1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
3MGPD 3AZID 1P3FA 5JRGA 1EQZA 1KX5D 4R8PA 3UTBA 3AZJA 3WKJD 3AZED 5GT3A 5AY8B 3W98D 3KWQD 5CP6D 4CSRA 1Q9CA 4NE5A 5B2JD 3B6FC 4H9PB 5BO0B 5AV5A 5B33D 1HTAA 3AZMD 3B6FB 4JJND 4H9PA 5BO0A 3MGSA 5G49B 4ZBJC 5CPIC 4WU8C 1WWIA 3X1TC 3V9RA 5F99B 1P3GB 5AV9A 4XUJC 2HIOA 1M1AB 3UTAD 3X1TB 3W99A 2NQBD 5CPIA 4HGAC 4WU8A 5B32D 4XUJB 1B67A 4QLCD 3X1TA 5FUGA 4DRBA 5KDMA 4HGAB 1P3MC 5CPJD 3AV1C 4Z66D 1HQ3C 3B0CT 1P3MB 4H9SC 3X1UC 1BH8A 3NQJA 3LZ0B 3AZIA 2AROC 5B31G 3KXBA 1HQ3B 5B31A 4XZQD 1P3MA 4KGCC 3REHB 3X1UB 3AV1A 4H9SA 4KGCB 1P3LB 3X1UA 2F8ND 2AROA 4M6BA 4KGCA 3VH5W 1TAFB 4G92C 3VH6W 3A6NC 1BFMA 3NQUB 2RVQD 4YM6C 4J8UD 3UT9C 1TAFA 1P3KD 4G92B 4WNNB 3AYWC 3AZFD 4YM6B 4J8VC 4J8WB 3AN2D 1ZLAD 3AZLD 1M19C 3A6NA 3AYWB 1JFIA 3UT9A 5B1MC 4YS3D 3REIC 4J8VB 1P3IB 1KX4C 1B6WA 1KX3B 5E5AC 3AV2D 4H9QB 1M19B 5B0ZC 2PYOD 5B1MB 3AZND 3AZKD 1F1EA 5E5AB 3O62C 1F66D 4H9NB 3B6GC 3C1BC 5B24C 3REIA 3WA9D 1KX4A 5GT0B 3W97C 3LZ1C 5E5AA 1P34C 3O62B 5JRGD 5B0ZA 1P3FD 1EQZD 4H9NA 3TU4C 4R8PD 3C1BB 5B24B 3UTBD 3AZJD 5GT3D 3W97B 3LZ1B 2JSSA 3TU4B 3B6GA 3C1BA 5B24A 3C1CC 3LZ1A 1P34A 3X1VC 4J8XC 3WAAA 3LELC 3REJC 1N1JA 3B0BA 3C1CB 3X1VB 5AV5D 4J8XB 5GXQC 1M18B 3MGSD 3AFAC 4J8UA 3X1VA 4J8XA 3LELA 3REJA 3LJAC 4WV4B 4AWLC 3AFAB 5BT1C 3AZHA 1U35B 5B40C 1TZYC 4UUZB 3LJAB 5GXQA 1ID3B 3W99D 4AWLB 3AFAA 3VH6A 3KUYA 4WU8D 5CPID 4KUDB 4UUZA 1TZYB 3X1TD 1P3AC 1S32C 4KHAB 4Z5TC 5AV6C 1P3PC 5DNNB 1TZYA 5C3IC 5B40A 4ZUXB 1P3AB 1S32B 5CPKB 4Z5TB 5AV6B 5C3IB 5AY8C 4E45A 1P3AA 2YFWA 3VH6T 3R45B 1S32A 3KXBD 4Z5TA 5B31D 1P3MD 5AV6A 1P3PA 3AV1D 3REKC 3R45A 1HQ3D 1P3OC 3X1UD 5AY8A 2AROD 4DRAA 3REKB 4KGCD 1P3OB 2LY8A 1AOIC 4H9OB 5AVCC 1A7WA 5F99C 1P3GC 1AOIB 1M1AC 1KU5A 5AVCB 3B6FA 3MGQC 2NZDC 5G49A 5BNVB 3A6ND 3UT9D 3MGQB 5F99A 2NZDB 5BNVA 1P3GA 3AYWD 1M1AA 