1P3LD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lD00
2HIOA 4E44A 4H9OB 5E5AC 3LZ0A 5AVBB 3W96A 5CPJC 3KUYA 3LZ1C 3AZJA 5B2JB 5B31C 5AV5B 1P3BC 3UT9A 1KU5A 3AZMA 4Z66A 5JRGC 1U35B 3AZND 3B6FD 3NQJB 3MGPC 4NE5A 3MGQD 3TU4A 5B1LA 1BH9B 3WA9A 3REJC 5F99D 3REHB 1F66B 3LZ1B 4KGCD 3MGSA 5B31B 1P3KA 5JA4B 4R8PD 4Z5TD 3WTPC 5B40A 4KUDD 3MGPB 1M19A 5FUGB 3X1UC 3REJB 3AV2B 5BNVA 2FJ7A 4XZQA 3VH5A 1KX3C 1P3OC 1H3OA 3AZLA 3NQUA 5AVBD 4JJNC 3AV1C 5GXQC 3X1UB 3KWQD 5BS7C 1P3GC 1P3OB 5E5AD 5AV8B 3C1BA 1ZLAD 4X23A 5CPJD 3AYWA 5GT0A 2CV5C 1P3BD 4UUZA 3X1VA 3RELC 5GXQB 5B1MA 5JRGD 4H9RA 2F8NK 4EO5B 1P3GB 3MGPD 3O62C 4G91B 2L5AA 3AZHB 1P3LA 1EQZC 3WTPD 5B33C 4YM6C 2AROA 3O62B 3AN2C 4H9SA 1ID3B 1EQZB 3LJAC 1KX3D 5BO0A 5B33B 3LZ0B 4WU8A 4YM6B 4JJND 3AV1D 5AY8A 1P34A 3AZJB 1B6WA 3AN2B 4Z2MG 3AZIC 3UT9B 4H9QA 4Z66B 5CPKC 1P3GD 1M18A 4Z2MH 5B0ZD 3AZKC 3VH5T 4YS3C 3TU4B 5B1LB 2CV5D 3RELD 1JFIB 3REKA 1WWIA 3O62D 3KXBA 4YS3B 1P3PC 3WAAA 4XUJC 3W99A 1P3AA 4Z5TA 5BNVB 2FJ7B 2NZDC 5CP6D 3B0CT 4LD9D 1H3OB 3MVDD 3AN2D 1P3PB 4XUJB 5B0YA 3C1CC 3LJAD 2NZDB 1HQ3C 5DNNC 5AV6D 3AYWB 5B24C 1KX4A 5B32G 5B32C 3X1VB 4J8XC 1P3FC 3AZID 5E5AA 5CPKD 4H9RB 5GSUA 1ZLAA 3AZKD 5DNNB 2NQBA 1KX5A 2YFVA 3WKJA 5AVCA 1P3FB 4J8XB 5BNXA 5DNMA 1U35C 4WU9C 2AROB 3LELD 3AZEC 2NZDD 4HGAB 3UTBC 3MNNA 1S32A 5B2JC 4J8UD 4H9PA 3AZEB 1KX3A 4QLCA 1TZYC 3C1CD 4ZBJC 1HQ3D 1M18B 5DNND 3UTBB 3B6GA 3MGRC 5B24D 3VH6W 3W98D 3REHC 1F66C 5B32D 5B31G 5B0ZA 5G49A 1TZYB 3REKB 4ZBJB 3UTAC 1AOIA 4CSRA 3MGRB 5B2IC 2F8NH 3W99B 5CPIA 1P3AB 5GT3D 1M1AA 3AV2C 3AZGC 2YFWA 3R45A 1P3IC 3UTAB 1HTAA 3A6ND 4WU9D 4CAYB 2F8NB 5KDMA 5B2IB 5CP6A 4LD9A 3AZGB 3MVDA 4ZUXA 3UTBD 3AZFA 5AV8C 1P3IB 4J8VC 1R4VA 3V9RA 1P3MC 5B2JD 5AV5D 2BYMA 5AV6A 1U35D 5GSUB 4EO5C 3WTPE 2NQBB 4J8VB 4J8WA 4G91C 3REIC 3WKJB 3REHD 3AZHC 3LZ1D 1P3MB 1F66D 5AVCB 5B31D 3AFAA 5BNXB 5DNMB 3X1TB 2F8ND 2PYOA 5AV9A 3REIB 3REJD 3AV2D 4DRBA 1ID3C 1F1EA 2HIOC 1P3ID 3LZ0C 3LELA 3MNNB 2RVQC 3KUYC 3AZJC 1S32B 4H9PB 4KHAA 3X1UD 4QLCB 3UT9C 3AZMC 4Z66C 2HIOB 1P3OD 3X1SA 5AV8D 3W97A 4J8UA 3TU4C 5B1LC 3C1CA 2HUEC 3WA9C 3W96B 3KUYB 3B0DC 3MGSC 5GXQD 1P3KC 3AZMB 5B40C 3W98A 4AWLC 1M19C 5CPIB 3AZHD 2HUEB 3WA9B 3B6FA 3B0DB 3AZNA 2FJ7C 3MGSB 1BH8A 1N1JA 1P3KB 3AZLC 3MGQA 5B40B 5GT3A 4KGCA 5F99A 4AWLB 5KDMB 1M19B 4R8PA 1ID3D 1EQZD 3A6NA 2HIOD 4XZQB 4KUDA 3AZFB 4WV4B 5B33D 3LZ0D 3AZLB 3C1BC 3NQUB 4YM6D 3AYWC 3KUYD 5GT0C 3AZJD 4H9OA 3X1VC 3UT9D 5B1MC 4Z66D 4WZSB 5AVBA 3KSYA 3C1BB 5AV5A 5B1LD 3TU4D 4X23B 3KWQA 5GT0B 1U35A 1P3LC 2IO5C 3MGSD 4UUZB 5B1MB 1BH9A 5CPJA 2AROC 3LZ1A 4YS3D 2PYOB 5B31A 5AV9B 1P3BA 1M19D 5JRGA 1P3LB 4H9SC 2FJ7D 2IO5B 4HGAC 3MGPA 5FUGA 3REJA 1P3PD 5AY8C 1P34C 4XUJD 1BFMA 3B0BA 3WTPA 1M18C 2JSSA 5BO0B 3X1SB 3W97B 1WWSA 3AYWD 3X1UA 4WU8B 5AY8B 1P34B 3X1VD 1P3OA 5B1MD 5AV8A 3REKC 1B67A 4H9QB 4JJNA 3AV1A 3KXBC 3WAAC 3W99C 3VH6A 5GXQA 1P3AC 1P3LD 4Z5TC 1P3FD 5BS7A 4J8XD 3AZNB 1P3GA 1N1JB 4G92C 1P34D 3MGQB 5C3IC 2AROD 2F8NG 5F99B 2CV5A 4KGCB 3KXBB 3WAAB 3RELA 5B0YC 4Z5TB 4G92B 3O62A 4DRAA 5C3IB 1ULYA 1KX4C 1EQZA 3AZED 5B0YB 5B33A 1M18D 5GSUC 1ZLAC 4YM6A 3AN2A 2LY8A 2NQBC 1KX5C 4WNNA 3WKJC 3KWQB 1KX4B 3LJAA 5AVCC 1TZYD 3REKD 5E5AB 5DNMC 1ZLAB 3X1TC 5CPJB 3MGRD 3KXBD 3WAAD 1P3BB 1KX5B 3W99D 2YFVB 3AZIA 1P3AD 1JFIA 5JRGB 5CPKA 3AZKA 3UTAD 4YS3A 3MNNC 4H9NA 5B2ID 1S32C 5B0YD 3VH5W 4QLCC 3WTPB 3AZGD 3VH6T 3B6GC 1P3PA 4XUJA 1KX4D 3W96C 2NZDA 1KX3B 5B0ZC 2CWEA 5GSUD 1AOIC 3B0CW 4JJNB 4J8VD 3AV1B 1KX5D 2NQBD 3B6GB 3WKJD 5CPIC 1P3MD 1M1AC 5AVCD 1HQ3A 5DNNA 5B0ZB 4NE6A 5G49B 5DNMD 3KWQC 1AOIB 2BYKA 3X1TD 5B24A 4CSRB 2CV5B 5B32A 1P3FA 4M6BA 4J8XA 5CP6C 3REID 3RELB 4LD9C 1M1AB 4XZQC 3MVDC 4ZUXC 2YFWB 3R45B 3AZFC 5BT1C 3MNND 5CHLB 1S32D 5CP6B 4LD9B 4QLCD 1TAFA 5AV6C 4WU9A 3MVDB 4ZUXB 3B6GD 3AZEA 4J8WC 4WNNB 4X23C 2RVQD 3W96D 1A7WA 3V9RB 3LJAB 3UTBA 2BYMB 3AFAC 3AZMD 5AV6B 1AOID 5B2JA 2PYOC 5AV9C 4J8WB 1TZYA 3AZIB 5CPID 3WA9D 1M1AD 5CPKB 3NQJA 3AZKB 1P3KD 3AFAB 3MGRA 5B40D 3LELC 3REHA 1F66A 4H9NB 5JA4A 4E45A 3UTAA 4XZQD 4ZUXD 4CAYA 2F8NA 3AZFD 3AZLD 3X1SC 5B2IA 3W97C 3LELB 5BT1D 4J8UC 4WU8C 3AV2A 3AZGA 4NE3A 4KHAB 1P3IA 3W98C 3C1BD 4J8WD 4J8UB 4X23D 5GT0D 3C1CB 4NFTA 3B6FC 1HQ3B 3AZNC 3AFAD 4J8VA 3MGQC 2BYKB 5GT3C 5B24B 1P3MA 5F99C 3W98B 2PYOD 5B32B 5AV9D 4KGCC 4R8PC 3B6FB 3A6NC 3X1TA 1BH8B 4KUDC 3REIA 5GT3B 3AZHA 1TAFB 4R8PB 3A6NB 4WU9B 5AVBC 3X1SD 4KUDB 3W97D 5AV5C 4WU8D 1Q9CA 5AY8D 1ID3A
