1P3LD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 37
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lD00
3X1TD 4G92C 4KUDA 1P34B 2AROA 5AV9D 1U35C 3TU4D 1P3OD 5B1LB 3AV2B 4ZUXC 3AZJC 3A6NB 5BS7C 1P3MA 3AZMC 3LJAA 3AZHD 3B0BA 3NQUA 5F99D 1AOIC 1P3IB 2LY8A 4M6BA 4CSRB 3MVDB 3AYWD 5CPJA 2JSSA 5FUGB 5BT1D 2YFVB 1HTAA 4XZQC 3C1CC 5GXQB 1M19D 1B67A 5E5AA 3KWQC 3X1TB 3B0DB 5G49B 3REJD 3AZMD 1Q9CA 3UT9A 2F8ND 5B40C 5AV6D 4UUZA 3REIA 4R8PA 1KX3C 1ZLAC 5JA4B 4DRAA 3TU4B 5B1MA 1M1AD 2HIOD 3W99D 1KX4C 4KGCB 3AZND 2F8NB 2F8NH 5BO0A 3KUYC 3X1UA 4XZQA 2FJ7B 5B0ZC 3X1TC 5B1MD 5F99B 5GT3B 3UTAC 1P3OA 1M1AA 4X23C 5CPID 3O62B 3REJA 4J8XD 3WTPC 3W98A 1AOIA 2YFWB 4WU8C 5DNMD 4YM6C 4J8WD 2IO5C 3LZ1B 3KXBA 3REKA 4KUDB 5CPJD 3AZMB 5F99C 5GT0D 3UTAB 5GSUB 3A6NA 4QLCC 3R45B 5B0YB 1F1EA 1TAFA 3AFAC 4H9SA 4J8WB 3KXBB 5B33C 3B0CW 5B32G 1U35B 3X1UB 1P3PA 3WA9C 3B0CT 3AN2A 4YS3C 1P3LA 1P3AC 1P3GD 3O62A 2BYKA 4J8WC 3REJC 3TU4A 3C1BB 3W98D 5GSUC 4JJNC 4H9OA 5AV8B 4XZQB 4YS3B 3VH5W 1M1AC 4H9RA 3AZEB 5E5AB 3X1UC 4H9NB 4H9PB 5B2IC 3AZKD 3B6FC 5B32A 3WA9D 3KUYD 3AFAB 1S32D 5B0ZD 4H9PA 4WU9C 4UUZB 5AY8A 4H9RB 3AZEA 1P3BA 4KHAB 3VH6T 4WNNA 3WTPA 3W98C 3X1VB 3REID 4Z5TA 3KUYB 4G91C 3KWQA 3W96C 3MGRD 5CHLB 4YM6D 3C1CA 1KX4B 4LD9D 1JFIA 2PYOC 1S32C 1M18A 5GT3C 1P3KD 3MNNA 1WWSA 3B0DC 3LELD 4LD9B 1ID3B 1TZYD 3REIC 1KX3A 1BH9A 4Z2MH 2HUEC 3AZLA 1KU5A 4J8VB 3LZ1A 4ZUXA 3AZID 3AZJA 2NQBB 1F66D 1P3GC 1ZLAB 4CAYB 5B33B 4WNNB 4LD9C 1KX5C 1ID3D 3AV1D 5AVBA 1AOIB 1EQZD 3C1BC 3C1CB 3AZFD 1P3AB 2CV5A 1P3FB 1TZYC 1N1JA 3X1VA 3AV2D 4WU8B 5G49A 3MVDD 3KXBC 1KX5A 5B31C 3AZGD 4H9OB 1P3GA 4G92B 5B32B 4H9NA 5CP6C 1TZYA 1KX5B 3MGRC 2HIOB 5B33A 3W99B 3RELC 5AV8A 1F66B 1M18C 3MNND 3LJAB 4J8UA 5B2JA 1P34D 1TAFB 3WAAA 4J8VD 4ZBJB 3KXBD 5GT3D 1P3KC 3AZGC 3MVDA 4Z66B 3UTBB 2AROB 5B24A 5GXQC 4ZBJC 3B6GB 2RVQC 5CPKB 3R45A 1P3MB 1F66C 1R4VA 5AY8D 4X23A 3NQJA 4NE6A 4EO5C 4XZQD 5CPKD 5CPKA 1ID3C 3MGRB 3REHC 4NE5A 3WKJB 2HIOA 3AZFC 3W99A 5BO0B 5GT0B 5B24C 1KX3D 1BFMA 3WKJD 2NZDB 5GXQD 3AV2C 3MVDC 5B1LC 5DNMB 3V9RB 1P3ID 3AZNC 5GT3A 3O62C 5AY8C 1B6WA 3UT9B 2NZDD 3X1SA 1P3PC 5AV8D 5JRGB 5BNXA 5AVCB 3MGQC 3WTPD 3A6ND 3AZED 1P3BC 5GT0A 5AV5C 5B1LD 4J8VC 3LJAD 3AZHA 4AWLC 4WU9A 3AZGA 3X1VD 5B0YC 5DNMA 4QLCB 5B2IA 3LZ0D 5JRGC 4H9SC 4H9QA 5KDMA 1M18B 3NQUB 4XUJB 5AV9C 3MGSC 5B0YA 1P3FD 1BH9B 1P3LC 3LELB 1KX4A 5B1LA 3AZHC 2FJ7C 4WU9B 5JRGD 3LZ0C 3REHB 1JFIB 2F8NA 3UTBA 4H9QB 2NZDC 5JA4A 3W97D 3W97A 4R8PB 5C3IC 4YM6A 5B40B 3C1CD 3AZFB 4J8XA 4WU8A 5B40A 5GXQA 5AV6C 2YFVA 1P3BD 3LJAC 5DNND 5BNXB 5BS7A 5B0ZA 3REIB 2HIOC 3W99C 1KX4D 5B0YD 3AZKA 5CP6B 3UTBC 3UTAD 1U35A 3VH5A 1BH8B 4X23D 2CV5B 1S32B 5B1MC 1P3KB 3V9RA 2IO5B 5BNVA 5B31G 5GSUA 4JJNA 2BYKB 3UT9D 3AZMA 4WU8D 3LZ0A 5AVBB 5DNMC 1HQ3B 4J8XC 1ULYA 4XUJD 1M19A 5E5AC 1P3FC 1P3LD 3VH5T 3C1BD 5B32C 5KDMB 5GT0C 4J8VA 3MGSA 3W98B 2FJ7D 3UTBD 5B2JC 3MGQA 4QLCA 3MGSB 5B33D 4QLCD 3REKB 5F99A 3AFAD 1P3OB 2FJ7A 3MNNB 2L5AA 4WZSB 3AZKB 3REKD 1P3BB 1P3MD 3TU4C 3X1SD 4E45A 1P3AD 2F8NG 2HUEB 3WTPE 5AVCA 5BNVB 4JJNB 2AROD 5AV9A 3AZLC 5B2JB 3KWQB 5CP6D 5GSUD 4JJND 3AZGB 4KUDD 4KGCD 3X1TA 5AV5B 5AY8B 4YM6B 3AZFA 5B2ID 3AZKC 3MNNC 3X1UD 5DNNB 3AYWC 3REKC 5AVBD 3AZNA 3X1SC 4WU9D 5DNNA 4CSRA 1M19C 5AV5A 3W96A 3LZ1C 3AZLD 4NFTA 3MGPC 3UT9C 5B40D 4Z5TC 4ZUXB 3AZJB 2RVQD 4NE3A 2NQBA 1ZLAD 3W97B 4EO5B 4XUJC 5AV9B 4KGCC 3LELA 5E5AD 1HQ3D 5CPKC 2NZDA 3REHD 3MGPB 2PYOD 3B6GA 3VH6A 2PYOA 3B6GD 3REHA 1P3IA 3VH6W 5B2JD 4CAYA 1P34A 1M19B 3RELA 1HQ3A 3MGRA 4Z2MG 5CPIC 4Z66D 3NQJB 3MGPD 5B2IB 4Z5TD 2NQBC 1P3MC 2BYMB 1M1AB 1BH8A 3RELB 3AZIC 5AVCC 3AV1C 1EQZC 2AROC 1KX5D 2YFWA 3LZ0B 3REJB 5CPJC 4KUDC 2F8NK 4J8UB 3WAAB 3A6NC 3WA9B 5B31B 5CP6A 5AVBC 4KHAA 3WTPB 3W96B 4G91B 1H3OA 1TZYB 3AV1A 5B31A 1EQZA 4YS3D 5AVCD 3X1VC 4J8UD 3WAAD 1P3AA 5B1MB 3LZ1D 5FUGA 2CV5C 1P3LB 2CWEA 3X1SB 1H3OB 3AV1B 1EQZB 1HQ3C 4J8XB 3B6FB 3RELD 1P34C 1M18D 3MGSD 3B6FD 3B6GC 3C1BA 5AV6B 4X23B 1KX3B 4DRBA 4LD9A 5CPJB 3AV2A 3AN2B 4XUJA 4Z66C 2CV5D 1P3PB 5C3IB 3WKJA 4R8PC 1ZLAA 3AZIB 2NQBD 4AWLB 5CPIA 3W96D 3MGQB 1ID3A 3UTAA 1U35D 1P3OC 3W97C 5CPIB 1S32A 1F66A 3KUYA 4E44A 4ZUXD 3AZIA 3AZJD 5B24B 2PYOB 3WKJC 3MGPA 3LELC 4HGAC 4KGCA 5B24D 4Z66A 1A7WA 4R8PD 1WWIA 3AZNB 5AV6A 5DNNC 1P3KA 1P3IC 3KSYA 4WV4B 3WAAC 4Z5TB 3O62D 4J8UC 4HGAB 5BT1C 3B6FA 3AZHB 3AN2D 1N1JB 5AV8C 1P3PD 5B0ZB 3AYWA 3KWQD 3AFAA 3AYWB 1P3GB 5JRGA 5AV5D 3MGQD 3AZEC 4YS3A 5B31D 1P3FA 3WA9A 5B32D 4J8WA 2BYMA 3AZLB 3AN2C 1AOID
