2NZDB 1KX5D 5B1LB 5B33C 2F8NG 1P3PB 1P3FA 5B2IA 3AZMD 5AV5D 3REHA 3LZ0C 5B32G 4UUZB 3LELB 3UTBB 1M1AC 3W99A 2FJ7D 1KU5A 1KX5C 2HIOC 3AZLD 1ID3A 5C3IC 4DRBA 4XZQD 3LZ1D 3H0LC 4Z5TD 1P3MB 3KXBA 1P3IB 2XD1A 4NE3A 5CPID 1P3AD 5E5AA 4AWLC 3AZLC 3WKJD 5AY8B 3C1CD 4X23A 1S32C 5CPKD 3B6GB 5AV5A 4XZQC 3AZHB 4Z5TC 1P34A 3AZEB 2ZM5A 1F66A 4JJND 3VH5T 4QLCA 3RELA 4R8PA 3AZFB 4J8VB 5CPKC 5GT3D 5BNXA 3AFAC 4ZBJC 3KWQA 3MGRB 5CPIA 5AV8D 1TAFA 4WU8B 3LJAB 3WTPE 4J8XC 4LD9D 4J8UD 5GT3C 3UTAD 1EQZC 5G49B 3X1TB 4WV4B 4KUDC 4WJ3C 5JA4B 5B40D 3WAAA 3MGQA 2CV5D 3UT9A 1P3OC 3REKD 5B33B 4WZSB 1R4VA 4J8UC 3AZGA 3AZKB 3UTAC 1KX4C 3LZ0B 2PYOC 3A1IA 1M1AB 3B6GA 5BNVA 1H3OA 5B40C 2Y2PA 1KX5B 2HIOB 5B0YD 3REKC 5GXQC 5CP6A 3W97C 3EPJA 3AV2D 3VH6W 5C3IB 1N1JA 4E44A 4NFTA 5B0YC 1U35D 4AWLB 3AZLB 1M19C 3C1BD 1S32B 3IP4C 5GSUD 5CHLB 1KX3D 4XZQB 3V9RB 4H9RA 4Z5TB 2BYMA 3MGPC 5B31A 5B1MC 3REJC 1TZYA 1P3LA 3W98A 1BH9A 2DQNC 3B6FD 5CPKB 3AYWA 5B2JD 1ZLAA 3AFAB 3AV2A 4ZBJB 3WA9A 2UWXA 5GT0A 4UPKA 1ULYA 4H9SC 4H9PA 3VH6A 4J8XB 2Y2LA 5GT3B 1EQZB 4Z2MG 5B24C 5GSUA 4KUDB 3X1SA 1P3GC 3EPLA 4YM6A 1HQ3D 3NQJB 4J8UB 5DNMD 3UTAB 5AVCD 1KX4B 5AV6D 2PYOB 5B2JA 5AVBA 3AV1A 3WTPD 4M6BA 5B40B 1P3MC 3AN2D 3EPKA 3TU4A 3REKB 1HQ3C 5B0ZD 5GXQB 4DQYB 3W97B 5DNMC 2FFFB 2F8NB 5AV9A 5AV6C 2YFWB 2Y2MA 3X1UC 3WTPC 5BO0B 5KDMB 5B0YB 1B6WA 1P3FD 5DNNA 2Y2NA 5B2ID 2NZDA 3REHD 5AVCA 3AZNA 3W99D 3MGPB 5B1MB 3REJB 1ID3D 3B0CT 5B2IC 3REHC 1A7WA 3MNND 2BYKB 3W99C 2HUEC 1BH8B 3KXBD 5E5AD 1ID3C 5F99A 4X23D 3AZKC 5B24B 1P3KA 1P34D 5AY8A 4WU9A 1P3GB 1F66D 4QLCD 3RELD 4R8PD 4H9OA 4X23C 3AZHA 3AZMC 5AV5C 3AZEA 1P34C 2DF4C 3MNNA 3B0BA 3KWQD 2FJ7C 3KUYD 2AROA 1HQ3B 3NQUB 2ZY3A 5DNMB 3MGRA 5AV6B 3X1UB 3LZ1C 1AOID 3WTPB 4YS3D 3WAAD 3MGQD 3UT9D 5CPJA 5CPIC 1P3AC 3X1TA 3VH6T 3WKJC 3C1CC 3REIA 3AZGD 4G91C 3MGSA 3B6GD 3WAAC 3MGQC 2JSSA 5FUGB 2NQBD 4JJNC 5BT1D 3KUYA 5CP6D 5B2IB 1M1AA 3REHB 4CSRB 2HIOA 1P3BA 2G5IC 3W99B 2HUEB 1AOIA 4YS3A 1ID3B 5AV8C 4Z66A 3MVDA 3W98D 5B31D 2Y2QA 1P3LD 1TZYD 1M18D 2CV5C 2NQBA 4X23B 3AZMB 5AV5B 3AYWD 3R45A 1ZLAD 1P34B 2J8PA 3A1KA 3EG5B 3WA9D 3W98C 5GT0D 1P3LC 1TZYC 3X1VA 2FJ7B 3A6ND 3AYWC 1ZLAC 3AV2C 2ZY2A 3LZ1B 3X1SD 4YM6D 4J8XA 3AZID 5CPIB 1U35C 1P3AB 1TAFB 1M18A 1JFIA 3C1BC 3WKJB 3C1CB 4KUDA 4G91B 5GSUC 1KX3C 5AVBD 1P3OA 3AV1D 3X1SC 3WAAB 3MGQB 4YM6C 3TU4D 4JJNB 3W96A 5JRGD 3B6FC 3A6NA 5AV9D 5B2JC 4CAYA 3AV1C 5BNVB 3W97A 2YFVA 3TU4C 4XUJD 3AZIA 3O62A 4J8WA 4G92C 3AZJA 2YFWA 4KHAB 5AV8B 5DNND 5B32A 5BO0A 2NZDD 3AZND 5BS7A 5B1LD 1M19A 4KGCA 2CV5B 5DNNC 2CWEA 5JRGA 3MGPA 5AVCC 5B1MA 3REJA 3AZNC 4H9RB 1WWSA 2BYMB 3W98B 5B31B 1P3LB 1TZYB 1Q9CA 4H9QB 3AN2C 4LD9A 5F99D 4XUJA 5B0ZC 1W2EA 4WNNA 3AYWB 1HTAA 4ZUXA 1ZLAB 3AV2B 1P3KD 4NE5A 5B1LA 5AY8D 4H9SA 4WU9D 2G5HC 1P3PA 5F99C 1U35B 3AZHD 4H9PB 2L5AA 4UUZA 3LELA 3C1BB 3UTBA 1P3FC 3AZED 1P3KC 5GSUB 1KX3B 3X1SB 4YM6B 4H9NB 3P5JB 4J8VD 2AROD 2XD5A 3B6FB 3MGRD 1P3MA 1P3IA 5B2JB 3MNNC 5B31G 3AV1B 2Y2OA 4WU8D 2ZY4A 3KXBC 5CPJD 3TU4B 2AROC 3X1TD 5E5AC 4G92B 3X1UA 3REID 5B33D 3MGSD 2W8SA 3AZFA 5CPJC 1F66C 4J8VA 4QLCC 3RELC 4R8PC 5DNNB 3REIC 1M1AD 5AVCB 3AZNB 5FUGA 2HIOD 1P3BD 3MGSC 3KFUG 4WU8A 3KWQC 3LJAA 3AN2B 3KUYC 4HGAC 4CSRA 3H0RC 5G49A 5B0ZB 2F8NK 4Z66D 3MVDD 5JA4A 1P3BC 1AOIC 5B33A 3B0DC 4YS3C 1S32D 3AL0C 3UT9C 3AZKA 5F99B 2JCHA 3LZ0A 3H0MC 2Y2GA 2RVQD 1P3FB 3AZGC 4Z66C 3MVDC 1P3KB 1KX5A 3B6GC 4WU9B 3X1VD 3B0CW 3AZMA 3EPHA 2NQBC 4H9OB 5BT1C 3AFAD 2RVQC 5CP6C 4DRAA 2FJ7A 3MNNB 3AZLA 3X1VC 3KXBB 4J8XD 2ZY5A 1EQZD 2AROB 1S32A 5E5AB 4XZQA 3V9RA 3LZ1A 2IO5C 4KUDD 4Z5TA 1P3OD 1P3AA 5B31C 3C1CA 5CPJB 1KX4D 1F66B 3WKJA 1M18C 5CPKA 4QLCB 3RELB 4R8PB 2PYOD 3REIB 3W96D 3AFAA 1BFMA 5BNXB 3MGSB 2F2AC 1B67A 4JJNA 3WA9C 5GXQD 3W97D 5GT0C 3KWQB 2F8ND 4E45A 3KUYB 4HGAB 3W96C 5GT3A 3O62D 4J8WD 3AZJD 1EQZA 2Y2HA 5B32D 3A6NC 2Y2IA 1P3BB 3F6TA 1M19D 1AOIB 4KHAA 3B0DB 5AV8A 4YS3B 4KGCD 3NQJA 3VH5W 3AZIC 4J8UA 3O62C 4J8WC 3UT9B 3UTAA 3AZJC 1KX4A 5B32C 2PYOA 3AZGB 3MGPD 4Z66B 5B1MD 5BS7C 3MVDB 5B40A 3REJD 2CV5A 5AVBC 3REKA 4Z2MH 1H3OB 4KGCC