3MGQA 2NZDA 4XUJA 5DNMC 4LD9C 3LZ0C 3REID 1KX4D 1H3OB 5E5AD 5B0ZD 5DNMB 3REHC 4LD9B 4X23B 1P3LC 3B6GD 3W96C 3C1BD 5AVBC 4EO5B 5B24D 3WTPC 3LZ0A 4WU9C 3LZ1D 1P34D 1HQ3A 3REHA 3WAAD 3TU4D 3W96B 5AVBB 3AZGC 4WU9B 3WTPB 1P3LA 5JA4B 3MVDC 3W96A 3C1CD 3AZGB 3X1VD 4J8XD 1KX5B 4J8WC 3MVDB 4WZSB 3LELD 3REJD 3WKJB 3AZEB 3NQUA 4H9RB 3AZHD 1P3IC 3MVDA 3KWQB 4WNNA 1KX3C 5CP6B 5GXQD 4YM6A 3AFAD 2IO5B 3KUYD 4J8WA 5B2JB 3AYWA 5BT1D 1P3IA 4J8VA 5GT0C 5B40D 1TZYD 1KX3A 4H9QA 1M19A 2L5AA 2FJ7C 5B1MA 1P3BC 5BNXB 1P3AD 1S32D 2FJ7B 5B32C 4Z5TD 1P3BB 5AV6D 5GT0A 1P3PD 3O62A 3RELC 2FJ7A 5B32B 1P3BA 4QLCB 5CPJC 3W97A 5AY8D 4Z66C 3RELB 3TU4A 1M18C 5CPJB 1ULYA 3RELA 4Z66B 1WWSA 4XZQC 3C1CA 2BYMB 4E44A 1U35C 5B1LC 4XZQB 3B6FD 1M18A 1ID3C 4KUDC 1BH9B 5B1LB 5F99D 3VH5A 2F8NB 1P3GD 4G91B 2RVQC 1M1AD 1U35A 5DNNC 5B1LA 3LJAA 4ZUXC 1P3KC 3MGQD 1ID3A 2NZDD 4XUJD 5CPKC 4KUDA 1P3KB 4KHAA 3AZFB 4YS3C 5DNNA 4ZUXA 3MNNC 3VH5T 3AN2B 1ZLAB 3AZLB 5AV8C 5CPKA 4YS3B 3AZNC 3MNNB 3LZ0D 3AZKC 2CV5C 3AV2B 1F66C 4Z2MH 5AV8B 2PYOB 3REHD 3MNNA 3AZNB 3AZKB 2CV5B 5AV8A 1F66B 1P3LD 2BYKB 5B2IC 3W96D 3AZJC 3WA9B 2CV5A 3REKA 5JRGB 1P3OA 5B2IB 3UTBB 3AZJB 4H9OA 5GT3B 5B0YC 3MVDD 5B2IA 3X1SC 1AOIA 4CSRB 4YM6D 5AV5C 5AVCA 5B0YB 5BS7C 4J8WD 3X1SB 3MGSC 5B0YA 5AV5B 1P3ID 4J8VD 3X1SA 3WTPE 5CHLB 1KX3D 2CWEA 3MGSB 1M19D 5AV9C 2F8NK 5B1MD 2HIOC 2F8NH 5BS7A 3W99C 3V9RB 4X23C 5AV9B 2HIOB 4EO5C 3MGRC 1H3OA 5GT0D 3O62D 3W99B 5DNMA 4ZBJB 5CPIB 2FJ7D 4WU8B 1R4VA 4LD9A 5GSUC 1P3BD 3MGRB 5FUGB 3W97D 4X23A 5KDMB 5GSUB 3MGRA 3MGPC 3AZIC 3RELD 1KX5C 3KXBC 5B31C 5GSUA 5AVBA 3AZEC 3WTPA 4WU9A 3WKJC 3MGPB 1BH8B 3NQJB 3AZIB 3W98C 5JA4A 3KWQC 3KXBB 5B31B 5CP6C 1M18D 3AZGA 3MGPA 3AV1B 2IO5C 3W98B 1KX5A 5B2JC 3WKJA 3AZEA 4H9RA 5B33C 2AROB 3W98A 3AZMC 3KWQA 1U35D 5B1LD 5CP6A 3LJAD 4JJNC 1ID3D 5B33B 3AZMB 4KUDD 5B2JA 4JJNB 5B33A 3AZMA 