chains in the Genus database with same CATH superfamily
3X1TD 4G92C 4KUDA 1P34B 2AROA 5AV9D 1U35C 3TU4D 1P3OD 5B1LB 3AV2B 4ZUXC 3AZJC 3A6NB 5BS7C 1P3MA 2G5HC 3AZMC 3LJAA 3AZHD 3B0BA 3NQUA 5F99D 1AOIC 1P3IB 2Y2IA 2LY8A 4M6BA 4CSRB 3MVDB 3AYWD 5CPJA 2JSSA 5FUGB 5BT1D 3FDDA 2YFVB 1HTAA 4XZQC 3C1CC 2Y2LA 5GXQB 1M19D 1B67A 5E5AA 3KWQC 3X1TB 3B0DB 5G49B 3REJD 3AZMD 1Q9CA 3UT9A 2F8ND 5B40C 5AV6D 4UUZA 3REIA 4R8PA 1KX3C 1ZLAC 5JA4B 4DRAA 3TU4B 1Z2CB 5B1MA 1M1AD 2HIOD 3W99D 1KX4C 4KGCB 3AZND 2F8NB 2Y2QA 2ZY4A 5BO0A 2F8NH 3KUYC 3X1UA 4XZQA 2FJ7B 5B0ZC 3X1TC 5B1MD 5F99B 5GT3B 3UTAC 1P3OA 1M1AA 4X23C 2ZM5A 4DQYB 5CPID 3O62B 3REJA 4J8XD 3WTPC 3W98A 1AOIA 2YFWB 4WU8C 5DNMD 4YM6C 4J8WD 3EPKA 2IO5C 3LZ1B 3KXBA 3REKA 4KUDB 5CPJD 3AZMB 5F99C 5GT0D 3UTAB 5GSUB 3A6NA 4QLCC 3R45B 5B0YB 1F1EA 1TAFA 3AFAC 4H9SA 4J8WB 3KXBB 5B33C 3B0CW 5B32G 1U35B 3EPHA 3X1UB 1P3PA 3WA9C 3B0CT 3AN2A 4YS3C 1P3LA 1P3AC 1P3GD 3O62A 2BYKA 4J8WC 3REJC 3TU4A 3C1BB 3W98D 5GSUC 4JJNC 4H9OA 5AV8B 4XZQB 4YS3B 3VH5W 1M1AC 2ZY3A 4H9RA 3AZEB 5E5AB 3X1UC 4H9NB 4H9PB 5B2IC 3AZKD 3B6FC 5B32A 3WA9D 3KUYD 3AFAB 1S32D 5B0ZD 4H9PA 4WU9C 4UUZB 5AY8A 4H9RB 3AZEA 1P3BA 4KHAB 3VH6T 4WNNA 3WTPA 3W98C 3X1VB 3REID 4Z5TA 3KUYB 4G91C 4UPKA 3KWQA 3W96C 3MGRD 5CHLB 4YM6D 3C1CA 1KX4B 4LD9D 2Y2NA 1JFIA 2PYOC 1S32C 1M18A 5GT3C 1P3KD 3MNNA 1WWSA 3EPLA 3B0DC 3LELD 4LD9B 2Y2JA 1ID3B 1TZYD 3REIC 1KX3A 1BH9A 4Z2MH 2HUEC 3AZLA 1KU5A 4J8VB 3LZ1A 4ZUXA 3AZID 3AZJA 2NQBB 1F66D 1P3GC 1ZLAB 4CAYB 5B33B 4WNNB 4LD9C 1KX5C 1ID3D 3AV1D 5AVBA 1AOIB 1EQZD 3C1BC 2J8PA 3C1CB 3AZFD 1P3AB 2G5IC 2CV5A 1P3FB 1TZYC 3F6TA 1N1JA 3X1VA 3AV2D 4WU8B 2FFFB 5G49A 3MVDD 3KXBC 1KX5A 5B31C 3AZGD 4H9OB 1P3GA 4G92B 5B32B 4H9NA 5CP6C 1TZYA 1KX5B 3MGRC 2HIOB 5B33A 3W99B 3RELC 5AV8A 1F66B 1M18C 3MNND 3LJAB 4J8UA 1T3UA 3H0RC 1TAFB 5B2JA 4J8VD 1P34D 3WAAA 4ZBJB 3KXBD 5GT3D 1P3KC 3AZGC 3MVDA 4Z66B 3UTBB 2ZY2A 2AROB 5B24A 5GXQC 4ZBJC 3B6GB 2RVQC 5CPKB 3R45A 1P3MB 1F66C 1R4VA 5AY8D 4X23A 3NQJA 4NE6A 4EO5C 4XZQD 5CPKD 5CPKA 1ID3C 3MGRB 3REHC 4NE5A 3WKJB 2HIOA 3AZFC 3W99A 5BO0B 5GT0B 5B24C 1KX3D 1BFMA 3WKJD 2NZDB 5GXQD 3AV2C 3MVDC 5B1LC 5DNMB 3V9RB 1P3ID 3AZNC 5GT3A 3O62C 5AY8C 1B6WA 3UT9B 2NZDD 3X1SA 1P3PC 5AV8D 5JRGB 5BNXA 3H0LC 5AVCB 2UWXA 3MGQC 3WTPD 3A6ND 3AZED 1P3BC 5GT0A 5AV5C 5B1LD 4J8VC 3LJAD 3AZHA 4AWLC 2RIQA 4WU9A 3AZGA 2XD1A 3X1VD 5B0YC 5DNMA 4QLCB 5B2IA 5JRGC 3LZ0D 4H9SC 4H9QA 5KDMA 2Y2MA 1M18B 2F2AC 3NQUB 4XUJB 5AV9C 3MGSC 5B0YA 1P3FD 1BH9B 1P3LC 3LELB 1KX4A 5B1LA 3AZHC 2FJ7C 4WU9B 5JRGD 3LZ0C 3REHB 3KFUG 1JFIB 2F8NA 3UTBA 4H9QB 2DF4C 2W8SA 2NZDC 5JA4A 3W97D 3W97A 4R8PB 5C3IC 4YM6A 5B40B 3C1CD 3AZFB 4J8XA 4WU8A 5B40A 3EPJA 5GXQA 5AV6C 2YFVA 1P3BD 3P5JB 3LJAC 2Y2GA 5DNND 5BNXB 5BS7A 5B0ZA 3REIB 2HIOC 3W99C 1KX4D 5B0YD 3AZKA 5CP6B 3UTBC 3UTAD 1U35A 3VH5A 1BH8B 4X23D 2CV5B 1S32B 5B1MC 1P3KB 3V9RA 2IO5B 5BNVA 5B31G 5GSUA 4JJNA 2BYKB 3UT9D 3AZMA 4WU8D 3LZ0A 5AVBB 5DNMC 1HQ3B 4J8XC 1ULYA 4XUJD 1M19A 5E5AC 1P3FC 1P3LD 3VH5T 3C1BD 5B32C 5KDMB 5GT0C 1W2EA 3MGSA 4J8VA 3W98B 2FJ7D 3UTBD 5B2JC 3MGQA 4QLCA 2JE5A 3MGSB 5B33D 4QLCD 3REKB 5F99A 3AFAD 1P3OB 2ZY5A 2FJ7A 3MNNB 2L5AA 4WZSB 3AZKB 3REKD 1P3BB 1P3MD 3TU4C 3X1SD 4E45A 1P3AD 2F8NG 2HUEB 3WTPE 5AVCA 5BNVB 4JJNB 2AROD 5AV9A 3AZLC 5B2JB 3KWQB 5CP6D 5GSUD 4JJND 3AZGB 4KUDD 4KGCD 3X1TA 5AV5B 5AY8B 4YM6B 3AZFA 5B2ID 3AZKC 3MNNC 3X1UD 5DNNB 3AYWC 3REKC 5AVBD 3A1IA 3AZNA 3X1SC 4WU9D 5DNNA 4CSRA 1M19C 5AV5A 3W96A 3LZ1C 3AZLD 4NFTA 3MGPC 3UT9C 5B40D 4Z5TC 4ZUXB 3AZJB 2RVQD 4NE3A 2NQBA 1ZLAD 4WJ3C 3W97B 4EO5B 3H0MC 4XUJC 5AV9B 4KGCC 3LELA 5E5AD 1HQ3D 5CPKC 2BG1A 2NZDA 2XD5A 3REHD 3MGPB 2PYOD 3B6GA 3VH6A 2PYOA 3B6GD 2Y2HA 3REHA 1P3IA 3VH6W 5B2JD 4CAYA 1P34A 1M19B 3RELA 1HQ3A 3MGRA 4Z2MG 5CPIC 4Z66D 3NQJB 3MGPD 5B2IB 4Z5TD 2NQBC 1P3MC 2BYMB 1M1AB 1BH8A 3RELB 3AZIC 5AVCC 3AV1C 1EQZC 2AROC 1KX5D 2YFWA 3LZ0B 3A1KA 3REJB 5CPJC 3AL0C 4KUDC 2F8NK 4J8UB 3WAAB 3A6NC 3WA9B 5B31B 5CP6A 5AVBC 2Y2PA 4KHAA 3WTPB 3W96B 4G91B 1H3OA 1TZYB 3AV1A 5B31A 1EQZA 4YS3D 5AVCD 3X1VC 4J8UD 3WAAD 1P3AA 5B1MB 3LZ1D 5FUGA 2CV5C 1P3LB 2CWEA 3X1SB 1H3OB 3AV1B 1EQZB 1PZRA 1HQ3C 4J8XB 3B6FB 3RELD 1P34C 1M18D 3MGSD 3B6FD 3B6GC 3C1BA 5AV6B 4X23B 1KX3B 4DRBA 4LD9A 5CPJB 3AV2A 3AN2B 4XUJA 4Z66C 2CV5D 1P3PB 5C3IB 3WKJA 2JCHA 4R8PC 1ZLAA 3AZIB 2NQBD 4AWLB 5CPIA 3W96D 2VQRA 2Y2OA 3MGQB 1ID3A 3UTAA 1U35D 1P3OC 3W97C 5CPIB 3IP4C 1S32A 1F66A 3KUYA 4E44A 4ZUXD 3AZIA 3AZJD 5B24B 2PYOB 3WKJC 3MGPA 3LELC 4HGAC 4KGCA 5B24D 4Z66A 1A7WA 4R8PD 1WWIA 3AZNB 5AV6A 5DNNC 1P3KA 2DQNC 1P3IC 3KSYA 4WV4B 3WAAC 4Z5TB 3O62D 4J8UC 4HGAB 5BT1C 3B6FA 3AZHB 3AN2D 1N1JB 5AV8C 1P3PD 3EG5B 5B0ZB 3AYWA 3KWQD 3AFAA 3AYWB 1P3GB 5JRGA 5AV5D 3MGQD 3AZEC 2Y2KA 4YS3A 5B31D 1P3FA 3WA9A 5B32D 4J8WA 2BYMA 3AZLB 3AN2C 1AOID