chains in the Genus database with same CATH topology
5GXQA 2NQBB 2F8NA 5JRGC 5CP6B 3R45B 4ZUXD 2RIQA 5KDMA 4H9QA 5AV9C 1F1EA 4NE6A 4EO5C 5B0YA 1N1JB 3X1VB 4LD9C 1P3PD 1PZRA 5B24D 4XUJC 3LELD 3UTBD 2IO5B 4ZUXC 1P3GD 2NZDC 1WWIA 1U35A 5B1LC 3VH5A 1P3PC 3C1BA 1M18B 1BH9B 1KX3A 1T3UA 3LELC 2BYKA 3UTBC 1JFIB 1BH8A 1P3MD 1P3ID 3FDDA 4H9NA 1P3OB 3KSYA 3WA9B 5GT0B 3B6FA 3W96B 3X1UD 5B24A 3A6NB 2Y2JA 1P3IC 4CAYB 1P3GA 2VQRA 3AZFD 5AY8C 4WU9C 2YFVB 2LY8A 3AZIB 3O62B 4J8WB 3AZJB 3AZHC 5B32B 3AZEC 2F8NH 1Z2CB 5AVBB 1M19B 3AZFC 2Y2KA 1HQ3A 2JE5A 3NQUA 3LJAD 4KGCB 5DNMA 4J8VC 5JRGB 5AV6A 3WTPA 3MGRC 5AV9B 3AN2A 4EO5B 2BG1A 4WU8C 3LJAC 5B0ZA 4LD9B 3AZKD 3LZ0D 3X1TC 4XUJB 4WNNB 4ZUXB 2NZDB 1KX5D 5B1LB 5B33C 2F8NG 1P3PB 1P3FA 5B2IA 3AZMD 5AV5D 3REHA 3LZ0C 5B32G 4UUZB 3LELB 3UTBB 1M1AC 3W99A 2FJ7D 1KU5A 1KX5C 2HIOC 3AZLD 1ID3A 5C3IC 4DRBA 4XZQD 3LZ1D 3H0LC 4Z5TD 1P3MB 3KXBA 1P3IB 2XD1A 4NE3A 5CPID 1P3AD 5E5AA 4AWLC 3AZLC 3WKJD 5AY8B 3C1CD 4X23A 1S32C 5CPKD 3B6GB 5AV5A 4XZQC 3AZHB 4Z5TC 1P34A 3AZEB 2ZM5A 1F66A 4JJND 3VH5T 4QLCA 3RELA 4R8PA 3AZFB 4J8VB 5CPKC 5GT3D 5BNXA 3AFAC 4ZBJC 3KWQA 3MGRB 5CPIA 5AV8D 1TAFA 4WU8B 3LJAB 3WTPE 4J8XC 4LD9D 4J8UD 5GT3C 3UTAD 1EQZC 5G49B 3X1TB 4WV4B 4KUDC 4WJ3C 5JA4B 5B40D 3WAAA 3MGQA 2CV5D 3UT9A 1P3OC 3REKD 5B33B 4WZSB 1R4VA 4J8UC 3AZGA 3AZKB 3UTAC 1KX4C 3LZ0B 2PYOC 3A1IA 1M1AB 3B6GA 5BNVA 1H3OA 5B40C 2Y2PA 1KX5B 2HIOB 5B0YD 3REKC 5GXQC 5CP6A 3W97C 3EPJA 3AV2D 3VH6W 5C3IB 1N1JA 4E44A 4NFTA 5B0YC 1U35D 4AWLB 3AZLB 1M19C 3C1BD 1S32B 3IP4C 5GSUD 5CHLB 1KX3D 4XZQB 3V9RB 4H9RA 4Z5TB 2BYMA 3MGPC 5B31A 5B1MC 3REJC 1TZYA 1P3LA 3W98A 1BH9A 2DQNC 3B6FD 5CPKB 3AYWA 5B2JD 1ZLAA 3AFAB 3AV2A 4ZBJB 3WA9A 2UWXA 5GT0A 4UPKA 1ULYA 4H9SC 4H9PA 3VH6A 4J8XB 2Y2LA 5GT3B 1EQZB 4Z2MG 5B24C 5GSUA 4KUDB 3X1SA 1P3GC 3EPLA 4YM6A 1HQ3D 3NQJB 4J8UB 5DNMD 3UTAB 5AVCD 1KX4B 5AV6D 2PYOB 5B2JA 5AVBA 3AV1A 3WTPD 4M6BA 5B40B 1P3MC 3AN2D 3EPKA 3TU4A 3REKB 1HQ3C 5B0ZD 5GXQB 4DQYB 3W97B 5DNMC 2FFFB 2F8NB 5AV9A 5AV6C 2YFWB 2Y2MA 3X1UC 3WTPC 5BO0B 5KDMB 5B0YB 1B6WA 1P3FD 5DNNA 2Y2NA 5B2ID 2NZDA 3REHD 5AVCA 3AZNA 3W99D 3MGPB 5B1MB 3REJB 1ID3D 3B0CT 5B2IC 3REHC 1A7WA 3MNND 2BYKB 3W99C 2HUEC 1BH8B 3KXBD 5E5AD 1ID3C 5F99A 4X23D 3AZKC 5B24B 1P3KA 1P34D 5AY8A 4WU9A 1P3GB 1F66D 4QLCD 3RELD 4R8PD 4H9OA 4X23C 3AZHA 3AZMC 5AV5C 3AZEA 1P34C 2DF4C 3MNNA 3B0BA 3KWQD 2FJ7C 3KUYD 2AROA 1HQ3B 3NQUB 2ZY3A 5DNMB 3MGRA 5AV6B 3X1UB 3LZ1C 1AOID 3WTPB 4YS3D 3WAAD 3MGQD 3UT9D 5CPJA 5CPIC 1P3AC 3X1TA 3VH6T 3WKJC 3C1CC 3REIA 3AZGD 4G91C 3MGSA 3B6GD 3WAAC 3MGQC 2JSSA 5FUGB 2NQBD 4JJNC 5BT1D 3KUYA 5CP6D 5B2IB 1M1AA 3REHB 4CSRB 2HIOA 1P3BA 2G5IC 3W99B 2HUEB 1AOIA 4YS3A 1ID3B 5AV8C 4Z66A 3MVDA 3W98D 5B31D 2Y2QA 1P3LD 1TZYD 1M18D 2CV5C 2NQBA 4X23B 3AZMB 5AV5B 3AYWD 3R45A 1ZLAD 1P34B 2J8PA 3A1KA 3EG5B 3WA9D 3W98C 5GT0D 1P3LC 1TZYC 3X1VA 2FJ7B 3A6ND 3AYWC 1ZLAC 3AV2C 2ZY2A 3LZ1B 3X1SD 4YM6D 4J8XA 3AZID 5CPIB 1U35C 1P3AB 1TAFB 1M18A 1JFIA 3C1BC 3WKJB 3C1CB 4KUDA 4G91B 5GSUC 1KX3C 5AVBD 1P3OA 3AV1D 3X1SC 3WAAB 3MGQB 4YM6C 3TU4D 4JJNB 3W96A 5JRGD 3B6FC 3A6NA 5AV9D 5B2JC 4CAYA 3AV1C 5BNVB 3W97A 2YFVA 3TU4C 4XUJD 3AZIA 3O62A 4J8WA 4G92C 3AZJA 2YFWA 4KHAB 5AV8B 5DNND 5B32A 5BO0A 2NZDD 3AZND 5BS7A 5B1LD 1M19A 4KGCA 2CV5B 5DNNC 2CWEA 5JRGA 3MGPA 5AVCC 5B1MA 3REJA 3AZNC 4H9RB 1WWSA 2BYMB 3W98B 5B31B 1P3LB 1TZYB 1Q9CA 4H9QB 3AN2C 