chains in the Genus database with same CATH superfamily
2HIOA 4E44A 4H9OB 5E5AC 3LZ0A 5AVBB 3W96A 5CPJC 3KUYA 3LZ1C 3AZJA 5B2JB 5B31C 5AV5B 1P3BC 3UT9A 1KU5A 3AZMA 4Z66A 5JRGC 1U35B 3AZND 3B6FD 3NQJB 3MGPC 4NE5A 3MGQD 3TU4A 5B1LA 2UWXA 1BH9B 3WA9A 3REJC 5F99D 3REHB 1F66B 3LZ1B 4KGCD 3MGSA 5B31B 1P3KA 5JA4B 4R8PD 4Z5TD 3WTPC 5B40A 4KUDD 3MGPB 1M19A 5FUGB 3X1UC 3REJB 3AV2B 5BNVA 2FJ7A 4XZQA 3VH5A 1KX3C 1P3OC 1H3OA 3AZLA 3NQUA 5AVBD 4JJNC 3AV1C 5GXQC 3X1UB 3KWQD 5BS7C 1P3GC 1P3OB 5E5AD 5AV8B 3C1BA 1ZLAD 4X23A 5CPJD 3AYWA 5GT0A 2CV5C 1P3BD 4UUZA 3X1VA 3RELC 5GXQB 5B1MA 5JRGD 4H9RA 2F8NK 4EO5B 1P3GB 3MGPD 3O62C 4G91B 2L5AA 3AZHB 1P3LA 4WJ3C 1EQZC 3WTPD 5B33C 3EPHA 4YM6C 2AROA 3O62B 3AN2C 4H9SA 1ID3B 1EQZB 3LJAC 1KX3D 5BO0A 5B33B 3LZ0B 4WU8A 4YM6B 4JJND 3AV1D 5AY8A 1P34A 3AZJB 1B6WA 3AN2B 4Z2MG 3AZIC 3UT9B 4H9QA 4Z66B 5CPKC 1P3GD 1M18A 4Z2MH 5B0ZD 3AZKC 3VH5T 4YS3C 3TU4B 5B1LB 2CV5D 3RELD 2Y2JA 3REKA 1JFIB 3EG5B 1WWIA 2Y2GA 3EPJA 3O62D 3KXBA 4YS3B 1P3PC 3WAAA 4XUJC 3W99A 1P3AA 4Z5TA 5BNVB 2FJ7B 2NZDC 5CP6D 3B0CT 4LD9D 1H3OB 3MVDD 2ZY5A 3AN2D 1P3PB 4XUJB 5B0YA 3C1CC 3LJAD 2NZDB 1HQ3C 5DNNC 5AV6D 3AYWB 5B24C 1KX4A 5B32G 5B32C 3X1VB 4J8XC 1P3FC 3AZID 2VQRA 5E5AA 5CPKD 4H9RB 5GSUA 1ZLAA 3AZKD 5DNNB 2NQBA 1KX5A 2YFVA 3WKJA 5AVCA 1P3FB 4J8XB 5BNXA 5DNMA 1U35C 4WU9C 2AROB 3LELD 3AZEC 2RIQA 2NZDD 2DQNC 4HGAB 3UTBC 3MNNA 1Z2CB 5B2JC 4J8UD 4H9PA 3EPLA 3AZEB 1S32A 4QLCA 1TZYC 1KX3A 3C1CD 4ZBJC 1HQ3D 1M18B 5DNND 2Y2LA 3UTBB 3B6GA 3MGRC 5B24D 3VH6W 3W98D 3REHC 1F66C 5B32D 5B31G 5B0ZA 5G49A 1TZYB 3REKB 4ZBJB 3UTAC 1AOIA 3A1KA 4CSRA 2ZY4A 3MGRB 5B2IC 4DQYB 2F8NH 3W99B 5CPIA 1P3AB 5GT3D 2JCHA 1M1AA 3AV2C 3AZGC 2G5HC 2YFWA 3R45A 1P3IC 3UTAB 1HTAA 3A6ND 4WU9D 4CAYB 2F8NB 5KDMA 5B2IB 5CP6A 4LD9A 3AZGB 3MVDA 4ZUXA 3UTBD 3AZFA 5AV8C 1P3IB 4J8VC 1R4VA 3V9RA 1P3MC 5B2JD 5AV5D 2BYMA 5AV6A 1U35D 5GSUB 4EO5C 3WTPE 2NQBB 4J8VB 4J8WA 4G91C 3REIC 3WKJB 3REHD 3AZHC 3LZ1D 1P3MB 1F66D 5AVCB 5B31D 3AFAA 5BNXB 5DNMB 3X1TB 2F8ND 2PYOA 5AV9A 3REIB 3REJD 3AV2D 4DRBA 1ID3C 1F1EA 2HIOC 1P3ID 3LZ0C 3LELA 3MNNB 2JE5A 2RVQC 3KUYC 3AZJC 1S32B 4H9PB 4KHAA 3X1UD 4QLCB 3UT9C 3AZMC 3IP4C 4Z66C 2HIOB 1P3OD 3X1SA 5AV8D 3W97A 4J8UA 3TU4C 5B1LC 3C1CA 2HUEC 3WA9C 3W96B 3KUYB 3B0DC 3MGSC 1W2EA 5GXQD 1P3KC 3AZMB 5B40C 3H0LC 3W98A 4AWLC 1M19C 5CPIB 3AZHD 2HUEB 3WA9B 3B6FA 3B0DB 3AZNA 2FJ7C 3MGSB 1BH8A 1N1JA 2J8PA 1P3KB 3AZLC 3MGQA 5B40B 2F2AC 5GT3A 2XD1A 4KGCA 5F99A 4AWLB 3KFUG 5KDMB 1M19B 1PZRA 4R8PA 1ID3D 1EQZD 3A6NA 2HIOD 4XZQB 4KUDA 3AZFB 4WV4B 5B33D 3LZ0D 3AZLB 3C1BC 3NQUB 4YM6D 3AYWC 3KUYD 5GT0C 3AZJD 4H9OA 3X1VC 3UT9D 2Y2MA 2ZY2A 5B1MC 4Z66D 4WZSB 2Y2KA 5AVBA 3KSYA 3C1BB 5AV5A 5B1LD 3TU4D 4X23B 3KWQA 5GT0B 1U35A 1P3LC 2IO5C 3MGSD 4UUZB 5B1MB 1BH9A 5CPJA 2AROC 3LZ1A 4YS3D 2PYOB 5B31A 5AV9B 1P3BA 1M19D 5JRGA 2Y2HA 1P3LB 4H9SC 2FJ7D 2IO5B 4HGAC 3MGPA 5FUGA 3REJA 1P3PD 5AY8C 1P34C 4XUJD 1BFMA 3P5JB 3B0BA 3WTPA 1M18C 2JSSA 5BO0B 3X1SB 3W97B 1WWSA 3AYWD 3X1UA 4WU8B 5AY8B 1P34B 3X1VD 1P3OA 5B1MD 5AV8A 3REKC 1B67A 3AL0C 4H9QB 2ZM5A 4JJNA 3AV1A 3KXBC 3WAAC 3W99C 3VH6A 5GXQA 1P3AC 1P3LD 4Z5TC 1P3FD 5BS7A 4J8XD 3AZNB 1P3GA 1N1JB 4G92C 1P34D 3MGQB 5C3IC 2AROD 2F8NG 5F99B 2CV5A 4KGCB 2Y2NA 3KXBB 3WAAB 3RELA 5B0YC 4Z5TB 4G92B 3O62A 4DRAA 5C3IB 1ULYA 1KX4C 1EQZA 3AZED 5B0YB 2DF4C 5B33A 1M18D 5GSUC 2BG1A 1ZLAC 4YM6A 3AN2A 2LY8A 2NQBC 1KX5C 4WNNA 3WKJC 3KWQB 1KX4B 3LJAA 5AVCC 1TZYD 3REKD 5E5AB 5DNMC 1ZLAB 3X1TC 5CPJB 3MGRD 3KXBD 3WAAD 1P3BB 1KX5B 3W99D 2YFVB 3H0RC 3AZIA 1P3AD 1JFIA 5JRGB 5CPKA 3AZKA 3UTAD 4YS3A 2Y2OA 3MNNC 4H9NA 5B2ID 1S32C 5B0YD 3VH5W 4QLCC 3WTPB 3AZGD 3VH6T 3B6GC 1P3PA 4XUJA 1KX4D 3W96C 2NZDA 1KX3B 2W8SA 5B0ZC 2CWEA 5GSUD 1AOIC 3B0CW 4JJNB 4J8VD 3AV1B 1KX5D 2NQBD 3B6GB 3WKJD 3H0MC 5CPIC 1P3MD 1M1AC 5AVCD 1HQ3A 5DNNA 5B0ZB 4NE6A 5G49B 5DNMD 3KWQC 1AOIB 2BYKA 3X1TD 5B24A 3A1IA 4CSRB 2CV5B 5B32A 1P3FA 4M6BA 4J8XA 5CP6C 2Y2IA 3REID 3RELB 4LD9C 1M1AB 4XZQC 4UPKA 3MVDC 4ZUXC 2YFWB 3R45B 3AZFC 2Y2PA 5BT1C 3MNND 3FDDA 5CHLB 1S32D 5CP6B 4LD9B 4QLCD 1TAFA 5AV6C 4WU9A 3MVDB 4ZUXB 3B6GD 3AZEA 4J8WC 4WNNB 4X23C 2RVQD 3W96D 1A7WA 3V9RB 3LJAB 3UTBA 2BYMB 3AFAC 3AZMD 5AV6B 1AOID 5B2JA 2PYOC 5AV9C 4J8WB 2Y2QA 1TZYA 3AZIB 5CPID 3WA9D 1M1AD 5CPKB 3NQJA 3AZKB 1P3KD 3AFAB 3MGRA 5B40D 3LELC 3REHA 1F66A 4H9NB 5JA4A 4E45A 3UTAA 4XZQD 4ZUXD 4CAYA 2F8NA 3AZFD 3AZLD 3X1SC 5B2IA 3W97C 3LELB 5BT1D 4J8UC 4WU8C 3AV2A 3AZGA 4NE3A 4KHAB 1P3IA 3W98C 3C1BD 1T3UA 4J8WD 4J8UB 4X23D 5GT0D 3C1CB 4NFTA 3B6FC 1HQ3B 3AZNC 3AFAD 4J8VA 3MGQC 2BYKB 5GT3C 5B24B 1P3MA 5F99C 3W98B 2PYOD 5B32B 5AV9D 4KGCC 2ZY3A 4R8PC 3B6FB 3A6NC 2FFFB 2XD5A 1BH8B 3X1TA 4KUDC 2G5IC 3REIA 5GT3B 3AZHA 3F6TA 3EPKA 1TAFB 4R8PB 3A6NB 4WU9B 5AVBC 3X1SD 4KUDB 3W97D 5AV5C 4WU8D 1Q9CA 5AY8D 1ID3A