chains in the Genus database with same CATH topology
3X1TD 4G92C 4KUDA 1P34B 2AROA 5AV9D 1U35C 3TU4D 1P3OD 5B1LB 3AV2B 4ZUXC 3AZJC 3A6NB 5BS7C 1P3MA 2G5HC 3AZMC 3LJAA 3AZHD 3B0BA 3NQUA 5F99D 1AOIC 1P3IB 2Y2IA 2LY8A 4M6BA 4CSRB 3MVDB 3AYWD 5CPJA 2JSSA 5FUGB 5BT1D 3FDDA 2YFVB 1HTAA 4XZQC 3C1CC 2Y2LA 5GXQB 1M19D 1B67A 5E5AA 3KWQC 3X1TB 3B0DB 5G49B 3REJD 3AZMD 1Q9CA 3UT9A 2F8ND 5B40C 5AV6D 4UUZA 3REIA 4R8PA 1KX3C 1ZLAC 5JA4B 4DRAA 3TU4B 1Z2CB 5B1MA 1M1AD 2HIOD 3W99D 1KX4C 4KGCB 3AZND 2F8NB 2Y2QA 2ZY4A 5BO0A 2F8NH 3KUYC 3X1UA 4XZQA 2FJ7B 5B0ZC 3X1TC 5B1MD 5F99B 5GT3B 3UTAC 1P3OA 1M1AA 4X23C 2ZM5A 4DQYB 5CPID 3O62B 3REJA 4J8XD 3WTPC 3W98A 1AOIA 2YFWB 4WU8C 5DNMD 4YM6C 4J8WD 3EPKA 2IO5C 3LZ1B 3KXBA 3REKA 4KUDB 5CPJD 3AZMB 5F99C 5GT0D 3UTAB 5GSUB 3A6NA 4QLCC 3R45B 5B0YB 1F1EA 1TAFA 3AFAC 4H9SA 4J8WB 3KXBB 5B33C 3B0CW 5B32G 1U35B 3EPHA 3X1UB 1P3PA 3WA9C 3B0CT 3AN2A 4YS3C 1P3LA 1P3AC 1P3GD 3O62A 2BYKA 4J8WC 3REJC 3TU4A 3C1BB 3W98D 5GSUC 4JJNC 4H9OA 5AV8B 4XZQB 4YS3B 3VH5W 1M1AC 2ZY3A 4H9RA 3AZEB 5E5AB 3X1UC 4H9NB 4H9PB 5B2IC 3AZKD 3B6FC 5B32A 3WA9D 3KUYD 3AFAB 1S32D 5B0ZD 4H9PA 4WU9C 4UUZB 5AY8A 4H9RB 3AZEA 1P3BA 4KHAB 3VH6T 4WNNA 3WTPA 3W98C 3X1VB 3REID 4Z5TA 3KUYB 4G91C 4UPKA 3KWQA 3W96C 3MGRD 5CHLB 4YM6D 3C1CA 1KX4B 4LD9D 2Y2NA 1JFIA 2PYOC 1S32C 1M18A 5GT3C 1P3KD 3MNNA 1WWSA 3EPLA 3B0DC 3LELD 4LD9B 2Y2JA 1ID3B 1TZYD 3REIC 1KX3A 1BH9A 4Z2MH 2HUEC 3AZLA 1KU5A 4J8VB 3LZ1A 4ZUXA 3AZID 3AZJA 2NQBB 1F66D 1P3GC 1ZLAB 4CAYB 5B33B 4WNNB 4LD9C 1KX5C 1ID3D 3AV1D 5AVBA 1AOIB 1EQZD 3C1BC 2J8PA 3C1CB 3AZFD 1P3AB 2G5IC 2CV5A 1P3FB 1TZYC 3F6TA 1N1JA 3X1VA 3AV2D 4WU8B 2FFFB 5G49A 3MVDD 3KXBC 1KX5A 5B31C 3AZGD 4H9OB 1P3GA 4G92B 5B32B 4H9NA 5CP6C 1TZYA 1KX5B 3MGRC 2HIOB 5B33A 3W99B 3RELC 5AV8A 1F66B 1M18C 3MNND 3LJAB 4J8UA 1T3UA 3H0RC 1TAFB 5B2JA 4J8VD 1P34D 3WAAA 4ZBJB 3KXBD 5GT3D 1P3KC 3AZGC 3MVDA 4Z66B 3UTBB 2ZY2A 2AROB 5B24A 5GXQC 4ZBJC 3B6GB 2RVQC 5CPKB 3R45A 1P3MB 1F66C 1R4VA 5AY8D 4X23A 3NQJA 4NE6A 4EO5C 4XZQD 5CPKD 5CPKA 1ID3C 3MGRB 3REHC 4NE5A 3WKJB 2HIOA 3AZFC 3W99A 5BO0B 5GT0B 5B24C 1KX3D 1BFMA 3WKJD 2NZDB 5GXQD 3AV2C 3MVDC 5B1LC 5DNMB 3V9RB 1P3ID 3AZNC 5GT3A 3O62C 5AY8C 1B6WA 3UT9B 2NZDD 3X1SA 1P3PC 5AV8D 5JRGB 5BNXA 3H0LC 5AVCB 2UWXA 3MGQC 3WTPD 3A6ND 3AZED 1P3BC 5GT0A 5AV5C 5B1LD 4J8VC 3LJAD 3AZHA 4AWLC 2RIQA 4WU9A 3AZGA 2XD1A 3X1VD 5B0YC 5DNMA 4QLCB 5B2IA 5JRGC 3LZ0D 4H9SC 4H9QA 5KDMA 2Y2MA 1M18B 2F2AC 3NQUB 4XUJB 5AV9C 3MGSC 5B0YA 1P3FD 1BH9B 1P3LC 3LELB 1KX4A 5B1LA 3AZHC 2FJ7C 4WU9B 5JRGD 3LZ0C 3REHB 3KFUG 1JFIB 2F8NA 3UTBA 4H9QB 2DF4C 2W8SA 2NZDC 5JA4A 3W97D 3W97A 4R8PB 5C3IC 4YM6A 5B40B 3C1CD 3AZFB 4J8XA 4WU8A 5B40A 3EPJA 5GXQA 5AV6C 2YFVA 1P3BD 3P5JB 3LJAC 2Y2GA 5DNND 5BNXB 5BS7A 5B0ZA 3REIB 2HIOC 3W99C 1KX4D 5B0YD 3AZKA 5CP6B 3UTBC 3UTAD 1U35A 3VH5A 1BH8B 4X23D 2CV5B 1S32B 5B1MC 1P3KB 3V9RA 2IO5B 5BNVA 5B31G 5GSUA 4JJNA 2BYKB 3UT9D 3AZMA 4WU8D 3LZ0A 5AVBB 5DNMC 1HQ3B 4J8XC 1ULYA 4XUJD 1M19A 5E5AC 1P3FC 1P3LD 3VH5T 3C1BD 5B32C 5KDMB 5GT0C 1W2EA 3MGSA 4J8VA 3W98B 2FJ7D 3UTBD 5B2JC 3MGQA 4QLCA 2JE5A 3MGSB 5B33D 4QLCD 3REKB 5F99A 3AFAD 1P3OB 2ZY5A 2FJ7A 3MNNB 2L5AA 4WZSB 3AZKB 3REKD 1P3BB 1P3MD 3TU4C 3X1SD 4E45A 1P3AD 2F8NG 2HUEB 3WTPE 5AVCA 5BNVB 4JJNB 2AROD 5AV9A 3AZLC 5B2JB 3KWQB 5CP6D 5GSUD 4JJND 3AZGB 4KUDD 4KGCD 3X1TA 5AV5B 5AY8B 4YM6B 3AZFA 5B2ID 3AZKC 3MNNC 3X1UD 5DNNB 3AYWC 3REKC 5AVBD 3A1IA 3AZNA 3X1SC 4WU9D 5DNNA 4CSRA 1M19C 5AV5A 3W96A 3LZ1C 3AZLD 4NFTA 3MGPC 3UT9C 5B40D 4Z5TC 4ZUXB 3AZJB 2RVQD 4NE3A 2NQBA 1ZLAD 4WJ3C 3W97B 4EO5B 3H0MC 4XUJC 5AV9B 4KGCC 3LELA 5E5AD 1HQ3D 5CPKC 2BG1A 2NZDA 2XD5A 3REHD 3MGPB 2PYOD 3B6GA 3VH6A 2PYOA 3B6GD 2Y2HA 3REHA 1P3IA 3VH6W 5B2JD 4CAYA 1P34A 1M19B 3RELA 1HQ3A 3MGRA 4Z2MG 5CPIC 4Z66D 3NQJB 3MGPD 5B2IB 4Z5TD 2NQBC 1P3MC 2BYMB 1M1AB 1BH8A 3RELB 3AZIC 5AVCC 3AV1C 