4LD9A 5F99D 4XUJA 5B0ZC 1W2EA 4WNNA 3AYWB 1HTAA 4ZUXA 1ZLAB 3AV2B 1P3KD 4NE5A 5B1LA 5AY8D 4H9SA 4WU9D 2G5HC 1P3PA 5F99C 1U35B 3AZHD 4H9PB 2L5AA 4UUZA 3LELA 3C1BB 3UTBA 1P3FC 3AZED 1P3KC 5GSUB 1KX3B 3X1SB 4YM6B 4H9NB 3P5JB 4J8VD 2AROD 2XD5A 3B6FB 3MGRD 1P3MA 1P3IA 5B2JB 3MNNC 5B31G 3AV1B 2Y2OA 4WU8D 2ZY4A 3KXBC 5CPJD 3TU4B 2AROC 3X1TD 5E5AC 4G92B 3X1UA 3REID 5B33D 3MGSD 2W8SA 3AZFA 5CPJC 1F66C 4J8VA 4QLCC 3RELC 4R8PC 5DNNB 3REIC 1M1AD 5AVCB 3AZNB 5FUGA 2HIOD 1P3BD 3MGSC 3KFUG 4WU8A 3KWQC 3LJAA 3AN2B 3KUYC 4HGAC 4CSRA 3H0RC 5G49A 5B0ZB 2F8NK 4Z66D 3MVDD 5JA4A 1P3BC 1AOIC 5B33A 3B0DC 4YS3C 1S32D 3AL0C 3UT9C 3AZKA 5F99B 2JCHA 3LZ0A 3H0MC 2Y2GA 2RVQD 1P3FB 3AZGC 4Z66C 3MVDC 1P3KB 1KX5A 3B6GC 4WU9B 3X1VD 3B0CW 3AZMA 3EPHA 2NQBC 4H9OB 5BT1C 3AFAD 2RVQC 5CP6C 4DRAA 2FJ7A 3MNNB 3AZLA 3X1VC 3KXBB 4J8XD 2ZY5A 1EQZD 2AROB 1S32A 5E5AB 4XZQA 3V9RA 3LZ1A 2IO5C 4KUDD 4Z5TA 1P3OD 1P3AA 5B31C 3C1CA 5CPJB 1KX4D 1F66B 3WKJA 1M18C 5CPKA 4QLCB 3RELB 4R8PB 2PYOD 3REIB 3W96D 3AFAA 1BFMA 5BNXB 3MGSB 2F2AC 1B67A 4JJNA 3WA9C 5GXQD 3W97D 5GT0C 3KWQB 2F8ND 4E45A 3KUYB 4HGAB 3W96C 5GT3A 3O62D 4J8WD 3AZJD 1EQZA 2Y2HA 5B32D 3A6NC 2Y2IA 1P3BB 3F6TA 1M19D 1AOIB 4KHAA 3B0DB 5AV8A 4YS3B 4KGCD 3NQJA 3VH5W 3AZIC 4J8UA 3O62C 4J8WC 3UT9B 3UTAA 3AZJC 1KX4A 5B32C 2PYOA 3AZGB 3MGPD 4Z66B 5B1MD 5BS7C 3MVDB 5B40A 3REJD 2CV5A 5AVBC 3REKA 4Z2MH 1H3OB 4KGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ A;  2NQB B;  2F8N A;  5JRG C;  5CP6 B;  3R45 B;  4ZUX D;  5KDM A;  4H9Q A;  5AV9 C;  1F1E A;  4NE6 A;  4EO5 C;  5B0Y A;  1N1J B;  3X1V B;  4LD9 C;  1P3P D;  5B24 D;  4XUJ C;  3LEL D;  3UTB D;  2IO5 B;  4ZUX C;  1P3G D;  2NZD C;  1WWI A;  1U35 A;  5B1L C;  3VH5 A;  1P3P C;  3C1B A;  1M18 B;  1BH9 B;  1KX3 A;  3LEL C;  1JFI B;  2BYK A;  3UTB C;  1BH8 A;  1P3M D;  1P3I D;  4H9N A;  1P3O B;  3KSY A;  3WA9 B;  5GT0 B;  3B6F A;  3W96 B;  3X1U D;  5B24 A;  3A6N B;  1P3I C;  4CAY B;  1P3G A;  3AZF D;  5AY8 C;  4WU9 C;  2YFV B;  2LY8 A;  3AZI B;  3O62 B;  4J8W B;  3AZJ B;  3AZH C;  5B32 B;  3AZE C;  2F8N H;  5AVB B;  1M19 B;  3AZF C;  1HQ3 A;  3NQU A;  3LJA D;  4KGC B;  5DNM A;  4J8V C;  5JRG B;  5AV6 A;  3WTP A;  3MGR C;  5AV9 B;  3AN2 A;  4EO5 B;  4WU8 C;  3LJA C;  5B0Z A;  4LD9 B;  3AZK D;  3LZ0 D;  3X1T C;  4XUJ B;  4WNN B;  4ZUX B;  2NZD B;  1KX5 D;  5B1L B;  5B33 C;  2F8N G;  1P3P B;  1P3F A;  5B2I A;  3AZM D;  5AV5 D;  3REH A;  3LZ0 C;  5B32 G;  4UUZ B;  3LEL B;  3UTB B;  1M1A C;  3W99 A;  2FJ7 D;  1KU5 A;  1KX5 C;  2HIO C;  3AZL D;  1ID3 A;  5C3I C;  4DRB A;  4XZQ D;  3LZ1 D;  4Z5T D;  1P3M B;  3KXB A;  1P3I B;  4NE3 A;  5CPI D;  1P3A D;  5E5A A;  4AWL C;  3AZL C;  3WKJ D;  5AY8 B;  3C1C D;  4X23 A;  1S32 C;  5CPK D;  3B6G B;  5AV5 A;  4XZQ C;  3AZH B;  4Z5T C;  1P34 A;  3AZE B;  1F66 A;  4JJN D;  3VH5 T;  4QLC A;  3REL A;  4R8P A;  3AZF B;  4J8V B;  5CPK C;  5GT3 D;  5BNX A;  3AFA C;  4ZBJ C;  3KWQ A;  3MGR B;  5CPI A;  5AV8 D;  1TAF A;  4WU8 B;  3LJA B;  3WTP E;  4J8X C;  4LD9 D;  4J8U D;  5GT3 C;  3UTA D;  1EQZ C;  5G49 B;  3X1T B;  4WV4 B;  4KUD C;  5JA4 B;  5B40 D;  3WAA A;  3MGQ A;  2CV5 D;  3UT9 A;  1P3O C;  3REK D;  5B33 B;  4WZS B;  1R4V A;  4J8U C;  3AZG A;  3AZK B;  3UTA C;  1KX4 C;  3LZ0 B;  2PYO C;  1M1A B;  3B6G A;  5BNV A;  1H3O A;  5B40 C;  1KX5 B;  2HIO B;  5B0Y D;  3REK C;  5GXQ C;  5CP6 A;  3W97 C;  3AV2 D;  3VH6 W;  5C3I B;  1N1J A;  4E44 A;  4NFT A;  5B0Y C;  1U35 D;  4AWL B;  3AZL B;  1M19 C;  3C1B D;  1S32 B;  5GSU D;  5CHL B;  1KX3 D;  4XZQ B;  3V9R B;  4H9R A;  4Z5T B;  2BYM A;  3MGP C;  5B31 A;  5B1M C;  3REJ C;  1TZY A;  1P3L A;  3W98 A;  1BH9 A;  3B6F D;  5CPK B;  3AYW A;  5B2J D;  1ZLA A;  3AFA B;  