3UTAC 5DNND 4JJNA 4ZUXD 2NQBC 4CAYB 4Z2MG 3A6NB 1JFIB 5CPKD 4QLCC 3UTAB 3UT9B 5BNXA 2NQBB 4CAYA 3UTAA 2HUEC 3MNND 2NQBA 5B32G 5AV8D 5B32A 4QLCA 2HUEB 3REIB 1KX4B 2CV5D 3REKD 5B0ZB 1P3OD 3B0DC 5CPJA 4Z66A 3WAAC 3B0DB 3B6GB 5B2ID 2BYMA 4G91C 1AOID 1P34B 4XZQA 5AVCD 3WAAB 1N1JB 4NE3A 4J8UC 1BH9A 5B0YD 2F8NG 2F8NA 3X1SD 3B0CW 3AZFC 4J8UB 3AZHC 4NFTA 3LELB 3REJB 3AN2C 1ZLAC 3AZLC 3KUYC 3AZHB 1P3KA 3AV2C 5GXQB 3AZFA 5DNMD 2PYOC 5AV9D 3KUYB 2HIOD 4LD9D 3AN2A 1ZLAA 3AZLA 4X23D 4YS3A 3WA9C 5B40B 3MGRD 3AV2A 1P3FC 5JRGC 1EQZC 4NE6A 2YFVB 2PYOA 4R8PC 3UTBC 3AZNA 5GSUD 5AVBD 4WU9D 5GT3C 3WTPD 3AZKA 1F66A 1P3FB 1EQZB 2YFWB 2YFVA 2BYKA 4R8PB 3WA9A 3KSYA 1P3PB 3AZGD
chains in the Genus database with same CATH superfamily
3MGPD 3AZID 2DF4C 1P3FA 5JRGA 1EQZA 1KX5D 4R8PA 3UTBA 3AZJA 3WKJD 2FFFB 5GT3A 3AZED 5AY8B 3W98D 3KWQD 5CP6D 4CSRA 1Q9CA 4NE5A 5B2JD 3B6FC 4H9PB 5BO0B 3A1IA 5AV5A 5B33D 1HTAA 3AZMD 3B6FB 4JJND 4H9PA 5BO0A 3MGSA 5G49B 4ZBJC 5CPIC 4WU8C 1WWIA 2Y2NA 3X1TC 3V9RA 5F99B 1P3GB 5AV9A 4XUJC 2HIOA 1M1AB 3UTAD 3X1TB 3W99A 2NQBD 5CPIA 4HGAC 4WU8A 5B32D 4XUJB 1B67A 4QLCD 3X1TA 5FUGA 2G5IC 4DRBA 5KDMA 4HGAB 1P3MC 2ZY2A 1W2EA 5CPJD 3AV1C 4Z66D 1HQ3C 3B0CT 1P3MB 4H9SC 3X1UC 2ZY3A 1BH8A 2BG1A 3NQJA 3LZ0B 3AZIA 2AROC 4DQYB 5B31G 3KXBA 1HQ3B 5B31A 4XZQD 1P3MA 4KGCC 2XD1A 3REHB 3X1UB 2ZY4A 3AV1A 4H9SA 4KGCB 1P3LB 3X1UA 2F8ND 2AROA 4M6BA 4KGCA 3VH5W 1TAFB 4G92C 3VH6W 3A6NC 1BFMA 3NQUB 2RVQD 4YM6C 4J8UD 3UT9C 1TAFA 1P3KD 4G92B 4WNNB 3AYWC 3AZFD 4YM6B 3EPLA 4J8VC 4J8WB 3AN2D 1ZLAD 3AZLD 1M19C 3A6NA 3AYWB 1JFIA 3UT9A 5B1MC 4YS3D 3REIC 4J8VB 1P3IB 1KX4C 1B6WA 3A1KA 1KX3B 5E5AC 3AV2D 4H9QB 1M19B 5B0ZC 2PYOD 5B1MB 3AZND 3AZKD 1F1EA 5E5AB 3O62C 1F66D 4H9NB 3B6GC 3C1BC 5B24C 3REIA 3WA9D 1KX4A 5GT0B 3W97C 3LZ1C 5E5AA 1P34C 3O62B 5JRGD 5B0ZA 1P3FD 1EQZD 4H9NA 3TU4C 4R8PD 3C1BB 2Y2OA 