1EQZC 2AROC 1KX5D 2YFWA 3LZ0B 3A1KA 3REJB 5CPJC 3AL0C 4KUDC 2F8NK 4J8UB 3WAAB 3A6NC 3WA9B 5B31B 5CP6A 5AVBC 2Y2PA 4KHAA 3WTPB 3W96B 4G91B 1H3OA 1TZYB 3AV1A 5B31A 1EQZA 4YS3D 5AVCD 3X1VC 4J8UD 3WAAD 1P3AA 5B1MB 3LZ1D 5FUGA 2CV5C 1P3LB 2CWEA 3X1SB 1H3OB 3AV1B 1EQZB 1PZRA 1HQ3C 4J8XB 3B6FB 3RELD 1P34C 1M18D 3MGSD 3B6FD 3B6GC 3C1BA 5AV6B 4X23B 1KX3B 4DRBA 4LD9A 5CPJB 3AV2A 3AN2B 4XUJA 4Z66C 2CV5D 1P3PB 5C3IB 3WKJA 2JCHA 4R8PC 1ZLAA 3AZIB 2NQBD 4AWLB 5CPIA 3W96D 2VQRA 2Y2OA 3MGQB 1ID3A 3UTAA 1U35D 1P3OC 3W97C 5CPIB 3IP4C 1S32A 1F66A 3KUYA 4E44A 4ZUXD 3AZIA 3AZJD 5B24B 2PYOB 3WKJC 3MGPA 3LELC 4HGAC 4KGCA 5B24D 4Z66A 1A7WA 4R8PD 1WWIA 3AZNB 5AV6A 5DNNC 1P3KA 2DQNC 1P3IC 3KSYA 4WV4B 3WAAC 4Z5TB 3O62D 4J8UC 4HGAB 5BT1C 3B6FA 3AZHB 3AN2D 1N1JB 5AV8C 1P3PD 3EG5B 5B0ZB 3AYWA 3KWQD 3AFAA 3AYWB 1P3GB 5JRGA 5AV5D 3MGQD 3AZEC 2Y2KA 4YS3A 5B31D 1P3FA 3WA9A 5B32D 4J8WA 2BYMA 3AZLB 3AN2C 1AOID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T D;  4G92 C;  4KUD A;  1P34 B;  2ARO A;  5AV9 D;  1U35 C;  3TU4 D;  1P3O D;  5B1L B;  3AV2 B;  4ZUX C;  3AZJ C;  3A6N B;  5BS7 C;  1P3M A;  3AZM C;  3LJA A;  3AZH D;  3B0B A;  3NQU A;  5F99 D;  1AOI C;  1P3I B;  2LY8 A;  4M6B A;  4CSR B;  3MVD B;  3AYW D;  5CPJ A;  2JSS A;  5FUG B;  5BT1 D;  2YFV B;  1HTA A;  4XZQ C;  3C1C C;  5GXQ B;  1M19 D;  1B67 A;  5E5A A;  3KWQ C;  3X1T B;  3B0D B;  5G49 B;  3REJ D;  3AZM D;  1Q9C A;  3UT9 A;  2F8N D;  5B40 C;  5AV6 D;  4UUZ A;  3REI A;  4R8P A;  1KX3 C;  1ZLA C;  5JA4 B;  4DRA A;  3TU4 B;  5B1M A;  1M1A D;  2HIO D;  3W99 D;  1KX4 C;  4KGC B;  3AZN D;  2F8N B;  2F8N H;  5BO0 A;  3KUY C;  3X1U A;  4XZQ A;  2FJ7 B;  5B0Z C;  3X1T C;  5B1M D;  5F99 B;  5GT3 B;  3UTA C;  1P3O A;  1M1A A;  4X23 C;  5CPI D;  3O62 B;  3REJ A;  4J8X D;  3WTP C;  3W98 A;  1AOI A;  2YFW B;  4WU8 C;  5DNM D;  4YM6 C;  4J8W D;  2IO5 C;  3LZ1 B;  3KXB A;  3REK A;  4KUD B;  5CPJ D;  3AZM B;  5F99 C;  5GT0 D;  3UTA B;  5GSU B;  3A6N A;  4QLC C;  3R45 B;  5B0Y B;  1F1E A;  1TAF A;  3AFA C;  4H9S A;  4J8W B;  3KXB B;  5B33 C;  3B0C W;  5B32 G;  1U35 B;  3X1U B;  1P3P A;  3WA9 C;  3B0C T;  3AN2 A;  4YS3 C;  1P3L A;  1P3A C;  1P3G D;  3O62 A;  2BYK A;  4J8W C;  3REJ C;  3TU4 A;  3C1B B;  3W98 D;  5GSU C;  4JJN C;  4H9O A;  5AV8 B;  4XZQ B;  4YS3 B;  3VH5 W;  1M1A C;  4H9R A;  3AZE B;  5E5A B;  3X1U C;  4H9N B;  4H9P B;  5B2I C;  3AZK D;  3B6F C;  5B32 A;  3WA9 D;  3KUY D;  3AFA B;  1S32 D;  5B0Z D;  4H9P A;  4WU9 C;  4UUZ B;  5AY8 A;  4H9R B;  3AZE A;  1P3B A;  4KHA B;  3VH6 T;  4WNN A;  3WTP A;  3W98 C;  3X1V B;  3REI D;  4Z5T A;  3KUY B;  4G91 C;  3KWQ A;  3W96 C;  3MGR D;  5CHL B;  4YM6 D;  3C1C A;  1KX4 B;  4LD9 D;  1JFI A;  2PYO C;  1S32 C;  1M18 A;  5GT3 C;  1P3K D;  3MNN A;  1WWS A;  3B0D C;  3LEL D;  4LD9 B;  1ID3 B;  1TZY D;  3REI C;  1KX3 A;  1BH9 A;  4Z2M H;  2HUE C;  3AZL A;  1KU5 A;  4J8V B;  3LZ1 A;  4ZUX A;  3AZI D;  3AZJ A;  2NQB B;  1F66 D;  1P3G C;  1ZLA B;  4CAY B;  5B33 B;  4WNN B;  4LD9 C;  1KX5 C;  1ID3 D;  3AV1 D;  5AVB A;  1AOI B;  1EQZ D;  3C1B C;  3C1C B;  3AZF D;  1P3A B;  2CV5 A;  1P3F B;  1TZY C;  1N1J A;  3X1V A;  3AV2 D;  4WU8 B;  5G49 A;  3MVD D;  3KXB C;  1KX5 A;  5B31 C;  3AZG D;  4H9O B;  1P3G A;  4G92 B;  5B32 B;  4H9N A;  5CP6 C;  1TZY A;  1KX5 B;  3MGR C;  2HIO B;  5B33 A;  3W99 B;  3REL C;  5AV8 A;  1F66 B;  1M18 C;  3MNN D;  3LJA B;  4J8U A;  5B2J A;  1P34 D;  1TAF B;  3WAA A;  4J8V D;  4ZBJ B;  3KXB D;  5GT3 D;  1P3K C;  3AZG C;  3MVD A;  4Z66 B;  3UTB B;  2ARO B;  5B24 A;  5GXQ C;  4ZBJ C;  3B6G B;  2RVQ C;  5CPK B;  3R45 A;  1P3M B;  1F66 C;  1R4V A;  5AY8 D;  4X23 A;  3NQJ A;  4NE6 A;  4EO5 C;  4XZQ D;  5CPK D;  5CPK A;  1ID3 C;  3MGR B;  3REH C;  4NE5 A;  3WKJ B;  2HIO A;  3AZF C;  3W99 A;  5BO0 B;  5GT0 B;  5B24 C;  1KX3 D;  1BFM A;  3WKJ D;  2NZD B;  5GXQ D;  3AV2 C;  3MVD C;  5B1L C;  5DNM B;  3V9R B;  1P3I D;  3AZN C;  5GT3 A;  3O62 C;  5AY8 C;  1B6W A;  3UT9 B;  2NZD D;  3X1S A;  1P3P C;  5AV8 D;  5JRG B;  5BNX A;  5AVC B;  3MGQ C;  3WTP D;  3A6N D;  3AZE D;  1P3B C;  5GT0 A;  5AV5 C;  5B1L D;  4J8V C;  3LJA D;  3AZH A;  4AWL C;  4WU9 A;  3AZG A;  3X1V D;  5B0Y C;  5DNM A;  4QLC B;  5B2I A;  3LZ0 D;  5JRG C;  4H9S C;  4H9Q A;  5KDM A;  1M18 B;  3NQU B;  4XUJ B;  5AV9 C;  3MGS C;  5B0Y A;  1P3F D;  1BH9 B;  1P3L C;  3LEL