3AV2 A;  4ZBJ B;  3WA9 A;  5GT0 A;  1ULY A;  4H9S C;  4H9P A;  3VH6 A;  4J8X B;  5GT3 B;  1EQZ B;  4Z2M G;  5B24 C;  5GSU A;  4KUD B;  3X1S A;  1P3G C;  4YM6 A;  1HQ3 D;  3NQJ B;  4J8U B;  5DNM D;  3UTA B;  5AVC D;  1KX4 B;  5AV6 D;  2PYO B;  5B2J A;  5AVB A;  3AV1 A;  3WTP D;  4M6B A;  5B40 B;  1P3M C;  3AN2 D;  3TU4 A;  3REK B;  1HQ3 C;  5B0Z D;  5GXQ B;  3W97 B;  5DNM C;  2F8N B;  5AV9 A;  5AV6 C;  2YFW B;  3X1U C;  3WTP C;  5BO0 B;  5KDM B;  5B0Y B;  1B6W A;  1P3F D;  5DNN A;  5B2I D;  2NZD A;  3REH D;  5AVC A;  3AZN A;  3W99 D;  3MGP B;  5B1M B;  3REJ B;  1ID3 D;  3B0C T;  5B2I C;  3REH C;  1A7W A;  3MNN D;  2BYK B;  3W99 C;  2HUE C;  1BH8 B;  3KXB D;  5E5A D;  1ID3 C;  5F99 A;  4X23 D;  3AZK C;  5B24 B;  1P3K A;  1P34 D;  5AY8 A;  4WU9 A;  1P3G B;  1F66 D;  4QLC D;  3REL D;  4R8P D;  4H9O A;  4X23 C;  3AZH A;  3AZM C;  5AV5 C;  3AZE A;  1P34 C;  3MNN A;  3B0B A;  3KWQ D;  2FJ7 C;  3KUY D;  2ARO A;  1HQ3 B;  3NQU B;  5DNM B;  3MGR A;  5AV6 B;  3X1U B;  3LZ1 C;  1AOI D;  3WTP B;  4YS3 D;  3WAA D;  3MGQ D;  3UT9 D;  5CPJ A;  5CPI C;  1P3A C;  3X1T A;  3VH6 T;  3WKJ C;  3C1C C;  3REI A;  3AZG D;  4G91 C;  3MGS A;  3B6G D;  3WAA C;  3MGQ C;  2JSS A;  5FUG B;  2NQB D;  4JJN C;  5BT1 D;  3KUY A;  5CP6 D;  5B2I B;  1M1A A;  3REH B;  4CSR B;  2HIO A;  1P3B A;  3W99 B;  2HUE B;  1AOI A;  4YS3 A;  1ID3 B;  5AV8 C;  4Z66 A;  3MVD A;  3W98 D;  5B31 D;  1P3L D;  1TZY D;  1M18 D;  2CV5 C;  2NQB A;  4X23 B;  3AZM B;  5AV5 B;  3AYW D;  3R45 A;  1ZLA D;  1P34 B;  3WA9 D;  3W98 C;  5GT0 D;  1P3L C;  1TZY C;  3X1V A;  2FJ7 B;  3A6N D;  3AYW C;  1ZLA C;  3AV2 C;  3LZ1 B;  3X1S D;  4YM6 D;  4J8X A;  3AZI D;  5CPI B;  1U35 C;  1P3A B;  1TAF B;  1M18 A;  1JFI A;  3C1B C;  3WKJ B;  3C1C B;  4KUD A;  4G91 B;  5GSU C;  1KX3 C;  5AVB D;  1P3O A;  3AV1 D;  3X1S C;  3WAA B;  3MGQ B;  4YM6 C;  3TU4 D;  4JJN B;  3W96 A;  5JRG D;  3B6F C;  3A6N A;  5AV9 D;  5B2J C;  4CAY A;  3AV1 C;  5BNV B;  3W97 A;  2YFV A;  3TU4 C;  4XUJ D;  3AZI A;  3O62 A;  4J8W A;  4G92 C;  3AZJ A;  2YFW A;  4KHA B;  5AV8 B;  5DNN D;  5B32 A;  5BO0 A;  2NZD D;  3AZN D;  5BS7 A;  5B1L D;  1M19 A;  4KGC A;  2CV5 B;  5DNN C;  2CWE A;  5JRG A;  3MGP A;  5AVC C;  5B1M A;  3REJ A;  3AZN C;  4H9R B;  1WWS A;  2BYM B;  3W98 B;  5B31 B;  1P3L B;  1TZY B;  1Q9C A;  4H9Q B;  3AN2 C;  4LD9 A;  5F99 D;  4XUJ A;  5B0Z C;  4WNN A;  3AYW B;  1HTA A;  4ZUX A;  1ZLA B;  3AV2 B;  1P3K D;  4NE5 A;  5B1L A;  5AY8 D;  4H9S A;  4WU9 D;  1P3P A;  5F99 C;  1U35 B;  3AZH D;  4H9P B;  2L5A A;  4UUZ A;  3LEL A;  3C1B B;  3UTB A;  1P3F C;  3AZE D;  1P3K C;  5GSU B;  1KX3 B;  3X1S B;  4YM6 B;  4H9N B;  4J8V D;  2ARO D;  3B6F B;  3MGR D;  1P3M A;  1P3I A;  5B2J B;  3MNN C;  5B31 G;  3AV1 B;  4WU8 D;  3KXB C;  5CPJ D;  3TU4 B;  2ARO C;  3X1T D;  5E5A C;  4G92 B;  3X1U A;  3REI D;  5B33 D;  3MGS D;  3AZF A;  5CPJ C;  1F66 C;  4J8V A;  4QLC C;  3REL C;  4R8P C;  5DNN B;  3REI C;  1M1A D;  5AVC B;  3AZN B;  5FUG A;  2HIO D;  1P3B D;  3MGS C;  4WU8 A;  3KWQ C;  3LJA A;  3AN2 B;  3KUY C;  4HGA C;  4CSR A;  5G49 A;  5B0Z B;  2F8N K;  4Z66 D;  3MVD D;  5JA4 A;  1P3B C;  1AOI C;  5B33 A;  3B0D C;  4YS3 C;  1S32 D;  3UT9 C;  3AZK A;  5F99 B;  3LZ0 A;  2RVQ D;  1P3F B;  3AZG C;  4Z66 C;  3MVD C;  1P3K B;  1KX5 A;  3B6G C;  4WU9 B;  3X1V D;  3B0C W;  3AZM A;  2NQB C;  4H9O B;  5BT1 C;  3AFA D;  2RVQ C;  5CP6 C;  4DRA A;  2FJ7 A;  3MNN B;  3AZL A;  3X1V C;  3KXB B;  4J8X D;  1EQZ D;  2ARO B;  1S32 A;  5E5A B;  4XZQ A;  3V9R A;  3LZ1 A;  2IO5 C;  4KUD D;  4Z5T A;  1P3O D;  1P3A A;  5B31 C;  3C1C A;  5CPJ B;  1KX4 D;  1F66 B;  3WKJ A;  1M18 C;  5CPK A;  4QLC B;  3REL B;  4R8P B;  2PYO