chains in the Genus database with same CATH topology
2HIOA 4E44A 4H9OB 5E5AC 3LZ0A 5AVBB 3W96A 5CPJC 3KUYA 3LZ1C 3AZJA 5B2JB 5B31C 5AV5B 1P3BC 3UT9A 1KU5A 3AZMA 4Z66A 5JRGC 1U35B 3AZND 3B6FD 3NQJB 3MGPC 4NE5A 3MGQD 3TU4A 5B1LA 2UWXA 1BH9B 3WA9A 3REJC 5F99D 3REHB 1F66B 3LZ1B 4KGCD 3MGSA 5B31B 1P3KA 5JA4B 4R8PD 4Z5TD 3WTPC 5B40A 4KUDD 3MGPB 1M19A 5FUGB 3X1UC 3REJB 3AV2B 5BNVA 2FJ7A 4XZQA 3VH5A 1KX3C 1P3OC 1H3OA 3AZLA 3NQUA 5AVBD 4JJNC 3AV1C 5GXQC 3X1UB 3KWQD 5BS7C 1P3GC 1P3OB 5E5AD 5AV8B 3C1BA 1ZLAD 4X23A 5CPJD 3AYWA 5GT0A 2CV5C 1P3BD 4UUZA 3X1VA 3RELC 5GXQB 5B1MA 5JRGD 4H9RA 2F8NK 4EO5B 1P3GB 3MGPD 3O62C 4G91B 2L5AA 3AZHB 1P3LA 4WJ3C 1EQZC 3WTPD 5B33C 3EPHA 4YM6C 2AROA 3O62B 3AN2C 4H9SA 1ID3B 1EQZB 3LJAC 1KX3D 5BO0A 5B33B 3LZ0B 4WU8A 4YM6B 4JJND 3AV1D 5AY8A 1P34A 3AZJB 1B6WA 3AN2B 4Z2MG 3AZIC 3UT9B 4H9QA 4Z66B 5CPKC 1P3GD 1M18A 4Z2MH 5B0ZD 3AZKC 3VH5T 4YS3C 3TU4B 5B1LB 2CV5D 3RELD 2Y2JA 3REKA 1JFIB 3EG5B 1WWIA 2Y2GA 3EPJA 3O62D 3KXBA 4YS3B 1P3PC 3WAAA 4XUJC 3W99A 1P3AA 4Z5TA 5BNVB 2FJ7B 2NZDC 5CP6D 3B0CT 4LD9D 1H3OB 3MVDD 2ZY5A 3AN2D 1P3PB 4XUJB 5B0YA 3C1CC 3LJAD 2NZDB 1HQ3C 5DNNC 5AV6D 3AYWB 5B24C 1KX4A 5B32G 5B32C 3X1VB 4J8XC 1P3FC 3AZID 2VQRA 5E5AA 5CPKD 4H9RB 5GSUA 1ZLAA 3AZKD 5DNNB 2NQBA 1KX5A 2YFVA 3WKJA 5AVCA 1P3FB 4J8XB 5BNXA 5DNMA 1U35C 4WU9C 2AROB 3LELD 3AZEC 2RIQA 2NZDD 2DQNC 4HGAB 3UTBC 3MNNA 1Z2CB 5B2JC 4J8UD 4H9PA 3EPLA 3AZEB 1S32A 4QLCA 1TZYC 1KX3A 3C1CD 4ZBJC 1HQ3D 1M18B 5DNND 2Y2LA 3UTBB 3B6GA 3MGRC 5B24D 3VH6W 3W98D 3REHC 1F66C 5B32D 5B31G 5B0ZA 5G49A 1TZYB 3REKB 4ZBJB 3UTAC 1AOIA 3A1KA 4CSRA 2ZY4A 3MGRB 5B2IC 4DQYB 2F8NH 3W99B 5CPIA 1P3AB 5GT3D 2JCHA 1M1AA 3AV2C 3AZGC 2G5HC 2YFWA 3R45A 1P3IC 3UTAB 1HTAA 3A6ND 4WU9D 4CAYB 2F8NB 5KDMA 5B2IB 5CP6A 4LD9A 3AZGB 3MVDA 4ZUXA 3UTBD 3AZFA 5AV8C 1P3IB 4J8VC 1R4VA 3V9RA 1P3MC 5B2JD 5AV5D 2BYMA 5AV6A 1U35D 5GSUB 4EO5C 3WTPE 2NQBB 4J8VB 4J8WA 4G91C 3REIC 3WKJB 3REHD 3AZHC 3LZ1D 1P3MB 1F66D 5AVCB 5B31D 3AFAA 5BNXB 5DNMB 3X1TB 2F8ND 2PYOA 5AV9A 3REIB 3REJD 3AV2D 4DRBA 1ID3C 1F1EA 2HIOC 1P3ID 3LZ0C 3LELA 3MNNB 2JE5A 2RVQC 3KUYC 3AZJC 1S32B 4H9PB 4KHAA 3X1UD 4QLCB 3UT9C 3AZMC 3IP4C 4Z66C 2HIOB 1P3OD 3X1SA 5AV8D 3W97A 4J8UA 3TU4C 5B1LC 3C1CA 2HUEC 3WA9C 3W96B 3KUYB 3B0DC 3MGSC 1W2EA 5GXQD 1P3KC 3AZMB 5B40C 3H0LC 3W98A 4AWLC 1M19C 5CPIB 3AZHD 2HUEB 3WA9B 3B6FA 3B0DB 3AZNA 2FJ7C 3MGSB 1BH8A 1N1JA 2J8PA 1P3KB 3AZLC 3MGQA 5B40B 2F2AC 5GT3A 2XD1A 4KGCA 5F99A 4AWLB 3KFUG 5KDMB 1M19B 1PZRA 4R8PA 1ID3D 1EQZD 3A6NA 2HIOD 4XZQB 4KUDA 3AZFB 4WV4B 5B33D 3LZ0D 3AZLB 3C1BC 3NQUB 4YM6D 3AYWC 3KUYD 5GT0C 3AZJD 4H9OA 3X1VC 3UT9D 2Y2MA 2ZY2A 5B1MC 4Z66D 4WZSB 2Y2KA 5AVBA 3KSYA 3C1BB 5AV5A 5B1LD 3TU4D 4X23B 3KWQA 5GT0B 1U35A 1P3LC 2IO5C 3MGSD 4UUZB 5B1MB 1BH9A 5CPJA 2AROC 3LZ1A 4YS3D 2PYOB 5B31A 5AV9B 1P3BA 1M19D 5JRGA 2Y2HA 1P3LB 4H9SC 2FJ7D 2IO5B 4HGAC 3MGPA 5FUGA 3REJA 1P3PD 5AY8C 1P34C 4XUJD 1BFMA 3P5JB 3B0BA 3WTPA 1M18C 2JSSA 5BO0B 3X1SB 3W97B 1WWSA 3AYWD 3X1UA 4WU8B 5AY8B 1P34B 3X1VD 1P3OA 5B1MD 5AV8A 3REKC 1B67A 3AL0C 4H9QB 2ZM5A 4JJNA 3AV1A 3KXBC 3WAAC 3W99C 3VH6A 5GXQA 1P3AC 1P3LD 4Z5TC 1P3FD 5BS7A 4J8XD 3AZNB 1P3GA 1N1JB 4G92C 1P34D 3MGQB 5C3IC 2AROD 2F8NG 5F99B 2CV5A 4KGCB 2Y2NA 3KXBB 3WAAB 3RELA 5B0YC 4Z5TB 4G92B 3O62A 4DRAA 5C3IB 1ULYA 1KX4C 1EQZA 3AZED 5B0YB 2DF4C 5B33A 1M18D 5GSUC 2BG1A 1ZLAC 4YM6A 3AN2A 2LY8A 2NQBC 1KX5C 4WNNA 3WKJC 3KWQB 1KX4B 3LJAA 5AVCC 1TZYD 3REKD 5E5AB 5DNMC 1ZLAB 3X1TC 5CPJB 3MGRD 3KXBD 3WAAD 1P3BB 1KX5B 3W99D 2YFVB 3H0RC 3AZIA 1P3AD 1JFIA 5JRGB 5CPKA 3AZKA 3UTAD 4YS3A 2Y2OA 3MNNC 4H9NA 5B2ID 1S32C 5B0YD 3VH5W 4QLCC 3WTPB 3AZGD 3VH6T 3B6GC 1P3PA 4XUJA 1KX4D 3W96C 2NZDA 1KX3B 2W8SA 5B0ZC 2CWEA 5GSUD 1AOIC 3B0CW 4JJNB 4J8VD 3AV1B 1KX5D 2NQBD 3B6GB 3WKJD 3H0MC 5CPIC 1P3MD 1M1AC 5AVCD 1HQ3A 5DNNA 5B0ZB 4NE6A 5G49B 5DNMD 3KWQC 1AOIB 2BYKA 3X1TD 5B24A 3A1IA 4CSRB 2CV5B 