B;  1KX4 A;  5B1L A;  3AZH C;  2FJ7 C;  4WU9 B;  5JRG D;  3LZ0 C;  3REH B;  1JFI B;  2F8N A;  3UTB A;  4H9Q B;  2NZD C;  5JA4 A;  3W97 D;  3W97 A;  4R8P B;  5C3I C;  4YM6 A;  5B40 B;  3C1C D;  3AZF B;  4J8X A;  4WU8 A;  5B40 A;  5GXQ A;  5AV6 C;  2YFV A;  1P3B D;  3LJA C;  5DNN D;  5BNX B;  5BS7 A;  5B0Z A;  3REI B;  2HIO C;  3W99 C;  1KX4 D;  5B0Y D;  3AZK A;  5CP6 B;  3UTB C;  3UTA D;  1U35 A;  3VH5 A;  1BH8 B;  4X23 D;  2CV5 B;  1S32 B;  5B1M C;  1P3K B;  3V9R A;  2IO5 B;  5BNV A;  5B31 G;  5GSU A;  4JJN A;  2BYK B;  3UT9 D;  3AZM A;  4WU8 D;  3LZ0 A;  5AVB B;  5DNM C;  1HQ3 B;  4J8X C;  1ULY A;  4XUJ D;  1M19 A;  5E5A C;  1P3F C;  1P3L D;  3VH5 T;  3C1B D;  5B32 C;  5KDM B;  5GT0 C;  4J8V A;  3MGS A;  3W98 B;  2FJ7 D;  3UTB D;  5B2J C;  3MGQ A;  4QLC A;  3MGS B;  5B33 D;  4QLC D;  3REK B;  5F99 A;  3AFA D;  1P3O B;  2FJ7 A;  3MNN B;  2L5A A;  4WZS B;  3AZK B;  3REK D;  1P3B B;  1P3M D;  3TU4 C;  3X1S D;  4E45 A;  1P3A D;  2F8N G;  2HUE B;  3WTP E;  5AVC A;  5BNV B;  4JJN B;  2ARO D;  5AV9 A;  3AZL C;  5B2J B;  3KWQ B;  5CP6 D;  5GSU D;  4JJN D;  3AZG B;  4KUD D;  4KGC D;  3X1T A;  5AV5 B;  5AY8 B;  4YM6 B;  3AZF A;  5B2I D;  3AZK C;  3MNN C;  3X1U D;  5DNN B;  3AYW C;  3REK C;  5AVB D;  3AZN A;  3X1S C;  4WU9 D;  5DNN A;  4CSR A;  1M19 C;  5AV5 A;  3W96 A;  3LZ1 C;  3AZL D;  4NFT A;  3MGP C;  3UT9 C;  5B40 D;  4Z5T C;  4ZUX B;  3AZJ B;  2RVQ D;  4NE3 A;  2NQB A;  1ZLA D;  3W97 B;  4EO5 B;  4XUJ C;  5AV9 B;  4KGC C;  3LEL A;  5E5A D;  1HQ3 D;  5CPK C;  2NZD A;  3REH D;  3MGP B;  2PYO D;  3B6G A;  3VH6 A;  2PYO A;  3B6G D;  3REH A;  1P3I A;  3VH6 W;  5B2J D;  4CAY A;  1P34 A;  1M19 B;  3REL A;  1HQ3 A;  3MGR A;  4Z2M G;  5CPI C;  4Z66 D;  3NQJ B;  3MGP D;  5B2I B;  4Z5T D;  2NQB C;  1P3M C;  2BYM B;  1M1A B;  1BH8 A;  3REL B;  3AZI C;  5AVC C;  3AV1 C;  1EQZ C;  2ARO C;  1KX5 D;  2YFW A;  3LZ0 B;  3REJ B;  5CPJ C;  4KUD C;  2F8N K;  4J8U B;  3WAA B;  3A6N C;  3WA9 B;  5B31 B;  5CP6 A;  5AVB C;  4KHA A;  3WTP B;  3W96 B;  4G91 B;  1H3O A;  1TZY B;  3AV1 A;  5B31 A;  1EQZ A;  4YS3 D;  5AVC D;  3X1V C;  4J8U D;  3WAA D;  1P3A A;  5B1M B;  3LZ1 D;  5FUG A;  2CV5 C;  1P3L B;  2CWE A;  3X1S B;  1H3O B;  3AV1 B;  1EQZ B;  1HQ3 C;  4J8X B;  3B6F B;  3REL D;  1P34 C;  1M18 D;  3MGS D;  3B6F D;  3B6G C;  3C1B A;  5AV6 B;  4X23 B;  1KX3 B;  4DRB A;  4LD9 A;  5CPJ B;  3AV2 A;  3AN2 B;  4XUJ A;  4Z66 C;  2CV5 D;  1P3P B;  5C3I B;  3WKJ A;  4R8P C;  1ZLA A;  3AZI B;  2NQB D;  4AWL B;  5CPI A;  3W96 D;  3MGQ B;  1ID3 A;  3UTA A;  1U35 D;  1P3O C;  3W97 C;  5CPI B;  1S32 A;  1F66 A;  3KUY A;  4E44 A;  4ZUX D;  3AZI A;  3AZJ D;  5B24 B;  2PYO B;  3WKJ C;  3MGP A;  3LEL C;  4HGA C;  4KGC A;  5B24 D;  4Z66 A;  1A7W A;  4R8P D;  1WWI A;  3AZN B;  5AV6 A;  5DNN C;  1P3K A;  1P3I C;  3KSY A;  4WV4 B;  3WAA C;  4Z5T B;  3O62 D;  4J8U C;  4HGA B;  5BT1 C;  3B6F A;  3AZH B;  3AN2 D;  1N1J B;  5AV8 C;  1P3P D;  5B0Z B;  3AYW A;  3KWQ D;  3AFA A;  3AYW B;  1P3G B;  5JRG A;  5AV5 D;  3MGQ D;  3AZE C;  4YS3 A;  5B31 D;  1P3F A;  3WA9 A;  5B32 D;  4J8W A;  2BYM A;  3AZL B;  3AN2 C;  1AOI D; 
#chains in the Genus database with same CATH topology
 3X1T D;  4G92 C;  4KUD A;  1P34 B;  2ARO A;  5AV9 D;  1U35 C;  3TU4 D;  1P3O D;  5B1L B;  3AV2 B;  4ZUX C;  3AZJ C;  3A6N B;  5BS7 C;  1P3M A;  2G5H C;  3AZM C;  3LJA A;  3AZH D;  3B0B A;  3NQU A;  5F99 D;  1AOI C;  1P3I B;  2Y2I A;  2LY8 A;  4M6B A;  4CSR B;  3MVD B;  3AYW D;  5CPJ A;  2JSS A;  5FUG B;  5BT1 D;  3FDD A;  2YFV B;  1HTA A;  4XZQ C;  3C1C C;  2Y2L A;  5GXQ B;  1M19 D;  1B67 A;  5E5A A;  3KWQ C;  3X1T B;  3B0D B;  5G49 B;  3REJ D;  3AZM D;  1Q9C A;  3UT9 A;  2F8N D;  5B40 C;  5AV6 D;  4UUZ A;  3REI A;  4R8P A;  1KX3 C;  1ZLA C;  5JA4 B;  4DRA A;  3TU4 B;  1Z2C B;  5B1M A;  1M1A D;  2HIO D;  3W99 D;  1KX4 C;  4KGC B;  3AZN D;  2F8N B;  2Y2Q A;  2ZY4 A;  5BO0 A;  2F8N H;  3KUY C;  3X1U A;  4XZQ A;  2FJ7 B;  5B0Z C;  3X1T C;  5B1M D;  5F99 B;  5GT3 B;  3UTA C;  1P3O A;  1M1A A;  4X23 C;  2ZM5 A;  4DQY B;  5CPI D;  3O62 B;  3REJ A;  4J8X D;  3WTP C;  3W98 A;  1AOI A;  2YFW B;  4WU8 C;  5DNM D;  4YM6 C;  4J8W D;  3EPK A;  2IO5 C;  3LZ1 B;  3KXB A;  3REK A;  4KUD B;  5CPJ D;  3AZM B;  5F99 C;  5GT0 D;  3UTA B;  5GSU B;  3A6N A;  4QLC C;  3R45 B;  5B0Y B;  1F1E A;  1TAF