D;  3REI B;  3W96 D;  3AFA A;  1BFM A;  5BNX B;  3MGS B;  4JJN A;  1B67 A;  3WA9 C;  5GXQ D;  3W97 D;  5GT0 C;  3KWQ B;  2F8N D;  4E45 A;  3KUY B;  4HGA B;  3W96 C;  5GT3 A;  3O62 D;  4J8W D;  3AZJ D;  1EQZ A;  5B32 D;  3A6N C;  1P3B B;  1M19 D;  1AOI B;  4KHA A;  3B0D B;  5AV8 A;  4YS3 B;  4KGC D;  3NQJ A;  3VH5 W;  3AZI C;  4J8U A;  3O62 C;  4J8W C;  3UT9 B;  3UTA A;  3AZJ C;  1KX4 A;  5B32 C;  2PYO A;  3AZG B;  3MGP D;  4Z66 B;  5B1M D;  5BS7 C;  3MVD B;  5B40 A;  3REJ D;  2CV5 A;  5AVB C;  3REK A;  4Z2M H;  1H3O B;  4KGC C; 
#chains in the Genus database with same CATH topology
 5GXQ A;  2NQB B;  2F8N A;  5JRG C;  5CP6 B;  3R45 B;  4ZUX D;  2RIQ A;  5KDM A;  4H9Q A;  5AV9 C;  1F1E A;  4NE6 A;  4EO5 C;  5B0Y A;  1N1J B;  3X1V B;  4LD9 C;  1P3P D;  1PZR A;  5B24 D;  4XUJ C;  3LEL D;  3UTB D;  2IO5 B;  4ZUX C;  1P3G D;  2NZD C;  1WWI A;  1U35 A;  5B1L C;  3VH5 A;  1P3P C;  3C1B A;  1M18 B;  1BH9 B;  1KX3 A;  1T3U A;  3LEL C;  2BYK A;  3UTB C;  1JFI B;  1BH8 A;  1P3M D;  1P3I D;  3FDD A;  4H9N A;  1P3O B;  3KSY A;  3WA9 B;  5GT0 B;  3B6F A;  3W96 B;  3X1U D;  5B24 A;  3A6N B;  2Y2J A;  1P3I C;  4CAY B;  1P3G A;  2VQR A;  3AZF D;  5AY8 C;  4WU9 C;  2YFV B;  2LY8 A;  3AZI B;  3O62 B;  4J8W B;  3AZJ B;  3AZH C;  5B32 B;  3AZE C;  2F8N H;  1Z2C B;  5AVB B;  1M19 B;  3AZF C;  2Y2K A;  1HQ3 A;  2JE5 A;  3NQU A;  3LJA D;  4KGC B;  5DNM A;  4J8V C;  5JRG B;  5AV6 A;  3WTP A;  3MGR C;  5AV9 B;  3AN2 A;  4EO5 B;  2BG1 A;  4WU8 C;  3LJA C;  5B0Z A;  4LD9 B;  3AZK D;  3LZ0 D;  3X1T C;  4XUJ B;  4WNN B;  4ZUX B;  2NZD B;  1KX5 D;  5B1L B;  5B33 C;  2F8N G;  1P3P B;  1P3F A;  5B2I A;  3AZM D;  5AV5 D;  3REH A;  3LZ0 C;  5B32 G;  4UUZ B;  3LEL B;  3UTB B;  1M1A C;  3W99 A;  2FJ7 D;  1KU5 A;  1KX5 C;  2HIO C;  3AZL D;  1ID3 A;  5C3I C;  4DRB A;  4XZQ D;  3LZ1 D;  3H0L C;  4Z5T D;  1P3M B;  3KXB A;  1P3I B;  2XD1 A;  4NE3 A;  5CPI D;  1P3A D;  5E5A A;  4AWL C;  3AZL C;  3WKJ D;  5AY8 B;  3C1C D;  4X23 A;  1S32 C;  5CPK D;  3B6G B;  5AV5 A;  4XZQ C;  3AZH B;  4Z5T C;  1P34 A;  3AZE B;  2ZM5 A;  1F66 A;  4JJN D;  3VH5 T;  4QLC A;  3REL A;  4R8P A;  3AZF B;  4J8V B;  5CPK C;  5GT3 D;  5BNX A;  3AFA C;  4ZBJ C;  3KWQ A;  3MGR B;  5CPI A;  5AV8 D;  1TAF A;  4WU8 B;  3LJA B;  3WTP E;  4J8X C;  4LD9 D;  4J8U D;  5GT3 C;  3UTA D;  1EQZ C;  5G49 B;  3X1T B;  4WV4 B;  4KUD C;  4WJ3 C;  5JA4 B;  5B40 D;  3WAA A;  3MGQ A;  2CV5 D;  3UT9 A;  1P3O C;  3REK D;  5B33 B;  4WZS B;  1R4V A;  4J8U C;  3AZG A;  3AZK B;  3UTA C;  1KX4 C;  3LZ0 B;  2PYO C;  3A1I A;  1M1A B;  3B6G A;  5BNV A;  1H3O A;  5B40 C;  2Y2P A;  1KX5 B;  2HIO B;  5B0Y D;  3REK C;  5GXQ C;  5CP6 A;  3W97 C;  3EPJ A;  3AV2 D;  3VH6 W;  5C3I B;  1N1J A;  4E44 A;  4NFT A;  5B0Y C;  1U35 D;  4AWL B;  3AZL B;  1M19 C;  3C1B D;  1S32 B;  3IP4 C;  5GSU D;  5CHL B;  1KX3 D;  4XZQ B;  3V9R B;  4H9R A;  4Z5T B;  2BYM A;  3MGP C;  5B31 A;  5B1M C;  3REJ C;  1TZY A;  1P3L A;  3W98 A;  1BH9 A;  2DQN C;  3B6F D;  5CPK B;  3AYW A;  5B2J D;  1ZLA A;  3AFA B;  3AV2 A;  4ZBJ B;  3WA9 A;  2UWX A;  5GT0 A;  4UPK A;  1ULY A;  4H9S C;  4H9P A;  3VH6 A;  4J8X B;  2Y2L A;  5GT3 B;  1EQZ B;  4Z2M G;  5B24 C;  5GSU A;  4KUD B;  3X1S A;  1P3G C;  3EPL A;  4YM6 A;  1HQ3 D;  3NQJ B;  4J8U B;  5DNM D;  3UTA B;  5AVC D;  1KX4 B;  5AV6 D;  2PYO B;  5B2J A;  5AVB A;  3AV1 A;  3WTP D;  4M6B A;  5B40 B;  1P3M C;  3AN2 D;  3EPK A;  3TU4 A;  3REK B;  1HQ3 C;  5B0Z D;  5GXQ B;  4DQY B;  3W97 B;  5DNM C;  2FFF B;  2F8N B;  5AV9 A;  5AV6 C;  2YFW B;  2Y2M A;  3X1U C;  3WTP C;  5BO0 B;  5KDM B;  5B0Y B;  1B6W A;  1P3F D;  5DNN A;  2Y2N A;  5B2I D;  2NZD A;  3REH D;  5AVC A;  3AZN A;  3W99 