5B24B 3UTBD 3AZJD 5GT3D 3W97B 3LZ1B 2JSSA 3TU4B 3B6GA 3C1BA 5B24A 3C1CC 3FDDA 3LZ1A 1P34A 3X1VC 4J8XC 3WAAA 3LELC 1PZRA 3REJC 1N1JA 3B0BA 3C1CB 2JE5A 3X1VB 5AV5D 4J8XB 5GXQC 1M18B 3MGSD 3AFAC 4J8UA 3X1VA 4J8XA 3LELA 3REJA 3LJAC 4WV4B 4AWLC 3AFAB 5BT1C 3AZHA 1U35B 5B40C 1TZYC 4UUZB 3LJAB 3H0MC 5GXQA 1ID3B 3W99D 4AWLB 3AFAA 3VH6A 3KUYA 4WU8D 5CPID 2Y2JA 4KUDB 3EPHA 4UUZA 1TZYB 3EG5B 3X1TD 1P3AC 1S32C 3F6TA 4KHAB 4Z5TC 5AV6C 1P3PC 5DNNB 1TZYA 5C3IC 5B40A 4ZUXB 1P3AB 1S32B 5CPKB 4Z5TB 5AV6B 5C3IB 5AY8C 4E45A 1P3AA 2YFWA 3VH6T 3R45B 1S32A 3KXBD 4Z5TA 5B31D 1P3MD 5AV6A 3KFUG 1P3PA 3AV1D 3REKC 3R45A 2Y2MA 1HQ3D 1P3OC 3X1UD 2Y2QA 5AY8A 2AROD 4DRAA 3REKB 4KGCD 1P3OB 2LY8A 1AOIC 4H9OB 5AVCC 1A7WA 5F99C 2ZM5A 1P3GC 1AOIB 1M1AC 1KU5A 5AVCB 3B6FA 3MGQC 2NZDC 5G49A 5BNVB 3A6ND 3UT9D 3MGQB 5F99A 2Y2GA 2NZDB 5BNVA 1P3GA 3AYWD 1M1AA 3MGQA 2NZDA 4XUJA 5DNMC 4LD9C 3EPKA 3LZ0C 3REID 1KX4D 1H3OB 5E5AD 5B0ZD 5DNMB 3REHC 4LD9B 4X23B 1P3LC 3B6GD 3W96C 3C1BD 5AVBC 4EO5B 5B24D 3WTPC 3LZ0A 4WU9C 3LZ1D 1P34D 1HQ3A 3REHA 3WAAD 3TU4D 3W96B 5AVBB 3AZGC 4WU9B 3WTPB 1P3LA 5JA4B 3MVDC 3W96A 3C1CD 3AZGB 3X1VD 2J8PA 4J8XD 1KX5B 4J8WC 3MVDB 4WZSB 3LELD 3P5JB 3REJD 3WKJB 3H0RC 3AZEB 3NQUA 4H9RB 3AZHD 1P3IC 3MVDA 3KWQB 2G5HC 4WNNA 1KX3C 5CP6B 5GXQD 2XD5A 4YM6A 3AFAD 2IO5B 3KUYD 4J8WA 5B2JB 3AYWA 5BT1D 1P3IA 4J8VA 5GT0C 5B40D 1TZYD 1KX3A 4H9QA 1M19A 2L5AA 2FJ7C 5B1MA 2VQRA 1P3BC 5BNXB 1P3AD 1S32D 2FJ7B 5B32C 4Z5TD 1P3BB 5AV6D 5GT0A 1P3PD 3O62A 2JCHA 3RELC 2FJ7A 5B32B 1P3BA 4QLCB 5CPJC 3W97A 5AY8D 4Z66C 3RELB 3TU4A 1M18C 5CPJB 1ULYA 3RELA 4Z66B 1WWSA 4XZQC 3C1CA 2BYMB 4E44A 1U35C 5B1LC 4XZQB 3B6FD 1M18A 1ID3C 4KUDC 4UPKA 1BH9B 5B1LB 5F99D 3VH5A 2F8NB 1P3GD 4G91B 2RVQC 2UWXA 1M1AD 1U35A 5DNNC 5B1LA 3LJAA 4ZUXC 1P3KC 3MGQD 1ID3A 2NZDD 4XUJD 5CPKC 4KUDA 1P3KB 4KHAA 3AZFB 4YS3C 5DNNA 4ZUXA 3MNNC 3VH5T 