A;  3AFA C;  4H9S A;  4J8W B;  3KXB B;  5B33 C;  3B0C W;  5B32 G;  1U35 B;  3EPH A;  3X1U B;  1P3P A;  3WA9 C;  3B0C T;  3AN2 A;  4YS3 C;  1P3L A;  1P3A C;  1P3G D;  3O62 A;  2BYK A;  4J8W C;  3REJ C;  3TU4 A;  3C1B B;  3W98 D;  5GSU C;  4JJN C;  4H9O A;  5AV8 B;  4XZQ B;  4YS3 B;  3VH5 W;  1M1A C;  2ZY3 A;  4H9R A;  3AZE B;  5E5A B;  3X1U C;  4H9N B;  4H9P B;  5B2I C;  3AZK D;  3B6F C;  5B32 A;  3WA9 D;  3KUY D;  3AFA B;  1S32 D;  5B0Z D;  4H9P A;  4WU9 C;  4UUZ B;  5AY8 A;  4H9R B;  3AZE A;  1P3B A;  4KHA B;  3VH6 T;  4WNN A;  3WTP A;  3W98 C;  3X1V B;  3REI D;  4Z5T A;  3KUY B;  4G91 C;  4UPK A;  3KWQ A;  3W96 C;  3MGR D;  5CHL B;  4YM6 D;  3C1C A;  1KX4 B;  4LD9 D;  2Y2N A;  1JFI A;  2PYO C;  1S32 C;  1M18 A;  5GT3 C;  1P3K D;  3MNN A;  1WWS A;  3EPL A;  3B0D C;  3LEL D;  4LD9 B;  2Y2J A;  1ID3 B;  1TZY D;  3REI C;  1KX3 A;  1BH9 A;  4Z2M H;  2HUE C;  3AZL A;  1KU5 A;  4J8V B;  3LZ1 A;  4ZUX A;  3AZI D;  3AZJ A;  2NQB B;  1F66 D;  1P3G C;  1ZLA B;  4CAY B;  5B33 B;  4WNN B;  4LD9 C;  1KX5 C;  1ID3 D;  3AV1 D;  5AVB A;  1AOI B;  1EQZ D;  3C1B C;  2J8P A;  3C1C B;  3AZF D;  1P3A B;  2G5I C;  2CV5 A;  1P3F B;  1TZY C;  3F6T A;  1N1J A;  3X1V A;  3AV2 D;  4WU8 B;  2FFF B;  5G49 A;  3MVD D;  3KXB C;  1KX5 A;  5B31 C;  3AZG D;  4H9O B;  1P3G A;  4G92 B;  5B32 B;  4H9N A;  5CP6 C;  1TZY A;  1KX5 B;  3MGR C;  2HIO B;  5B33 A;  3W99 B;  3REL C;  5AV8 A;  1F66 B;  1M18 C;  3MNN D;  3LJA B;  4J8U A;  1T3U A;  3H0R C;  1TAF B;  5B2J A;  4J8V D;  1P34 D;  3WAA A;  4ZBJ B;  3KXB D;  5GT3 D;  1P3K C;  3AZG C;  3MVD A;  4Z66 B;  3UTB B;  2ZY2 A;  2ARO B;  5B24 A;  5GXQ C;  4ZBJ C;  3B6G B;  2RVQ C;  5CPK B;  3R45 A;  1P3M B;  1F66 C;  1R4V A;  5AY8 D;  4X23 A;  3NQJ A;  4NE6 A;  4EO5 C;  4XZQ D;  5CPK D;  5CPK A;  1ID3 C;  3MGR B;  3REH C;  4NE5 A;  3WKJ B;  2HIO A;  3AZF C;  3W99 A;  5BO0 B;  5GT0 B;  5B24 C;  1KX3 D;  1BFM A;  3WKJ D;  2NZD B;  5GXQ D;  3AV2 C;  3MVD C;  5B1L C;  5DNM B;  3V9R B;  1P3I D;  3AZN C;  5GT3 A;  3O62 C;  5AY8 C;  1B6W A;  3UT9 B;  2NZD D;  3X1S A;  1P3P C;  5AV8 D;  5JRG B;  5BNX A;  3H0L C;  5AVC B;  2UWX A;  3MGQ C;  3WTP D;  3A6N D;  3AZE D;  1P3B C;  5GT0 A;  5AV5 C;  5B1L D;  4J8V C;  3LJA D;  3AZH A;  4AWL C;  2RIQ A;  4WU9 A;  3AZG A;  2XD1 A;  3X1V D;  5B0Y C;  5DNM A;  4QLC B;  5B2I A;  5JRG C;  3LZ0 D;  4H9S C;  4H9Q A;  5KDM A;  2Y2M A;  1M18 B;  2F2A C;  3NQU B;  4XUJ B;  5AV9 C;  3MGS C;  5B0Y A;  1P3F D;  1BH9 B;  1P3L C;  3LEL B;  1KX4 A;  5B1L A;  3AZH C;  2FJ7 C;  4WU9 B;  5JRG D;  3LZ0 C;  3REH B;  3KFU G;  1JFI B;  2F8N A;  3UTB A;  4H9Q B;  2DF4 C;  2W8S A;  2NZD C;  5JA4 A;  3W97 D;  3W97 A;  4R8P B;  5C3I C;  4YM6 A;  5B40 B;  3C1C D;  3AZF B;  4J8X A;  4WU8 A;  5B40 A;  3EPJ A;  5GXQ A;  5AV6 C;  2YFV A;  1P3B D;  3P5J B;  3LJA C;  2Y2G A;  5DNN D;  5BNX B;  5BS7 A;  5B0Z A;  3REI B;  2HIO C;  3W99 C;  1KX4 D;  5B0Y D;  3AZK A;  5CP6 B;  3UTB C;  3UTA D;  1U35 A;  3VH5 A;  1BH8 B;  4X23 D;  2CV5 B;  1S32 B;  5B1M C;  1P3K B;  3V9R A;  2IO5 B;  5BNV A;  5B31 G;  5GSU A;  4JJN A;  2BYK B;  3UT9 D;  3AZM A;  4WU8 D;  3LZ0 A;  5AVB B;  5DNM C;  1HQ3 B;  4J8X C;  1ULY A;  4XUJ D;  1M19 A;  5E5A C;  1P3F C;  1P3L D;  3VH5 T;  3C1B D;  5B32 C;  5KDM B;  5GT0 C;  1W2E A;  3MGS A;  4J8V A;  3W98 B;  2FJ7 D;  3UTB D;  5B2J C;  3MGQ A;  4QLC A;  2JE5 A;  3MGS B;  5B33 D;  4QLC D;  3REK B;  5F99 A;  3AFA D;  1P3O B;  2ZY5 A;  2FJ7 A;  3MNN B;  2L5A A;  4WZS B;  3AZK B;  3REK D;  1P3B B;  1P3M D;  3TU4 C;  3X1S D;  4E45 A;  1P3A D;  2F8N G;  2HUE B;  3WTP E;  5AVC A;  5BNV B;  4JJN B;  2ARO D;  5AV9 A;  3AZL C;  5B2J B;  3KWQ B;  5CP6 D;  5GSU D;  4JJN D;  3AZG B;  4KUD D;  4KGC D;  3X1T A;  5AV5 B;  5AY8 B;  4YM6 B;  3AZF A;  5B2I D;  3AZK C;  3MNN C;  3X1U D;  5DNN B;  3AYW C;  3REK C;  5AVB D;  3A1I A;  3AZN A;  3X1S C;  4WU9 D;  5DNN A;  4CSR A;  1M19 C;  5AV5 A;  3W96 A;  3LZ1 C;  3AZL D;  4NFT A;  3MGP C;  3UT9 C;  5B40 D;  4Z5T C;  4ZUX B;  3AZJ B;  2RVQ D;  4NE3 A;  2NQB A;  1ZLA D;  4WJ3 C;  3W97 B;  4EO5 B;  3H0M C;  4XUJ C;  5AV9 B;  4KGC C;  3LEL A;  5E5A D;  1HQ3 D;  5CPK C;  2BG1 A;  2NZD A;  2XD5 A;  3REH D;  3MGP B;  2PYO D;  3B6G A;  3VH6 A;  2PYO A;  3B6G D;  2Y2H A;  3REH A;  1P3I A;  3VH6 W;  5B2J D;  4CAY A;  1P34 A;  1M19 B;  3REL A;  1HQ3 A;  