5B32A 1P3FA 4M6BA 4J8XA 5CP6C 2Y2IA 3REID 3RELB 4LD9C 1M1AB 4XZQC 4UPKA 3MVDC 4ZUXC 2YFWB 3R45B 3AZFC 2Y2PA 5BT1C 3MNND 3FDDA 5CHLB 1S32D 5CP6B 4LD9B 4QLCD 1TAFA 5AV6C 4WU9A 3MVDB 4ZUXB 3B6GD 3AZEA 4J8WC 4WNNB 4X23C 2RVQD 3W96D 1A7WA 3V9RB 3LJAB 3UTBA 2BYMB 3AFAC 3AZMD 5AV6B 1AOID 5B2JA 2PYOC 5AV9C 4J8WB 2Y2QA 1TZYA 3AZIB 5CPID 3WA9D 1M1AD 5CPKB 3NQJA 3AZKB 1P3KD 3AFAB 3MGRA 5B40D 3LELC 3REHA 1F66A 4H9NB 5JA4A 4E45A 3UTAA 4XZQD 4ZUXD 4CAYA 2F8NA 3AZFD 3AZLD 3X1SC 5B2IA 3W97C 3LELB 5BT1D 4J8UC 4WU8C 3AV2A 3AZGA 4NE3A 4KHAB 1P3IA 3W98C 3C1BD 1T3UA 4J8WD 4J8UB 4X23D 5GT0D 3C1CB 4NFTA 3B6FC 1HQ3B 3AZNC 3AFAD 4J8VA 3MGQC 2BYKB 5GT3C 5B24B 1P3MA 5F99C 3W98B 2PYOD 5B32B 5AV9D 4KGCC 2ZY3A 4R8PC 3B6FB 3A6NC 2FFFB 2XD5A 1BH8B 3X1TA 4KUDC 2G5IC 3REIA 5GT3B 3AZHA 3F6TA 3EPKA 1TAFB 4R8PB 3A6NB 4WU9B 5AVBC 3X1SD 4KUDB 3W97D 5AV5C 4WU8D 1Q9CA 5AY8D 1ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO A;  4E44 A;  4H9O B;  5E5A C;  3LZ0 A;  5AVB B;  3W96 A;  5CPJ C;  3KUY A;  3LZ1 C;  3AZJ A;  5B2J B;  5B31 C;  5AV5 B;  1P3B C;  3UT9 A;  1KU5 A;  3AZM A;  4Z66 A;  5JRG C;  1U35 B;  3AZN D;  3B6F D;  3NQJ B;  3MGP C;  4NE5 A;  3MGQ D;  3TU4 A;  5B1L A;  1BH9 B;  3WA9 A;  3REJ C;  5F99 D;  3REH B;  1F66 B;  3LZ1 B;  4KGC D;  3MGS A;  5B31 B;  1P3K A;  5JA4 B;  4R8P D;  4Z5T D;  3WTP C;  5B40 A;  4KUD D;  3MGP B;  1M19 A;  5FUG B;  3X1U C;  3REJ B;  3AV2 B;  5BNV A;  2FJ7 A;  4XZQ A;  3VH5 A;  1KX3 C;  1P3O C;  1H3O A;  3AZL A;  3NQU A;  5AVB D;  4JJN C;  3AV1 C;  5GXQ C;  3X1U B;  3KWQ D;  5BS7 C;  1P3G C;  1P3O B;  5E5A D;  5AV8 B;  3C1B A;  1ZLA D;  4X23 A;  5CPJ D;  3AYW A;  5GT0 A;  2CV5 C;  1P3B D;  4UUZ A;  3X1V A;  3REL C;  5GXQ B;  5B1M A;  5JRG D;  4H9R A;  2F8N K;  4EO5 B;  1P3G B;  3MGP D;  3O62 C;  4G91 B;  2L5A A;  3AZH B;  1P3L A;  1EQZ C;  3WTP D;  5B33 C;  4YM6 C;  2ARO A;  3O62 B;  3AN2 C;  4H9S A;  1ID3 B;  1EQZ B;  3LJA C;  1KX3 D;  5BO0 A;  5B33 B;  3LZ0 B;  4WU8 A;  4YM6 B;  4JJN D;  3AV1 D;  5AY8 A;  1P34 A;  3AZJ B;  1B6W A;  3AN2 B;  4Z2M G;  3AZI C;  3UT9 B;  4H9Q A;  4Z66 B;  5CPK C;  1P3G D;  1M18 A;  4Z2M H;  5B0Z D;  3AZK C;  3VH5 T;  4YS3 C;  3TU4 B;  5B1L B;  2CV5 D;  3REL D;  1JFI B;  3REK A;  1WWI A;  3O62 D;  3KXB A;  4YS3 B;  1P3P C;  3WAA A;  4XUJ C;  3W99 A;  1P3A A;  4Z5T A;  5BNV B;  2FJ7 B;  2NZD C;  5CP6 D;  3B0C T;  4LD9 D;  1H3O B;  3MVD D;  3AN2 D;  1P3P B;  4XUJ B;  5B0Y A;  3C1C C;  3LJA D;  2NZD B;  1HQ3 C;  5DNN C;  5AV6 D;  3AYW B;  5B24 C;  1KX4 A;  5B32 G;  5B32 C;  3X1V B;  4J8X C;  1P3F C;  3AZI D;  5E5A A;  5CPK D;  4H9R B;  5GSU A;  1ZLA A;  3AZK D;  5DNN B;  2NQB A;  1KX5 A;  2YFV A;  3WKJ A;  5AVC A;  1P3F B;  4J8X B;  5BNX A;  5DNM A;  1U35 C;  4WU9 C;  2ARO B;  3LEL D;  3AZE C;  2NZD D;  4HGA B;  3UTB C;  3MNN A;  1S32 A;  5B2J C;  4J8U D;  4H9P A;  3AZE B;  1KX3 A;  4QLC A;  1TZY C;  3C1C D;  4ZBJ C;  1HQ3 D;  1M18 B;  5DNN D;  3UTB B;  3B6G A;  3MGR C;  5B24 D;  3VH6 W;  3W98 D;  3REH C;  1F66 C;  5B32 D;  5B31 G;  5B0Z A;  5G49 A;  1TZY B;  3REK B;  4ZBJ B;  3UTA C;  1AOI A;  4CSR A;  3MGR B;  5B2I C;  2F8N H;  3W99 B;  5CPI A;  1P3A B;  5GT3 D;  1M1A A;  3AV2 C;  3AZG C;  2YFW A;  3R45 A;  1P3I C;  3UTA B;  1HTA A;  3A6N D;  4WU9 D;  4CAY B;  2F8N B;  5KDM A;  5B2I B;  5CP6 A;  4LD9 A;  3AZG B;  3MVD A;  4ZUX A;  3UTB D;  3AZF A;  5AV8 C;  1P3I B;  4J8V C;  1R4V A;  3V9R A;  1P3M C;  5B2J D;  5AV5 D;  2BYM A;  5AV6 A;  1U35 D;  5GSU B;  4EO5 C;  3WTP E;  2NQB B;  4J8V B;  4J8W A;  4G91 C;  3REI C;  3WKJ B;  3REH D;  3AZH C;  3LZ1 D;  1P3M B;  1F66 D;  5AVC B;  5B31 D;  3AFA A;  5BNX B;  5DNM B;  3X1T B;  2F8N D;  2PYO A;  5AV9 A;  3REI B;  3REJ D;  3AV2 D;  4DRB A;  1ID3 C;  1F1E A;  2HIO C;  1P3I D;  3LZ0 C;  3LEL A;  3MNN B;  2RVQ C;  3KUY C;  3AZJ C;  1S32 B;  4H9P B;  4KHA A;  3X1U D;  4QLC B;  3UT9 C;  3AZM C;  4Z66 C;  2HIO B;  1P3O D;  3X1S A;  5AV8 D;  3W97 A;  4J8U A;  3TU4 C;  5B1L C;  3C1C A;  2HUE C;  3WA9 C;  3W96 B;  3KUY B;  3B0D C;  3MGS C;  5GXQ D;  1P3K C;  3AZM B;  5B40 C;  3W98 A;  4AWL C;  1M19 C;  5CPI B;  3AZH D;  2HUE B;  3WA9 B;  3B6F A;  3B0D B;  3AZN A;  2FJ7 C;  3MGS B;  1BH8 A;  1N1J A;  1P3K B;  3AZL C;  3MGQ A;  5B40 B;  5GT3 A;  4KGC A;  5F99 A;  4AWL B;  5KDM B;  1M19 B;  4R8P A;  1ID3 D;  1EQZ D;  3A6N