1T3UA 3AN2B 1ZLAB 3AZLB 5AV8C 2Y2LA 5CPKA 4YS3B 3AZNC 3MNNB 3LZ0D 3AZKC 2CV5C 3AV2B 1F66C 4Z2MH 5AV8B 2PYOB 3REHD 3MNNA 3AZNB 3AZKB 2CV5B 5AV8A 1F66B 1P3LD 2BYKB 5B2IC 3W96D 3AZJC 3WA9B 2CV5A 3REKA 5JRGB 1P3OA 5B2IB 3UTBB 3AZJB 4H9OA 5GT3B 5B0YC 2Y2PA 3EPJA 3MVDD 5B2IA 3X1SC 1AOIA 4CSRB 4YM6D 5AV5C 5AVCA 5B0YB 2Y2IA 5BS7C 3X1SB 4J8WD 3MGSC 5B0YA 5AV5B 2Y2KA 1P3ID 4J8VD 3X1SA 3WTPE 5CHLB 1KX3D 2CWEA 3MGSB 1M19D 5AV9C 2ZY5A 2F8NK 5B1MD 2HIOC 2F8NH 5BS7A 3W99C 3V9RB 3AL0C 4X23C 5AV9B 2HIOB 4EO5C 3MGRC 1H3OA 5GT0D 3O62D 3W99B 5DNMA 4ZBJB 5CPIB 2FJ7D 4WU8B 4WJ3C 1R4VA 4LD9A 5GSUC 1P3BD 3MGRB 5FUGB 3W97D 4X23A 5KDMB 5GSUB 3MGRA 3MGPC 3AZIC 3RELD 1KX5C 3KXBC 5B31C 5GSUA 5AVBA 3AZEC 3WTPA 4WU9A 3WKJC 3MGPB 1BH8B 3NQJB 3AZIB 3W98C 5JA4A 3KWQC 3KXBB 5B31B 5CP6C 1M18D 3AZGA 3MGPA 3AV1B 2IO5C 3W98B 1KX5A 5B2JC 3WKJA 3AZEA 4H9RA 1Z2CB 2AROB 5B33C 3AZMC 3W98A 3KWQA 1U35D 5B1LD 5CP6A 3LJAD 4JJNC 1ID3D 5B33B 3AZMB 4KUDD 5B2JA 4JJNB 5B33A 2RIQA 3AZMA 3UTAC 5DNND 4JJNA 4ZUXD 2NQBC 4CAYB 4Z2MG 3A6NB 1JFIB 5CPKD 4QLCC 3UTAB 3UT9B 5BNXA 2NQBB 4CAYA 3UTAA 2HUEC 3MNND 2NQBA 5B32G 5AV8D 5B32A 4QLCA 2HUEB 3REIB 1KX4B 2CV5D 3REKD 5B0ZB 1P3OD 3B0DC 5CPJA 4Z66A 3WAAC 3B0DB 3B6GB 5B2ID 2BYMA 4G91C 1AOID 1P34B 4XZQA 5AVCD 3WAAB 1N1JB 4NE3A 4J8UC 1BH9A 5B0YD 2F8NG 2F8NA 3X1SD 3B0CW 3AZFC 3H0LC 4J8UB 3AZHC 4NFTA 3LELB 3REJB 3AN2C 1ZLAC 3AZLC 3KUYC 3AZHB 1P3KA 2F2AC 3AV2C 5GXQB 3AZFA 2Y2HA 5DNMD 2PYOC 5AV9D 3KUYB 2W8SA 2HIOD 4LD9D 3AN2A 1ZLAA 3AZLA 3IP4C 4X23D 4YS3A 2DQNC 3WA9C 5B40B 3MGRD 3AV2A 1P3FC 5JRGC 1EQZC 4NE6A 2YFVB 2PYOA 4R8PC 3UTBC 3AZNA 5GSUD 5AVBD 4WU9D 5GT3C 3WTPD 3AZKA 1F66A 1P3FB 1EQZB 2YFWB 2YFVA 2BYKA 4R8PB 3WA9A 3KSYA 1P3PB 3AZGD
chains in the Genus database with same CATH topology