3MGR A;  4Z2M G;  5CPI C;  4Z66 D;  3NQJ B;  3MGP D;  5B2I B;  4Z5T D;  2NQB C;  1P3M C;  2BYM B;  1M1A B;  1BH8 A;  3REL B;  3AZI C;  5AVC C;  3AV1 C;  1EQZ C;  2ARO C;  1KX5 D;  2YFW A;  3LZ0 B;  3A1K A;  3REJ B;  5CPJ C;  3AL0 C;  4KUD C;  2F8N K;  4J8U B;  3WAA B;  3A6N C;  3WA9 B;  5B31 B;  5CP6 A;  5AVB C;  2Y2P A;  4KHA A;  3WTP B;  3W96 B;  4G91 B;  1H3O A;  1TZY B;  3AV1 A;  5B31 A;  1EQZ A;  4YS3 D;  5AVC D;  3X1V C;  4J8U D;  3WAA D;  1P3A A;  5B1M B;  3LZ1 D;  5FUG A;  2CV5 C;  1P3L B;  2CWE A;  3X1S B;  1H3O B;  3AV1 B;  1EQZ B;  1PZR A;  1HQ3 C;  4J8X B;  3B6F B;  3REL D;  1P34 C;  1M18 D;  3MGS D;  3B6F D;  3B6G C;  3C1B A;  5AV6 B;  4X23 B;  1KX3 B;  4DRB A;  4LD9 A;  5CPJ B;  3AV2 A;  3AN2 B;  4XUJ A;  4Z66 C;  2CV5 D;  1P3P B;  5C3I B;  3WKJ A;  2JCH A;  4R8P C;  1ZLA A;  3AZI B;  2NQB D;  4AWL B;  5CPI A;  3W96 D;  2VQR A;  2Y2O A;  3MGQ B;  1ID3 A;  3UTA A;  1U35 D;  1P3O C;  3W97 C;  5CPI B;  3IP4 C;  1S32 A;  1F66 A;  3KUY A;  4E44 A;  4ZUX D;  3AZI A;  3AZJ D;  5B24 B;  2PYO B;  3WKJ C;  3MGP A;  3LEL C;  4HGA C;  4KGC A;  5B24 D;  4Z66 A;  1A7W A;  4R8P D;  1WWI A;  3AZN B;  5AV6 A;  5DNN C;  1P3K A;  2DQN C;  1P3I C;  3KSY A;  4WV4 B;  3WAA C;  4Z5T B;  3O62 D;  4J8U C;  4HGA B;  5BT1 C;  3B6F A;  3AZH B;  3AN2 D;  1N1J B;  5AV8 C;  1P3P D;  3EG5 B;  5B0Z B;  3AYW A;  3KWQ D;  3AFA A;  3AYW B;  1P3G B;  5JRG A;  5AV5 D;  3MGQ D;  3AZE C;  2Y2K A;  4YS3 A;  5B31 D;  1P3F A;  3WA9 A;  5B32 D;  4J8W A;  2BYM A;  3AZL B;  3AN2 C;  1AOI D; 
#chains in the Genus database with same CATH homology
 3X1T D;  4G92 C;  4KUD A;  1P34 B;  2ARO A;  5AV9 D;  1U35 C;  3TU4 D;  1P3O D;  5B1L B;  3AV2 B;  4ZUX C;  3AZJ C;  3A6N B;  5BS7 C;  1P3M A;  2G5H C;  3AZM C;  3LJA A;  3AZH D;  3B0B A;  3NQU A;  5F99 D;  1AOI C;  1P3I B;  2Y2I A;  2LY8 A;  4M6B A;  4CSR B;  3MVD B;  3AYW D;  5CPJ A;  2JSS A;  5FUG B;  5BT1 D;  3FDD A;  2YFV B;  1HTA A;  4XZQ C;  3C1C C;  2Y2L A;  5GXQ B;  1M19 D;  1B67 A;  5E5A A;  3KWQ C;  3X1T B;  3B0D B;  5G49 B;  3REJ D;  3AZM D;  1Q9C A;  3UT9 A;  2F8N D;  5B40 C;  5AV6 D;  4UUZ A;  3REI A;  4R8P A;  1KX3 C;  1ZLA C;  5JA4 B;  4DRA A;  3TU4 B;  1Z2C B;  5B1M A;  1M1A D;  2HIO D;  3W99 D;  1KX4 C;  4KGC B;  3AZN D;  2F8N B;  2Y2Q A;  2ZY4 A;  5BO0 A;  2F8N H;  3KUY C;  3X1U A;  4XZQ A;  2FJ7 B;  5B0Z C;  3X1T C;  5B1M D;  5F99 B;  5GT3 B;  3UTA C;  1P3O A;  1M1A A;  4X23 C;  2ZM5 A;  4DQY B;  5CPI D;  3O62 B;  3REJ A;  4J8X D;  3WTP C;  3W98 A;  1AOI A;  2YFW B;  4WU8 C;  5DNM D;  4YM6 C;  4J8W D;  3EPK A;  2IO5 C;  3LZ1 B;  3KXB A;  3REK A;  4KUD B;  5CPJ D;  3AZM B;  5F99 C;  5GT0 D;  3UTA B;  5GSU B;  3A6N A;  4QLC C;  3R45 B;  5B0Y B;  1F1E A;  1TAF A;  3AFA C;  4H9S A;  4J8W B;  3KXB B;  5B33 C;  3B0C W;  5B32 G;  1U35 B;  3EPH A;  3X1U B;  1P3P A;  3WA9 C;  3B0C T;  3AN2 A;  4YS3 C;  1P3L A;  1P3A C;  1P3G D;  3O62 A;  2BYK A;  4J8W C;  3REJ C;  3TU4 A;  3C1B B;  3W98 D;  5GSU C;  4JJN C;  4H9O A;  5AV8 B;  4XZQ B;  4YS3 B;  3VH5 W;  1M1A C;  2ZY3 A;  4H9R A;  3AZE B;  5E5A B;  3X1U C;  4H9N B;  4H9P B;  5B2I C;  3AZK D;  3B6F C;  5B32 A;  3WA9 D;  3KUY D;  3AFA B;  1S32 D;  5B0Z D;  4H9P A;  4WU9 C;  4UUZ B;  5AY8 A;  4H9R B;  3AZE A;  1P3B A;  4KHA B;  3VH6 T;  4WNN A;  3WTP A;  3W98 C;  3X1V B;  3REI D;  4Z5T A;  3KUY B;  4G91 C;  4UPK A;  3KWQ A;  3W96 C;  3MGR D;  5CHL B;  4YM6 D;  3C1C A;  1KX4 B;  4LD9 D;  2Y2N A;  1JFI A;  2PYO C;  1S32 C;  1M18 A;  5GT3 C;  1P3K D;  3MNN A;  1WWS A;  3EPL A;  3B0D C;  3LEL D;  4LD9 B;  2Y2J A;  1ID3 B;  1TZY D;  3REI C;  1KX3 A;  1BH9 A;  4Z2M H;  2HUE C;  3AZL A;  1KU5 A;  4J8V B;  3LZ1 A;  4ZUX A;  3AZI D;  3AZJ A;  2NQB B;  1F66 D;  1P3G C;  1ZLA B;  4CAY B;  5B33 B;  4WNN B;  4LD9 C;  1KX5 C;  1ID3 D;  3AV1 D;  5AVB A;  1AOI B;  1EQZ D;  3C1B C;  2J8P A;  3C1C B;  3AZF D;  1P3A B;  2G5I C;  2CV5 A;  1P3F B;  1TZY C;  3F6T A;  1N1J A;  3X1V A;  3AV2 D;  4WU8 B;  2FFF B;  5G49 A;  3MVD D;  3KXB C;  1KX5 A;  5B31 C;  3AZG D;  4H9O B;  1P3G A;  4G92 B;  5B32 B;  4H9N A;  5CP6 C;  1TZY A;  1KX5 B;  3MGR C;  2HIO B;  5B33 A;  3W99 B;  3REL C;  5AV8 A;  1F66 B;  1M18 C;  3MNN D;  3LJA B;  4J8U A;  1T3U A;  3H0R C;  1TAF B;  5B2J A;  4J8V D;  1P34 D;  3WAA A;  4ZBJ B;  3KXB D;  5GT3 D;  1P3K C;  3AZG C;  3MVD A;  