D;  3MGP B;  5B1M B;  3REJ B;  1ID3 D;  3B0C T;  5B2I C;  3REH C;  1A7W A;  3MNN D;  2BYK B;  3W99 C;  2HUE C;  1BH8 B;  3KXB D;  5E5A D;  1ID3 C;  5F99 A;  4X23 D;  3AZK C;  5B24 B;  1P3K A;  1P34 D;  5AY8 A;  4WU9 A;  1P3G B;  1F66 D;  4QLC D;  3REL D;  4R8P D;  4H9O A;  4X23 C;  3AZH A;  3AZM C;  5AV5 C;  3AZE A;  1P34 C;  2DF4 C;  3MNN A;  3B0B A;  3KWQ D;  2FJ7 C;  3KUY D;  2ARO A;  1HQ3 B;  3NQU B;  2ZY3 A;  5DNM B;  3MGR A;  5AV6 B;  3X1U B;  3LZ1 C;  1AOI D;  3WTP B;  4YS3 D;  3WAA D;  3MGQ D;  3UT9 D;  5CPJ A;  5CPI C;  1P3A C;  3X1T A;  3VH6 T;  3WKJ C;  3C1C C;  3REI A;  3AZG D;  4G91 C;  3MGS A;  3B6G D;  3WAA C;  3MGQ C;  2JSS A;  5FUG B;  2NQB D;  4JJN C;  5BT1 D;  3KUY A;  5CP6 D;  5B2I B;  1M1A A;  3REH B;  4CSR B;  2HIO A;  1P3B A;  2G5I C;  3W99 B;  2HUE B;  1AOI A;  4YS3 A;  1ID3 B;  5AV8 C;  4Z66 A;  3MVD A;  3W98 D;  5B31 D;  2Y2Q A;  1P3L D;  1TZY D;  1M18 D;  2CV5 C;  2NQB A;  4X23 B;  3AZM B;  5AV5 B;  3AYW D;  3R45 A;  1ZLA D;  1P34 B;  2J8P A;  3A1K A;  3EG5 B;  3WA9 D;  3W98 C;  5GT0 D;  1P3L C;  1TZY C;  3X1V A;  2FJ7 B;  3A6N D;  3AYW C;  1ZLA C;  3AV2 C;  2ZY2 A;  3LZ1 B;  3X1S D;  4YM6 D;  4J8X A;  3AZI D;  5CPI B;  1U35 C;  1P3A B;  1TAF B;  1M18 A;  1JFI A;  3C1B C;  3WKJ B;  3C1C B;  4KUD A;  4G91 B;  5GSU C;  1KX3 C;  5AVB D;  1P3O A;  3AV1 D;  3X1S C;  3WAA B;  3MGQ B;  4YM6 C;  3TU4 D;  4JJN B;  3W96 A;  5JRG D;  3B6F C;  3A6N A;  5AV9 D;  5B2J C;  4CAY A;  3AV1 C;  5BNV B;  3W97 A;  2YFV A;  3TU4 C;  4XUJ D;  3AZI A;  3O62 A;  4J8W A;  4G92 C;  3AZJ A;  2YFW A;  4KHA B;  5AV8 B;  5DNN D;  5B32 A;  5BO0 A;  2NZD D;  3AZN D;  5BS7 A;  5B1L D;  1M19 A;  4KGC A;  2CV5 B;  5DNN C;  2CWE A;  5JRG A;  3MGP A;  5AVC C;  5B1M A;  3REJ A;  3AZN C;  4H9R B;  1WWS A;  2BYM B;  3W98 B;  5B31 B;  1P3L B;  1TZY B;  1Q9C A;  4H9Q B;  3AN2 C;  4LD9 A;  5F99 D;  4XUJ A;  5B0Z C;  1W2E A;  4WNN A;  3AYW B;  1HTA A;  4ZUX A;  1ZLA B;  3AV2 B;  1P3K D;  4NE5 A;  5B1L A;  5AY8 D;  4H9S A;  4WU9 D;  2G5H C;  1P3P A;  5F99 C;  1U35 B;  3AZH D;  4H9P B;  2L5A A;  4UUZ A;  3LEL A;  3C1B B;  3UTB A;  1P3F C;  3AZE D;  1P3K C;  5GSU B;  1KX3 B;  3X1S B;  4YM6 B;  4H9N B;  3P5J B;  4J8V D;  2ARO D;  2XD5 A;  3B6F B;  3MGR D;  1P3M A;  1P3I A;  5B2J B;  3MNN C;  5B31 G;  3AV1 B;  2Y2O A;  4WU8 D;  2ZY4 A;  3KXB C;  5CPJ D;  3TU4 B;  2ARO C;  3X1T D;  5E5A C;  4G92 B;  3X1U A;  3REI D;  5B33 D;  3MGS D;  2W8S A;  3AZF A;  5CPJ C;  1F66 C;  4J8V A;  4QLC C;  3REL C;  4R8P C;  5DNN B;  3REI C;  1M1A D;  5AVC B;  3AZN B;  5FUG A;  2HIO D;  1P3B D;  3MGS C;  3KFU G;  4WU8 A;  3KWQ C;  3LJA A;  3AN2 B;  3KUY C;  4HGA C;  4CSR A;  3H0R C;  5G49 A;  5B0Z B;  2F8N K;  4Z66 D;  3MVD D;  5JA4 A;  1P3B C;  1AOI C;  5B33 A;  3B0D C;  4YS3 C;  1S32 D;  3AL0 C;  3UT9 C;  3AZK A;  5F99 B;  2JCH A;  3LZ0 A;  3H0M C;  2Y2G A;  2RVQ D;  1P3F B;  3AZG C;  4Z66 C;  3MVD C;  1P3K B;  1KX5 A;  3B6G C;  4WU9 B;  3X1V D;  3B0C W;  3AZM A;  3EPH A;  2NQB C;  4H9O B;  5BT1 C;  3AFA D;  2RVQ C;  5CP6 C;  4DRA A;  2FJ7 A;  3MNN B;  3AZL A;  3X1V C;  3KXB B;  4J8X D;  2ZY5 A;  1EQZ D;  2ARO B;  1S32 A;  5E5A B;  4XZQ A;  3V9R A;  3LZ1 A;  2IO5 C;  4KUD D;  4Z5T A;  1P3O D;  1P3A A;  5B31 C;  3C1C A;  5CPJ B;  1KX4 D;  1F66 B;  3WKJ A;  1M18 C;  5CPK A;  4QLC B;  3REL B;  4R8P B;  2PYO D;  3REI B;  3W96 D;  3AFA A;  1BFM A;  5BNX B;  3MGS B;  2F2A C;  1B67 A;  4JJN A;  3WA9 C;  5GXQ D;  3W97 D;  5GT0 C;  3KWQ B;  2F8N D;  4E45 A;  3KUY B;  4HGA B;  3W96 C;  5GT3 A;  3O62 D;  4J8W D;  3AZJ D;  1EQZ A;  2Y2H A;  5B32 D;  3A6N C;  2Y2I A;  1P3B B;  3F6T A;  1M19 D;  1AOI B;  4KHA A;  3B0D B;  5AV8 A;  4YS3 B;  4KGC D;  3NQJ A;  3VH5 W;  3AZI C;  4J8U A;  3O62 C;  4J8W C;  3UT9 B;  3UTA A;  3AZJ C;  1KX4 A;  5B32 C;  2PYO A;  3AZG B;  3MGP D;  4Z66 B;  5B1M D;  5BS7 C;  3MVD B;  5B40 A;  3REJ D;  2CV5 A;  5AVB C;  3REK A;  4Z2M H;  1H3O B;  4KGC C; 