A;  2HIO D;  4XZQ B;  4KUD A;  3AZF B;  4WV4 B;  5B33 D;  3LZ0 D;  3AZL B;  3C1B C;  3NQU B;  4YM6 D;  3AYW C;  3KUY D;  5GT0 C;  3AZJ D;  4H9O A;  3X1V C;  3UT9 D;  5B1M C;  4Z66 D;  4WZS B;  5AVB A;  3KSY A;  3C1B B;  5AV5 A;  5B1L D;  3TU4 D;  4X23 B;  3KWQ A;  5GT0 B;  1U35 A;  1P3L C;  2IO5 C;  3MGS D;  4UUZ B;  5B1M B;  1BH9 A;  5CPJ A;  2ARO C;  3LZ1 A;  4YS3 D;  2PYO B;  5B31 A;  5AV9 B;  1P3B A;  1M19 D;  5JRG A;  1P3L B;  4H9S C;  2FJ7 D;  2IO5 B;  4HGA C;  3MGP A;  5FUG A;  3REJ A;  1P3P D;  5AY8 C;  1P34 C;  4XUJ D;  1BFM A;  3B0B A;  3WTP A;  1M18 C;  2JSS A;  5BO0 B;  3X1S B;  3W97 B;  1WWS A;  3AYW D;  3X1U A;  4WU8 B;  5AY8 B;  1P34 B;  3X1V D;  1P3O A;  5B1M D;  5AV8 A;  3REK C;  1B67 A;  4H9Q B;  4JJN A;  3AV1 A;  3KXB C;  3WAA C;  3W99 C;  3VH6 A;  5GXQ A;  1P3A C;  1P3L D;  4Z5T C;  1P3F D;  5BS7 A;  4J8X D;  3AZN B;  1P3G A;  1N1J B;  4G92 C;  1P34 D;  3MGQ B;  5C3I C;  2ARO D;  2F8N G;  5F99 B;  2CV5 A;  4KGC B;  3KXB B;  3WAA B;  3REL A;  5B0Y C;  4Z5T B;  4G92 B;  3O62 A;  4DRA A;  5C3I B;  1ULY A;  1KX4 C;  1EQZ A;  3AZE D;  5B0Y B;  5B33 A;  1M18 D;  5GSU C;  1ZLA C;  4YM6 A;  3AN2 A;  2LY8 A;  2NQB C;  1KX5 C;  4WNN A;  3WKJ C;  3KWQ B;  1KX4 B;  3LJA A;  5AVC C;  1TZY D;  3REK D;  5E5A B;  5DNM C;  1ZLA B;  3X1T C;  5CPJ B;  3MGR D;  3KXB D;  3WAA D;  1P3B B;  1KX5 B;  3W99 D;  2YFV B;  3AZI A;  1P3A D;  1JFI A;  5JRG B;  5CPK A;  3AZK A;  3UTA D;  4YS3 A;  3MNN C;  4H9N A;  5B2I D;  1S32 C;  5B0Y D;  3VH5 W;  4QLC C;  3WTP B;  3AZG D;  3VH6 T;  3B6G C;  1P3P A;  4XUJ A;  1KX4 D;  3W96 C;  2NZD A;  1KX3 B;  5B0Z C;  2CWE A;  5GSU D;  1AOI C;  3B0C W;  4JJN B;  4J8V D;  3AV1 B;  1KX5 D;  2NQB D;  3B6G B;  3WKJ D;  5CPI C;  1P3M D;  1M1A C;  5AVC D;  1HQ3 A;  5DNN A;  5B0Z B;  4NE6 A;  5G49 B;  5DNM D;  3KWQ C;  1AOI B;  2BYK A;  3X1T D;  5B24 A;  4CSR B;  2CV5 B;  5B32 A;  1P3F A;  4M6B A;  4J8X A;  5CP6 C;  3REI D;  3REL B;  4LD9 C;  1M1A B;  4XZQ C;  3MVD C;  4ZUX C;  2YFW B;  3R45 B;  3AZF C;  5BT1 C;  3MNN D;  5CHL B;  1S32 D;  5CP6 B;  4LD9 B;  4QLC D;  1TAF A;  5AV6 C;  4WU9 A;  3MVD B;  4ZUX B;  3B6G D;  3AZE A;  4J8W C;  4WNN B;  4X23 C;  2RVQ D;  3W96 D;  1A7W A;  3V9R B;  3LJA B;  3UTB A;  2BYM B;  3AFA C;  3AZM D;  5AV6 B;  1AOI D;  5B2J A;  2PYO C;  5AV9 C;  4J8W B;  1TZY A;  3AZI B;  5CPI D;  3WA9 D;  1M1A D;  5CPK B;  3NQJ A;  3AZK B;  1P3K D;  3AFA B;  3MGR A;  5B40 D;  3LEL C;  3REH A;  1F66 A;  4H9N B;  5JA4 A;  4E45 A;  3UTA A;  4XZQ D;  4ZUX D;  4CAY A;  2F8N A;  3AZF D;  3AZL D;  3X1S C;  5B2I A;  3W97 C;  3LEL B;  5BT1 D;  4J8U C;  4WU8 C;  3AV2 A;  3AZG A;  4NE3 A;  4KHA B;  1P3I A;  3W98 C;  3C1B D;  4J8W D;  4J8U B;  4X23 D;  5GT0 D;  3C1C B;  4NFT A;  3B6F C;  1HQ3 B;  3AZN C;  3AFA D;  4J8V A;  3MGQ C;  2BYK B;  5GT3 C;  5B24 B;  1P3M A;  5F99 C;  3W98 B;  2PYO D;  5B32 B;  5AV9 D;  4KGC C;  4R8P C;  3B6F B;  3A6N C;  3X1T A;  1BH8 B;  4KUD C;  3REI A;  5GT3 B;  3AZH A;  1TAF B;  4R8P B;  3A6N B;  4WU9 B;  5AVB C;  3X1S D;  4KUD B;  3W97 D;  5AV5 C;  4WU8 D;  1Q9C A;  5AY8 D;  1ID3 A; 
#chains in the Genus database with same CATH topology
 2HIO A;  4E44 A;  4H9O B;  5E5A C;  3LZ0 A;  5AVB B;  3W96 A;  5CPJ C;  3KUY A;  3LZ1 C;  3AZJ A;  5B2J B;  5B31 C;  5AV5 B;  1P3B C;  3UT9 A;  1KU5 A;  3AZM A;  4Z66 A;  5JRG C;  1U35 B;  3AZN D;  3B6F D;  3NQJ B;  3MGP C;  4NE5 A;  3MGQ D;  3TU4 A;  5B1L A;  2UWX A;  1BH9 B;  3WA9 A;  3REJ C;  5F99 D;  3REH B;  1F66 B;  3LZ1 B;  4KGC D;  3MGS A;  5B31 B;  1P3K A;  5JA4 B;  4R8P D;  4Z5T D;  3WTP C;  5B40 A;  4KUD D;  3MGP B;  1M19 A;  5FUG B;  3X1U C;  3REJ B;  3AV2 B;  5BNV A;  2FJ7 A;  4XZQ A;  3VH5 A;  1KX3 C;  1P3O C;  1H3O A;  3AZL A;  3NQU A;  5AVB D;  4JJN C;  3AV1 C;  5GXQ C;  3X1U B;  3KWQ D;  5BS7 C;  1P3G C;  1P3O B;  5E5A D;  5AV8 B;  3C1B A;  1ZLA D;  4X23 A;  5CPJ D;  3AYW A;  5GT0 A;  2CV5 C;  1P3B D;  4UUZ A;  3X1V A;  3REL C;  5GXQ B;  5B1M A;  5JRG D;  4H9R A;  2F8N K;  4EO5 B;  1P3G B;  3MGP D;  3O62 C;  4G91 B;  2L5A A;  3AZH B;  1P3L A;  4WJ3 C;  1EQZ C;  3WTP D;  5B33 C;  3EPH A;  4YM6 C;  2ARO A;  3O62 B;  3AN2 C;  4H9S A;  1ID3 B;  1EQZ B;  3LJA C;  1KX3 D;  5BO0 A;  5B33 B;  3LZ0 B;  4WU8 A;  4YM6 B;  4JJN D;  3AV1 D;  5AY8 A;  1P34 A;  3AZJ B;  1B6W A;  3AN2 B;  4Z2M G;  