4Z66 B;  3UTB B;  2ZY2 A;  2ARO B;  5B24 A;  5GXQ C;  4ZBJ C;  3B6G B;  2RVQ C;  5CPK B;  3R45 A;  1P3M B;  1F66 C;  1R4V A;  5AY8 D;  4X23 A;  3NQJ A;  4NE6 A;  4EO5 C;  4XZQ D;  5CPK D;  5CPK A;  1ID3 C;  3MGR B;  3REH C;  4NE5 A;  3WKJ B;  2HIO A;  3AZF C;  3W99 A;  5BO0 B;  5GT0 B;  5B24 C;  1KX3 D;  1BFM A;  3WKJ D;  2NZD B;  5GXQ D;  3AV2 C;  3MVD C;  5B1L C;  5DNM B;  3V9R B;  1P3I D;  3AZN C;  5GT3 A;  3O62 C;  5AY8 C;  1B6W A;  3UT9 B;  2NZD D;  3X1S A;  1P3P C;  5AV8 D;  5JRG B;  5BNX A;  3H0L C;  5AVC B;  2UWX A;  3MGQ C;  3WTP D;  3A6N D;  3AZE D;  1P3B C;  5GT0 A;  5AV5 C;  5B1L D;  4J8V C;  3LJA D;  3AZH A;  4AWL C;  2RIQ A;  4WU9 A;  3AZG A;  2XD1 A;  3X1V D;  5B0Y C;  5DNM A;  4QLC B;  5B2I A;  5JRG C;  3LZ0 D;  4H9S C;  4H9Q A;  5KDM A;  2Y2M A;  1M18 B;  2F2A C;  3NQU B;  4XUJ B;  5AV9 C;  3MGS C;  5B0Y A;  1P3F D;  1BH9 B;  1P3L C;  3LEL B;  1KX4 A;  5B1L A;  3AZH C;  2FJ7 C;  4WU9 B;  5JRG D;  3LZ0 C;  3REH B;  3KFU G;  1JFI B;  2F8N A;  3UTB A;  4H9Q B;  2DF4 C;  2W8S A;  2NZD C;  5JA4 A;  3W97 D;  3W97 A;  4R8P B;  5C3I C;  4YM6 A;  5B40 B;  3C1C D;  3AZF B;  4J8X A;  4WU8 A;  5B40 A;  3EPJ A;  5GXQ A;  5AV6 C;  2YFV A;  1P3B D;  3P5J B;  3LJA C;  2Y2G A;  5DNN D;  5BNX B;  5BS7 A;  5B0Z A;  3REI B;  2HIO C;  3W99 C;  1KX4 D;  5B0Y D;  3AZK A;  5CP6 B;  3UTB C;  3UTA D;  1U35 A;  3VH5 A;  1BH8 B;  4X23 D;  2CV5 B;  1S32 B;  5B1M C;  1P3K B;  3V9R A;  2IO5 B;  5BNV A;  5B31 G;  5GSU A;  4JJN A;  2BYK B;  3UT9 D;  3AZM A;  4WU8 D;  3LZ0 A;  5AVB B;  5DNM C;  1HQ3 B;  4J8X C;  1ULY A;  4XUJ D;  1M19 A;  5E5A C;  1P3F C;  1P3L D;  3VH5 T;  3C1B D;  5B32 C;  5KDM B;  5GT0 C;  1W2E A;  3MGS A;  4J8V A;  3W98 B;  2FJ7 D;  3UTB D;  5B2J C;  3MGQ A;  4QLC A;  2JE5 A;  3MGS B;  5B33 D;  4QLC D;  3REK B;  5F99 A;  3AFA D;  1P3O B;  2ZY5 A;  2FJ7 A;  3MNN B;  2L5A A;  4WZS B;  3AZK B;  3REK D;  1P3B B;  1P3M D;  3TU4 C;  3X1S D;  4E45 A;  1P3A D;  2F8N G;  2HUE B;  3WTP E;  5AVC A;  5BNV B;  4JJN B;  2ARO D;  5AV9 A;  3AZL C;  5B2J B;  3KWQ B;  5CP6 D;  5GSU D;  4JJN D;  3AZG B;  4KUD D;  4KGC D;  3X1T A;  5AV5 B;  5AY8 B;  4YM6 B;  3AZF A;  5B2I D;  3AZK C;  3MNN C;  3X1U D;  5DNN B;  3AYW C;  3REK C;  5AVB D;  3A1I A;  3AZN A;  3X1S C;  4WU9 D;  5DNN A;  4CSR A;  1M19 C;  5AV5 A;  3W96 A;  3LZ1 C;  3AZL D;  4NFT A;  3MGP C;  3UT9 C;  5B40 D;  4Z5T C;  4ZUX B;  3AZJ B;  2RVQ D;  4NE3 A;  2NQB A;  1ZLA D;  4WJ3 C;  3W97 B;  4EO5 B;  3H0M C;  4XUJ C;  5AV9 B;  4KGC C;  3LEL A;  5E5A D;  1HQ3 D;  5CPK C;  2BG1 A;  2NZD A;  2XD5 A;  3REH D;  3MGP B;  2PYO D;  3B6G A;  3VH6 A;  2PYO A;  3B6G D;  2Y2H A;  3REH A;  1P3I A;  3VH6 W;  5B2J D;  4CAY A;  1P34 A;  1M19 B;  3REL A;  1HQ3 A;  3MGR A;  4Z2M G;  5CPI C;  4Z66 D;  3NQJ B;  3MGP D;  5B2I B;  4Z5T D;  2NQB C;  1P3M C;  2BYM B;  1M1A B;  1BH8 A;  3REL B;  3AZI C;  5AVC C;  3AV1 C;  1EQZ C;  2ARO C;  1KX5 D;  2YFW A;  3LZ0 B;  3A1K A;  3REJ B;  5CPJ C;  3AL0 C;  4KUD C;  2F8N K;  4J8U B;  3WAA B;  3A6N C;  3WA9 B;  5B31 B;  5CP6 A;  5AVB C;  2Y2P A;  4KHA A;  3WTP B;  3W96 B;  4G91 B;  1H3O A;  1TZY B;  3AV1 A;  5B31 A;  1EQZ A;  4YS3 D;  5AVC D;  3X1V C;  4J8U D;  3WAA D;  1P3A A;  5B1M B;  3LZ1 D;  5FUG A;  2CV5 C;  1P3L B;  2CWE A;  3X1S B;  1H3O B;  3AV1 B;  1EQZ B;  1PZR A;  1HQ3 C;  4J8X B;  3B6F B;  3REL D;  1P34 C;  1M18 D;  3MGS D;  3B6F D;  3B6G C;  3C1B A;  5AV6 B;  4X23 B;  1KX3 B;  4DRB A;  4LD9 A;  5CPJ B;  3AV2 A;  3AN2 B;  4XUJ A;  4Z66 C;  2CV5 D;  1P3P B;  5C3I B;  3WKJ A;  2JCH A;  4R8P C;  1ZLA A;  3AZI B;  2NQB D;  4AWL B;  5CPI A;  3W96 D;  2VQR A;  2Y2O A;  3MGQ B;  1ID3 A;  3UTA A;  1U35 D;  1P3O C;  3W97 C;  5CPI B;  3IP4 C;  1S32 A;  1F66 A;  3KUY A;  4E44 A;  4ZUX D;  3AZI A;  3AZJ D;  5B24 B;  2PYO B;  3WKJ C;  3MGP A;  3LEL C;  4HGA C;  4KGC A;  5B24 D;  4Z66 A;  1A7W A;  4R8P D;  1WWI A;  3AZN B;  5AV6 A;  5DNN C;  1P3K A;  2DQN C;  1P3I C;  3KSY A;  4WV4 B;  3WAA C;  4Z5T B;  3O62 D;  4J8U C;  4HGA B;  5BT1 C;  3B6F A;  3AZH B;  3AN2 D;  1N1J B;  5AV8 C;  1P3P D;  3EG5 B;  5B0Z B;  3AYW A;  3KWQ D;  3AFA A;  3AYW B;  1P3G B;  5JRG A;  5AV5 D;  3MGQ D;  3AZE C;  2Y2K A;  4YS3 A;  5B31 D;  1P3F A;  3WA9 A;  5B32 D;  4J8W A;  2BYM A;  3AZL B;  3AN2 C;  1AOI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...