#chains in the Genus database with same CATH homology
 5GXQ A;  2NQB B;  2F8N A;  5JRG C;  5CP6 B;  3R45 B;  4ZUX D;  2RIQ A;  5KDM A;  4H9Q A;  5AV9 C;  1F1E A;  4NE6 A;  4EO5 C;  5B0Y A;  1N1J B;  3X1V B;  4LD9 C;  1P3P D;  1PZR A;  5B24 D;  4XUJ C;  3LEL D;  3UTB D;  2IO5 B;  4ZUX C;  1P3G D;  2NZD C;  1WWI A;  1U35 A;  5B1L C;  3VH5 A;  1P3P C;  3C1B A;  1M18 B;  1BH9 B;  1KX3 A;  1T3U A;  3LEL C;  2BYK A;  3UTB C;  1JFI B;  1BH8 A;  1P3M D;  1P3I D;  3FDD A;  4H9N A;  1P3O B;  3KSY A;  3WA9 B;  5GT0 B;  3B6F A;  3W96 B;  3X1U D;  5B24 A;  3A6N B;  2Y2J A;  1P3I C;  4CAY B;  1P3G A;  2VQR A;  3AZF D;  5AY8 C;  4WU9 C;  2YFV B;  2LY8 A;  3AZI B;  3O62 B;  4J8W B;  3AZJ B;  3AZH C;  5B32 B;  3AZE C;  2F8N H;  1Z2C B;  5AVB B;  1M19 B;  3AZF C;  2Y2K A;  1HQ3 A;  2JE5 A;  3NQU A;  3LJA D;  4KGC B;  5DNM A;  4J8V C;  5JRG B;  5AV6 A;  3WTP A;  3MGR C;  5AV9 B;  3AN2 A;  4EO5 B;  2BG1 A;  4WU8 C;  3LJA C;  5B0Z A;  4LD9 B;  3AZK D;  3LZ0 D;  3X1T C;  4XUJ B;  4WNN B;  4ZUX B;  2NZD B;  1KX5 D;  5B1L B;  5B33 C;  2F8N G;  1P3P B;  1P3F A;  5B2I A;  3AZM D;  5AV5 D;  3REH A;  3LZ0 C;  5B32 G;  4UUZ B;  3LEL B;  3UTB B;  1M1A C;  3W99 A;  2FJ7 D;  1KU5 A;  1KX5 C;  2HIO C;  3AZL D;  1ID3 A;  5C3I C;  4DRB A;  4XZQ D;  3LZ1 D;  3H0L C;  4Z5T D;  1P3M B;  3KXB A;  1P3I B;  2XD1 A;  4NE3 A;  5CPI D;  1P3A D;  5E5A A;  4AWL C;  3AZL C;  3WKJ D;  5AY8 B;  3C1C D;  4X23 A;  1S32 C;  5CPK D;  3B6G B;  5AV5 A;  4XZQ C;  3AZH B;  4Z5T C;  1P34 A;  3AZE B;  2ZM5 A;  1F66 A;  4JJN D;  3VH5 T;  4QLC A;  3REL A;  4R8P A;  3AZF B;  4J8V B;  5CPK C;  5GT3 D;  5BNX A;  3AFA C;  4ZBJ C;  3KWQ A;  3MGR B;  5CPI A;  5AV8 D;  1TAF A;  4WU8 B;  3LJA B;  3WTP E;  4J8X C;  4LD9 D;  4J8U D;  5GT3 C;  3UTA D;  1EQZ C;  5G49 B;  3X1T B;  4WV4 B;  4KUD C;  4WJ3 C;  5JA4 B;  5B40 D;  3WAA A;  3MGQ A;  2CV5 D;  3UT9 A;  1P3O C;  3REK D;  5B33 B;  4WZS B;  1R4V A;  4J8U C;  3AZG A;  3AZK B;  3UTA C;  1KX4 C;  3LZ0 B;  2PYO C;  3A1I A;  1M1A B;  3B6G A;  5BNV A;  1H3O A;  5B40 C;  2Y2P A;  1KX5 B;  2HIO B;  5B0Y D;  3REK C;  5GXQ C;  5CP6 A;  3W97 C;  3EPJ A;  3AV2 D;  3VH6 W;  5C3I B;  1N1J A;  4E44 A;  4NFT A;  5B0Y C;  1U35 D;  4AWL B;  3AZL B;  1M19 C;  3C1B D;  1S32 B;  3IP4 C;  5GSU D;  5CHL B;  1KX3 D;  4XZQ B;  3V9R B;  4H9R A;  4Z5T B;  2BYM A;  3MGP C;  5B31 A;  5B1M C;  3REJ C;  1TZY A;  1P3L A;  3W98 A;  1BH9 A;  2DQN C;  3B6F D;  5CPK B;  3AYW A;  5B2J D;  1ZLA A;  3AFA B;  3AV2 A;  4ZBJ B;  3WA9 A;  2UWX A;  5GT0 A;  4UPK A;  1ULY A;  4H9S C;  4H9P A;  3VH6 A;  4J8X B;  2Y2L A;  5GT3 B;  1EQZ B;  4Z2M G;  5B24 C;  5GSU A;  4KUD B;  3X1S A;  1P3G C;  3EPL A;  4YM6 A;  1HQ3 D;  3NQJ B;  4J8U B;  5DNM D;  3UTA B;  5AVC D;  1KX4 B;  5AV6 D;  2PYO B;  5B2J A;  5AVB A;  3AV1 A;  3WTP D;  4M6B A;  5B40 B;  1P3M C;  3AN2 D;  3EPK A;  3TU4 A;  3REK B;  1HQ3 C;  5B0Z D;  5GXQ B;  4DQY B;  3W97 B;  5DNM C;  2FFF B;  2F8N B;  5AV9 A;  5AV6 C;  2YFW B;  2Y2M A;  3X1U C;  3WTP C;  5BO0 B;  5KDM B;  5B0Y B;  1B6W A;  1P3F D;  5DNN A;  2Y2N A;  5B2I D;  2NZD A;  3REH D;  5AVC A;  3AZN A;  3W99 D;  3MGP B;  5B1M B;  3REJ B;  1ID3 D;  3B0C T;  5B2I C;  3REH C;  1A7W A;  3MNN D;  2BYK B;  3W99 C;  2HUE C;  1BH8 B;  3KXB D;  5E5A D;  1ID3 C;  5F99 A;  4X23 D;  3AZK C;  5B24 B;  1P3K A;  1P34 D;  5AY8 A;  4WU9 A;  1P3G B;  1F66 D;  4QLC D;  3REL D;  4R8P D;  4H9O A;  4X23 C;  3AZH A;  