3AZI C;  3UT9 B;  4H9Q A;  4Z66 B;  5CPK C;  1P3G D;  1M18 A;  4Z2M H;  5B0Z D;  3AZK C;  3VH5 T;  4YS3 C;  3TU4 B;  5B1L B;  2CV5 D;  3REL D;  2Y2J A;  3REK A;  1JFI B;  3EG5 B;  1WWI A;  2Y2G A;  3EPJ A;  3O62 D;  3KXB A;  4YS3 B;  1P3P C;  3WAA A;  4XUJ C;  3W99 A;  1P3A A;  4Z5T A;  5BNV B;  2FJ7 B;  2NZD C;  5CP6 D;  3B0C T;  4LD9 D;  1H3O B;  3MVD D;  2ZY5 A;  3AN2 D;  1P3P B;  4XUJ B;  5B0Y A;  3C1C C;  3LJA D;  2NZD B;  1HQ3 C;  5DNN C;  5AV6 D;  3AYW B;  5B24 C;  1KX4 A;  5B32 G;  5B32 C;  3X1V B;  4J8X C;  1P3F C;  3AZI D;  2VQR A;  5E5A A;  5CPK D;  4H9R B;  5GSU A;  1ZLA A;  3AZK D;  5DNN B;  2NQB A;  1KX5 A;  2YFV A;  3WKJ A;  5AVC A;  1P3F B;  4J8X B;  5BNX A;  5DNM A;  1U35 C;  4WU9 C;  2ARO B;  3LEL D;  3AZE C;  2RIQ A;  2NZD D;  2DQN C;  4HGA B;  3UTB C;  3MNN A;  1Z2C B;  5B2J C;  4J8U D;  4H9P A;  3EPL A;  3AZE B;  1S32 A;  4QLC A;  1TZY C;  1KX3 A;  3C1C D;  4ZBJ C;  1HQ3 D;  1M18 B;  5DNN D;  2Y2L A;  3UTB B;  3B6G A;  3MGR C;  5B24 D;  3VH6 W;  3W98 D;  3REH C;  1F66 C;  5B32 D;  5B31 G;  5B0Z A;  5G49 A;  1TZY B;  3REK B;  4ZBJ B;  3UTA C;  1AOI A;  3A1K A;  4CSR A;  2ZY4 A;  3MGR B;  5B2I C;  4DQY B;  2F8N H;  3W99 B;  5CPI A;  1P3A B;  5GT3 D;  2JCH A;  1M1A A;  3AV2 C;  3AZG C;  2G5H C;  2YFW A;  3R45 A;  1P3I C;  3UTA B;  1HTA A;  3A6N D;  4WU9 D;  4CAY B;  2F8N B;  5KDM A;  5B2I B;  5CP6 A;  4LD9 A;  3AZG B;  3MVD A;  4ZUX A;  3UTB D;  3AZF A;  5AV8 C;  1P3I B;  4J8V C;  1R4V A;  3V9R A;  1P3M C;  5B2J D;  5AV5 D;  2BYM A;  5AV6 A;  1U35 D;  5GSU B;  4EO5 C;  3WTP E;  2NQB B;  4J8V B;  4J8W A;  4G91 C;  3REI C;  3WKJ B;  3REH D;  3AZH C;  3LZ1 D;  1P3M B;  1F66 D;  5AVC B;  5B31 D;  3AFA A;  5BNX B;  5DNM B;  3X1T B;  2F8N D;  2PYO A;  5AV9 A;  3REI B;  3REJ D;  3AV2 D;  4DRB A;  1ID3 C;  1F1E A;  2HIO C;  1P3I D;  3LZ0 C;  3LEL A;  3MNN B;  2JE5 A;  2RVQ C;  3KUY C;  3AZJ C;  1S32 B;  4H9P B;  4KHA A;  3X1U D;  4QLC B;  3UT9 C;  3AZM C;  3IP4 C;  4Z66 C;  2HIO B;  1P3O D;  3X1S A;  5AV8 D;  3W97 A;  4J8U A;  3TU4 C;  5B1L C;  3C1C A;  2HUE C;  3WA9 C;  3W96 B;  3KUY B;  3B0D C;  3MGS C;  1W2E A;  5GXQ D;  1P3K C;  3AZM B;  5B40 C;  3H0L C;  3W98 A;  4AWL C;  1M19 C;  5CPI B;  3AZH D;  2HUE B;  3WA9 B;  3B6F A;  3B0D B;  3AZN A;  2FJ7 C;  3MGS B;  1BH8 A;  1N1J A;  2J8P A;  1P3K B;  3AZL C;  3MGQ A;  5B40 B;  2F2A C;  5GT3 A;  2XD1 A;  4KGC A;  5F99 A;  4AWL B;  3KFU G;  5KDM B;  1M19 B;  1PZR A;  4R8P A;  1ID3 D;  1EQZ D;  3A6N A;  2HIO D;  4XZQ B;  4KUD A;  3AZF B;  4WV4 B;  5B33 D;  3LZ0 D;  3AZL B;  3C1B C;  3NQU B;  4YM6 D;  3AYW C;  3KUY D;  5GT0 C;  3AZJ D;  4H9O A;  3X1V C;  3UT9 D;  2Y2M A;  2ZY2 A;  5B1M C;  4Z66 D;  4WZS B;  2Y2K A;  5AVB A;  3KSY A;  3C1B B;  5AV5 A;  5B1L D;  3TU4 D;  4X23 B;  3KWQ A;  5GT0 B;  1U35 A;  1P3L C;  2IO5 C;  3MGS D;  4UUZ B;  5B1M B;  1BH9 A;  5CPJ A;  2ARO C;  3LZ1 A;  4YS3 D;  2PYO B;  5B31 A;  5AV9 B;  1P3B A;  1M19 D;  5JRG A;  2Y2H A;  1P3L B;  4H9S C;  2FJ7 D;  2IO5 B;  4HGA C;  3MGP A;  5FUG A;  3REJ A;  1P3P D;  5AY8 C;  1P34 C;  4XUJ D;  1BFM A;  3P5J B;  3B0B A;  3WTP A;  1M18 C;  2JSS A;  5BO0 B;  3X1S B;  3W97 B;  1WWS A;  3AYW D;  3X1U A;  4WU8 B;  5AY8 B;  1P34 B;  3X1V D;  1P3O A;  5B1M D;  5AV8 A;  3REK C;  1B67 A;  3AL0 C;  4H9Q B;  2ZM5 A;  4JJN A;  3AV1 A;  3KXB C;  3WAA C;  3W99 C;  3VH6 A;  5GXQ A;  1P3A C;  1P3L D;  4Z5T C;  1P3F D;  5BS7 A;  4J8X D;  3AZN B;  1P3G A;  1N1J B;  4G92 C;  1P34 D;  3MGQ B;  5C3I C;  2ARO D;  2F8N G;  5F99 B;  2CV5 A;  4KGC B;  2Y2N A;  3KXB B;  3WAA B;  3REL A;  5B0Y C;  4Z5T B;  4G92 B;  3O62 A;  4DRA A;  5C3I B;  1ULY A;  1KX4 C;  1EQZ A;  3AZE D;  5B0Y B;  2DF4 C;  5B33 A;  1M18 D;  5GSU C;  2BG1 A;  1ZLA C;  4YM6 A;  3AN2 A;  2LY8 A;  2NQB C;  1KX5 C;  4WNN A;  3WKJ C;  3KWQ B;  1KX4 B;  3LJA A;  5AVC C;  1TZY D;  3REK D;  5E5A B;  5DNM C;  1ZLA B;  3X1T C;  5CPJ B;  3MGR D;  3KXB D;  3WAA D;  1P3B B;  1KX5 B;  3W99 D;  2YFV B;  3H0R C;  3AZI A;  1P3A D;  1JFI A;  5JRG B;  5CPK A;  3AZK A;  3UTA D;  4YS3 A;  2Y2O A;  3MNN C;  4H9N A;  5B2I D;  1S32 C;  5B0Y D;  3VH5 W;  4QLC C;  3WTP B;  3AZG D;  3VH6 T;  3B6G C;  1P3P A;  4XUJ A;  1KX4 D;  3W96 C;  2NZD A;  1KX3 B;  2W8S A;  5B0Z C;  2CWE A;  5GSU D;  1AOI C;  3B0C W;  4JJN B;  4J8V D;  3AV1 B;  1KX5 D;  2NQB D;  3B6G B;  3WKJ D;  3H0M C;  5CPI C;  1P3M D;  1M1A C;  5AVC D;  1HQ3 A;  5DNN A;  5B0Z B;  4NE6 A;  5G49 B;  5DNM D;  3KWQ C;  1AOI B;  2BYK A;  3X1T D;  5B24 A;  3A1I A;  4CSR B;  2CV5 B;  5B32 A;  1P3F A;  4M6B A;  4J8X A;  5CP6 C;  2Y2I A;  3REI D;  3REL B;  4LD9 C;  1M1A B;  4XZQ C;  4UPK A;  3MVD C;  4ZUX C;  2YFW B;  3R45 B;  3AZF C;  2Y2P A;  5BT1 C;  3MNN D;  3FDD A;  5CHL B;  1S32 D;  5CP6 B;  4LD9 B;  4QLC D;  1TAF A;  5AV6 C;  4WU9 A;  3MVD B;  4ZUX B;  3B6G D;  3AZE A;  4J8W C;  4WNN B;  4X23 C;  2RVQ D;  3W96 D;  1A7W A;  3V9R B;  3LJA B;  3UTB A;  2BYM B;  3AFA C;  3AZM D;  5AV6 B;  1AOI D;  5B2J A;  2PYO C;  5AV9 C;  4J8W B;  2Y2Q A;  1TZY A;  3AZI B;  5CPI D;  3WA9 D;  1M1A D;  5CPK B;  3NQJ A;  3AZK B;  1P3K D;  3AFA B;  3MGR A;  5B40 D;  3LEL C;  3REH A;  1F66 A;  4H9N B;  5JA4 A;  4E45 A;  3UTA A;  4XZQ D;  4ZUX D;  4CAY A;  2F8N A;  3AZF D;  3AZL D;  3X1S C;  5B2I A;  3W97 C;  3LEL B;  5BT1 D;  4J8U C;  4WU8 C;  3AV2 A;  3AZG A;  4NE3 A;  4KHA B;  1P3I A;  3W98 C;  3C1B D;  1T3U A;  4J8W D;  4J8U B;  4X23 D;  5GT0 D;  3C1C B;  4NFT A;  3B6F C;  1HQ3 B;  3AZN C;  3AFA D;  4J8V A;  3MGQ C;  2BYK B;  5GT3 C;  5B24 B;  1P3M A;  5F99 C;  3W98 B;  2PYO D;  5B32 B;  5AV9 D;  4KGC C;  2ZY3 A;  4R8P C;  3B6F B;  3A6N C;  2FFF B;  2XD5 A;  1BH8 B;  3X1T A;  4KUD C;  2G5I C;  3REI A;  5GT3 B;  3AZH A;  3F6T A;  3EPK A;  1TAF B;  4R8P B;  3A6N B;  4WU9 B;  5AVB C;  3X1S D;  4KUD B;  3W97 D;  5AV5 C;  4WU8 D;  1Q9C A;  5AY8 D;  1ID3 A; 
#chains in the Genus database with same CATH homology
 2HIO A;  4E44 A;  4H9O B;  5E5A C;  3LZ0 A;  5AVB B;  3W96 A;  5CPJ C;  3KUY A;  3LZ1 C;  3AZJ A;  5B2J B;  5B31 C;  5AV5 B;  1P3B C;  3UT9 A;  1KU5 A;  3AZM A;  4Z66 A;  5JRG C;  1U35 B;  3AZN D;  3B6F D;  3NQJ B;  3MGP C;  4NE5 A;  3MGQ D;  3TU4 A;  5B1L A;  2UWX A;  1BH9 B;  3WA9 A;  3REJ C;  5F99 D;  3REH B;  1F66 B;  3LZ1 B;  4KGC D;  3MGS A;  5B31 B;  1P3K A;  5JA4 B;  4R8P D;  4Z5T D;  3WTP C;  5B40 A;  4KUD D;  3MGP B;  1M19 A;  5FUG B;  3X1U C;  3REJ B;  3AV2 B;  5BNV A;  2FJ7 A;  4XZQ A;  3VH5 A;  1KX3 C;  1P3O C;  1H3O A;  3AZL A;  3NQU A;  5AVB D;  4JJN C;  3AV1 C;  5GXQ C;  3X1U B;  3KWQ D;  5BS7 C;  1P3G C;  1P3O B;  5E5A D;  5AV8 B;  3C1B A;  1ZLA D;  4X23 A;  5CPJ D;  3AYW A;  5GT0 A;  2CV5 C;  1P3B D;  4UUZ A;  3X1V A;  3REL C;  5GXQ B;  5B1M A;  5JRG D;  4H9R A;  2F8N K;  4EO5 B;  1P3G B;  3MGP D;  3O62 C;  4G91 B;  2L5A A;  3AZH B;  1P3L A;  4WJ3 C;  1EQZ C;  3WTP D;  5B33 C;  3EPH A;  4YM6 C;  2ARO A;  3O62 B;  3AN2 C;  4H9S A;  1ID3 B;  1EQZ B;  3LJA C;  1KX3 D;  5BO0 A;  5B33 B;  3LZ0 B;  4WU8 A;  4YM6 B;  4JJN D;  3AV1 D;  5AY8 A;  1P34 A;  3AZJ B;  1B6W A;  3AN2 B;  4Z2M G;  3AZI C;  3UT9 B;  4H9Q A;  4Z66 B;  5CPK C;  1P3G D;  1M18 A;  4Z2M H;  5B0Z D;  3AZK C;  3VH5 T;  4YS3 C;  3TU4 B;  5B1L B;  2CV5 D;  3REL D;  2Y2J A;  3REK A;  1JFI B;  3EG5 B;  1WWI A;  2Y2G A;  3EPJ A;  3O62 D;  3KXB A;  4YS3 B;  1P3P C;  3WAA A;  4XUJ C;  3W99 A;  1P3A A;  4Z5T A;  5BNV B;  2FJ7 B;  2NZD C;  5CP6 D;  3B0C T;  4LD9 D;  1H3O B;  3MVD D;  2ZY5 A;  3AN2 D;  1P3P B;  4XUJ B;  5B0Y A;  3C1C C;  3LJA D;  2NZD B;  1HQ3 C;  5DNN C;  5AV6 D;  3AYW B;  5B24 C;  1KX4 A;  5B32 G;  5B32 C;  3X1V B;  4J8X C;  1P3F C;  3AZI D;  2VQR A;  5E5A A;  5CPK D;  4H9R B;  5GSU A;  1ZLA A;  3AZK D;  5DNN B;  2NQB A;  1KX5 A;  2YFV A;  3WKJ A;  5AVC A;  1P3F B;  4J8X B;  5BNX A;  5DNM A;  1U35 C;  4WU9 C;  2ARO B;  3LEL D;  3AZE C;  2RIQ A;  2NZD D;  2DQN C;  4HGA B;  3UTB C;  3MNN A;  1Z2C B;  5B2J C;  4J8U D;  4H9P A;  3EPL A;  3AZE B;  1S32 A;  4QLC A;  1TZY C;  1KX3 A;  3C1C D;  4ZBJ C;  1HQ3 D;  1M18 B;  5DNN D;  2Y2L A;  3UTB B;  3B6G A;  3MGR C;  5B24 D;  3VH6 W;  3W98 D;  3REH C;  1F66 C;  5B32 D;  5B31 G;  5B0Z A;  5G49 A;  1TZY B;  3REK B;  4ZBJ B;  3UTA C;  1AOI A;  3A1K A;  4CSR A;  2ZY4 A;  3MGR B;  5B2I C;  4DQY B;  2F8N H;  3W99 B;  5CPI A;  1P3A B;  5GT3 D;  2JCH A;  1M1A A;  3AV2 C;  3AZG C;  2G5H C;  2YFW A;  3R45 A;  1P3I C;  3UTA B;  1HTA A;  3A6N D;  4WU9 D;  4CAY B;  2F8N B;  5KDM A;  5B2I B;  5CP6 A;  4LD9 A;  3AZG B;  3MVD A;  4ZUX A;  3UTB D;  3AZF A;  5AV8 C;  1P3I B;  4J8V C;  1R4V A;  3V9R A;  1P3M C;  5B2J D;  5AV5 D;  2BYM A;  5AV6 A;  1U35 D;  5GSU B;  4EO5 C;  3WTP E;  