3AZM C;  5AV5 C;  3AZE A;  1P34 C;  2DF4 C;  3MNN A;  3B0B A;  3KWQ D;  2FJ7 C;  3KUY D;  2ARO A;  1HQ3 B;  3NQU B;  2ZY3 A;  5DNM B;  3MGR A;  5AV6 B;  3X1U B;  3LZ1 C;  1AOI D;  3WTP B;  4YS3 D;  3WAA D;  3MGQ D;  3UT9 D;  5CPJ A;  5CPI C;  1P3A C;  3X1T A;  3VH6 T;  3WKJ C;  3C1C C;  3REI A;  3AZG D;  4G91 C;  3MGS A;  3B6G D;  3WAA C;  3MGQ C;  2JSS A;  5FUG B;  2NQB D;  4JJN C;  5BT1 D;  3KUY A;  5CP6 D;  5B2I B;  1M1A A;  3REH B;  4CSR B;  2HIO A;  1P3B A;  2G5I C;  3W99 B;  2HUE B;  1AOI A;  4YS3 A;  1ID3 B;  5AV8 C;  4Z66 A;  3MVD A;  3W98 D;  5B31 D;  2Y2Q A;  1P3L D;  1TZY D;  1M18 D;  2CV5 C;  2NQB A;  4X23 B;  3AZM B;  5AV5 B;  3AYW D;  3R45 A;  1ZLA D;  1P34 B;  2J8P A;  3A1K A;  3EG5 B;  3WA9 D;  3W98 C;  5GT0 D;  1P3L C;  1TZY C;  3X1V A;  2FJ7 B;  3A6N D;  3AYW C;  1ZLA C;  3AV2 C;  2ZY2 A;  3LZ1 B;  3X1S D;  4YM6 D;  4J8X A;  3AZI D;  5CPI B;  1U35 C;  1P3A B;  1TAF B;  1M18 A;  1JFI A;  3C1B C;  3WKJ B;  3C1C B;  4KUD A;  4G91 B;  5GSU C;  1KX3 C;  5AVB D;  1P3O A;  3AV1 D;  3X1S C;  3WAA B;  3MGQ B;  4YM6 C;  3TU4 D;  4JJN B;  3W96 A;  5JRG D;  3B6F C;  3A6N A;  5AV9 D;  5B2J C;  4CAY A;  3AV1 C;  5BNV B;  3W97 A;  2YFV A;  3TU4 C;  4XUJ D;  3AZI A;  3O62 A;  4J8W A;  4G92 C;  3AZJ A;  2YFW A;  4KHA B;  5AV8 B;  5DNN D;  5B32 A;  5BO0 A;  2NZD D;  3AZN D;  5BS7 A;  5B1L D;  1M19 A;  4KGC A;  2CV5 B;  5DNN C;  2CWE A;  5JRG A;  3MGP A;  5AVC C;  5B1M A;  3REJ A;  3AZN C;  4H9R B;  1WWS A;  2BYM B;  3W98 B;  5B31 B;  1P3L B;  1TZY B;  1Q9C A;  4H9Q B;  3AN2 C;  4LD9 A;  5F99 D;  4XUJ A;  5B0Z C;  1W2E A;  4WNN A;  3AYW B;  1HTA A;  4ZUX A;  1ZLA B;  3AV2 B;  1P3K D;  4NE5 A;  5B1L A;  5AY8 D;  4H9S A;  4WU9 D;  2G5H C;  1P3P A;  5F99 C;  1U35 B;  3AZH D;  4H9P B;  2L5A A;  4UUZ A;  3LEL A;  3C1B B;  3UTB A;  1P3F C;  3AZE D;  1P3K C;  5GSU B;  1KX3 B;  3X1S B;  4YM6 B;  4H9N B;  3P5J B;  4J8V D;  2ARO D;  2XD5 A;  3B6F B;  3MGR D;  1P3M A;  1P3I A;  5B2J B;  3MNN C;  5B31 G;  3AV1 B;  2Y2O A;  4WU8 D;  2ZY4 A;  3KXB C;  5CPJ D;  3TU4 B;  2ARO C;  3X1T D;  5E5A C;  4G92 B;  3X1U A;  3REI D;  5B33 D;  3MGS D;  2W8S A;  3AZF A;  5CPJ C;  1F66 C;  4J8V A;  4QLC C;  3REL C;  4R8P C;  5DNN B;  3REI C;  1M1A D;  5AVC B;  3AZN B;  5FUG A;  2HIO D;  1P3B D;  3MGS C;  3KFU G;  4WU8 A;  3KWQ C;  3LJA A;  3AN2 B;  3KUY C;  4HGA C;  4CSR A;  3H0R C;  5G49 A;  5B0Z B;  2F8N K;  4Z66 D;  3MVD D;  5JA4 A;  1P3B C;  1AOI C;  5B33 A;  3B0D C;  4YS3 C;  1S32 D;  3AL0 C;  3UT9 C;  3AZK A;  5F99 B;  2JCH A;  3LZ0 A;  3H0M C;  2Y2G A;  2RVQ D;  1P3F B;  3AZG C;  4Z66 C;  3MVD C;  1P3K B;  1KX5 A;  3B6G C;  4WU9 B;  3X1V D;  3B0C W;  3AZM A;  3EPH A;  2NQB C;  4H9O B;  5BT1 C;  3AFA D;  2RVQ C;  5CP6 C;  4DRA A;  2FJ7 A;  3MNN B;  3AZL A;  3X1V C;  3KXB B;  4J8X D;  2ZY5 A;  1EQZ D;  2ARO B;  1S32 A;  5E5A B;  4XZQ A;  3V9R A;  3LZ1 A;  2IO5 C;  4KUD D;  4Z5T A;  1P3O D;  1P3A A;  5B31 C;  3C1C A;  5CPJ B;  1KX4 D;  1F66 B;  3WKJ A;  1M18 C;  5CPK A;  4QLC B;  3REL B;  4R8P B;  2PYO D;  3REI B;  3W96 D;  3AFA A;  1BFM A;  5BNX B;  3MGS B;  2F2A C;  1B67 A;  4JJN A;  3WA9 C;  5GXQ D;  3W97 D;  5GT0 C;  3KWQ B;  2F8N D;  4E45 A;  3KUY B;  4HGA B;  3W96 C;  5GT3 A;  3O62 D;  4J8W D;  3AZJ D;  1EQZ A;  2Y2H A;  5B32 D;  3A6N C;  2Y2I A;  1P3B B;  3F6T A;  1M19 D;  1AOI B;  4KHA A;  3B0D B;  5AV8 A;  4YS3 B;  4KGC D;  3NQJ A;  3VH5 W;  3AZI C;  4J8U A;  3O62 C;  4J8W C;  3UT9 B;  3UTA A;  3AZJ C;  1KX4 A;  5B32 C;  2PYO A;  3AZG B;  3MGP D;  4Z66 B;  5B1M D;  5BS7 C;  3MVD B;  5B40 A;  3REJ D;  2CV5 A;  5AVB C;  3REK A;  4Z2M H;  1H3O B;  4KGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...