2NQB B;  4J8V B;  4J8W A;  4G91 C;  3REI C;  3WKJ B;  3REH D;  3AZH C;  3LZ1 D;  1P3M B;  1F66 D;  5AVC B;  5B31 D;  3AFA A;  5BNX B;  5DNM B;  3X1T B;  2F8N D;  2PYO A;  5AV9 A;  3REI B;  3REJ D;  3AV2 D;  4DRB A;  1ID3 C;  1F1E A;  2HIO C;  1P3I D;  3LZ0 C;  3LEL A;  3MNN B;  2JE5 A;  2RVQ C;  3KUY C;  3AZJ C;  1S32 B;  4H9P B;  4KHA A;  3X1U D;  4QLC B;  3UT9 C;  3AZM C;  3IP4 C;  4Z66 C;  2HIO B;  1P3O D;  3X1S A;  5AV8 D;  3W97 A;  4J8U A;  3TU4 C;  5B1L C;  3C1C A;  2HUE C;  3WA9 C;  3W96 B;  3KUY B;  3B0D C;  3MGS C;  1W2E A;  5GXQ D;  1P3K C;  3AZM B;  5B40 C;  3H0L C;  3W98 A;  4AWL C;  1M19 C;  5CPI B;  3AZH D;  2HUE B;  3WA9 B;  3B6F A;  3B0D B;  3AZN A;  2FJ7 C;  3MGS B;  1BH8 A;  1N1J A;  2J8P A;  1P3K B;  3AZL C;  3MGQ A;  5B40 B;  2F2A C;  5GT3 A;  2XD1 A;  4KGC A;  5F99 A;  4AWL B;  3KFU G;  5KDM B;  1M19 B;  1PZR A;  4R8P A;  1ID3 D;  1EQZ D;  3A6N A;  2HIO D;  4XZQ B;  4KUD A;  3AZF B;  4WV4 B;  5B33 D;  3LZ0 D;  3AZL B;  3C1B C;  3NQU B;  4YM6 D;  3AYW C;  3KUY D;  5GT0 C;  3AZJ D;  4H9O A;  3X1V C;  3UT9 D;  2Y2M A;  2ZY2 A;  5B1M C;  4Z66 D;  4WZS B;  2Y2K A;  5AVB A;  3KSY A;  3C1B B;  5AV5 A;  5B1L D;  3TU4 D;  4X23 B;  3KWQ A;  5GT0 B;  1U35 A;  1P3L C;  2IO5 C;  3MGS D;  4UUZ B;  5B1M B;  1BH9 A;  5CPJ A;  2ARO C;  3LZ1 A;  4YS3 D;  2PYO B;  5B31 A;  5AV9 B;  1P3B A;  1M19 D;  5JRG A;  2Y2H A;  1P3L B;  4H9S C;  2FJ7 D;  2IO5 B;  4HGA C;  3MGP A;  5FUG A;  3REJ A;  1P3P D;  5AY8 C;  1P34 C;  4XUJ D;  1BFM A;  3P5J B;  3B0B A;  3WTP A;  1M18 C;  2JSS A;  5BO0 B;  3X1S B;  3W97 B;  1WWS A;  3AYW D;  3X1U A;  4WU8 B;  5AY8 B;  1P34 B;  3X1V D;  1P3O A;  5B1M D;  5AV8 A;  3REK C;  1B67 A;  3AL0 C;  4H9Q B;  2ZM5 A;  4JJN A;  3AV1 A;  3KXB C;  3WAA C;  3W99 C;  3VH6 A;  5GXQ A;  1P3A C;  1P3L D;  4Z5T C;  1P3F D;  5BS7 A;  4J8X D;  3AZN B;  1P3G A;  1N1J B;  4G92 C;  1P34 D;  3MGQ B;  5C3I C;  2ARO D;  2F8N G;  5F99 B;  2CV5 A;  4KGC B;  2Y2N A;  3KXB B;  3WAA B;  3REL A;  5B0Y C;  4Z5T B;  4G92 B;  3O62 A;  4DRA A;  5C3I B;  1ULY A;  1KX4 C;  1EQZ A;  3AZE D;  5B0Y B;  2DF4 C;  5B33 A;  1M18 D;  5GSU C;  2BG1 A;  1ZLA C;  4YM6 A;  3AN2 A;  2LY8 A;  2NQB C;  1KX5 C;  4WNN A;  3WKJ C;  3KWQ B;  1KX4 B;  3LJA A;  5AVC C;  1TZY D;  3REK D;  5E5A B;  5DNM C;  1ZLA B;  3X1T C;  5CPJ B;  3MGR D;  3KXB D;  3WAA D;  1P3B B;  1KX5 B;  3W99 D;  2YFV B;  3H0R C;  3AZI A;  1P3A D;  1JFI A;  5JRG B;  5CPK A;  3AZK A;  3UTA D;  4YS3 A;  2Y2O A;  3MNN C;  4H9N A;  5B2I D;  1S32 C;  5B0Y D;  3VH5 W;  4QLC C;  3WTP B;  3AZG D;  3VH6 T;  3B6G C;  1P3P A;  4XUJ A;  1KX4 D;  3W96 C;  2NZD A;  1KX3 B;  2W8S A;  5B0Z C;  2CWE A;  5GSU D;  1AOI C;  3B0C W;  4JJN B;  4J8V D;  3AV1 B;  1KX5 D;  2NQB D;  3B6G B;  3WKJ D;  3H0M C;  5CPI C;  1P3M D;  1M1A C;  5AVC D;  1HQ3 A;  5DNN A;  5B0Z B;  4NE6 A;  5G49 B;  5DNM D;  3KWQ C;  1AOI B;  2BYK A;  3X1T D;  5B24 A;  3A1I A;  4CSR B;  2CV5 B;  5B32 A;  1P3F A;  4M6B A;  4J8X A;  5CP6 C;  2Y2I A;  3REI D;  3REL B;  4LD9 C;  1M1A B;  4XZQ C;  4UPK A;  3MVD C;  4ZUX C;  2YFW B;  3R45 B;  3AZF C;  2Y2P A;  5BT1 C;  3MNN D;  3FDD A;  5CHL B;  1S32 D;  5CP6 B;  4LD9 B;  4QLC D;  1TAF A;  5AV6 C;  4WU9 A;  3MVD B;  4ZUX B;  3B6G D;  3AZE A;  4J8W C;  4WNN B;  4X23 C;  2RVQ D;  3W96 D;  1A7W A;  3V9R B;  3LJA B;  3UTB A;  2BYM B;  3AFA C;  3AZM D;  5AV6 B;  1AOI D;  5B2J A;  2PYO C;  5AV9 C;  4J8W B;  2Y2Q A;  1TZY A;  3AZI B;  5CPI D;  3WA9 D;  1M1A D;  5CPK B;  3NQJ A;  3AZK B;  1P3K D;  3AFA B;  3MGR A;  5B40 D;  3LEL C;  3REH A;  1F66 A;  4H9N B;  5JA4 A;  4E45 A;  3UTA A;  4XZQ D;  4ZUX D;  4CAY A;  2F8N A;  3AZF D;  3AZL D;  3X1S C;  5B2I A;  3W97 C;  3LEL B;  5BT1 D;  4J8U C;  4WU8 C;  3AV2 A;  3AZG A;  4NE3 A;  4KHA B;  1P3I A;  3W98 C;  3C1B D;  1T3U A;  4J8W D;  4J8U B;  4X23 D;  5GT0 D;  3C1C B;  4NFT A;  3B6F C;  1HQ3 B;  3AZN C;  3AFA D;  4J8V A;  3MGQ C;  2BYK B;  5GT3 C;  5B24 B;  1P3M A;  5F99 C;  3W98 B;  2PYO D;  5B32 B;  5AV9 D;  4KGC C;  2ZY3 A;  4R8P C;  3B6F B;  3A6N C;  2FFF B;  2XD5 A;  1BH8 B;  3X1T A;  4KUD C;  2G5I C;  3REI A;  5GT3 B;  3AZH A;  3F6T A;  3EPK A;  1TAF B;  4R8P B;  3A6N B;  4WU9 B;  5AVB C;  3X1S D;  4KUD B;  3W97 D;  5AV5 C;  4WU8 D;  1Q9C A;  5AY8 D;  1ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...