3MGPD 3AZID 2DF4C 1P3FA 5JRGA 1EQZA 1KX5D 4R8PA 3UTBA 3AZJA 3WKJD 2FFFB 5GT3A 3AZED 5AY8B 3W98D 3KWQD 5CP6D 4CSRA 1Q9CA 4NE5A 5B2JD 3B6FC 4H9PB 5BO0B 3A1IA 5AV5A 5B33D 1HTAA 3AZMD 3B6FB 4JJND 4H9PA 5BO0A 3MGSA 5G49B 4ZBJC 5CPIC 4WU8C 1WWIA 2Y2NA 3X1TC 3V9RA 5F99B 1P3GB 5AV9A 4XUJC 2HIOA 1M1AB 3UTAD 3X1TB 3W99A 2NQBD 5CPIA 4HGAC 4WU8A 5B32D 4XUJB 1B67A 4QLCD 3X1TA 5FUGA 2G5IC 4DRBA 5KDMA 4HGAB 1P3MC 2ZY2A 1W2EA 5CPJD 3AV1C 4Z66D 1HQ3C 3B0CT 1P3MB 4H9SC 3X1UC 2ZY3A 1BH8A 2BG1A 3NQJA 3LZ0B 3AZIA 2AROC 4DQYB 5B31G 3KXBA 1HQ3B 5B31A 4XZQD 1P3MA 4KGCC 2XD1A 3REHB 3X1UB 2ZY4A 3AV1A 4H9SA 4KGCB 1P3LB 3X1UA 2F8ND 2AROA 4M6BA 4KGCA 3VH5W 1TAFB 4G92C 3VH6W 3A6NC 1BFMA 3NQUB 2RVQD 4YM6C 4J8UD 3UT9C 1TAFA 1P3KD 4G92B 4WNNB 3AYWC 3AZFD 4YM6B 3EPLA 4J8VC 4J8WB 3AN2D 1ZLAD 3AZLD 1M19C 3A6NA 3AYWB 1JFIA 3UT9A 5B1MC 4YS3D 3REIC 4J8VB 1P3IB 1KX4C 1B6WA 3A1KA 1KX3B 5E5AC 3AV2D 4H9QB 1M19B 5B0ZC 2PYOD 5B1MB 3AZND 3AZKD 1F1EA 5E5AB 3O62C 1F66D 4H9NB 3B6GC 3C1BC 5B24C 3REIA 3WA9D 1KX4A 5GT0B 3W97C 3LZ1C 5E5AA 1P34C 3O62B 5JRGD 5B0ZA 1P3FD 1EQZD 4H9NA 3TU4C 4R8PD 3C1BB 2Y2OA 5B24B 3UTBD 3AZJD 5GT3D 3W97B 3LZ1B 2JSSA 3TU4B 3B6GA 3C1BA 5B24A 3C1CC 3FDDA 3LZ1A 1P34A 3X1VC 4J8XC 3WAAA 3LELC 1PZRA 3REJC 1N1JA 3B0BA 3C1CB 2JE5A 3X1VB 5AV5D 4J8XB 5GXQC 1M18B 3MGSD 3AFAC 4J8UA 3X1VA 4J8XA 3LELA 3REJA 3LJAC 4WV4B 4AWLC 3AFAB 5BT1C 3AZHA 1U35B 5B40C 1TZYC 4UUZB 3LJAB 3H0MC 5GXQA 1ID3B 3W99D 4AWLB 3AFAA 3VH6A 3KUYA 4WU8D 5CPID 2Y2JA 4KUDB 3EPHA 4UUZA 1TZYB 3EG5B 3X1TD 1P3AC 1S32C 3F6TA 4KHAB 4Z5TC 5AV6C 1P3PC 5DNNB 1TZYA 5C3IC 5B40A 4ZUXB 1P3AB 1S32B 5CPKB 4Z5TB 5AV6B 5C3IB 5AY8C 4E45A 1P3AA 2YFWA 3VH6T 3R45B 1S32A 3KXBD 4Z5TA 5B31D 1P3MD 5AV6A 3KFUG 1P3PA 3AV1D 3REKC 3R45A 2Y2MA 1HQ3D 1P3OC 3X1UD 2Y2QA 5AY8A 2AROD 4DRAA 3REKB 4KGCD 1P3OB 2LY8A 1AOIC 4H9OB 5AVCC 1A7WA 5F99C 2ZM5A 1P3GC 1AOIB 1M1AC 1KU5A 5AVCB 3B6FA 3MGQC 2NZDC 5G49A 5BNVB 3A6ND 3UT9D 3MGQB 5F99A 2Y2GA 2NZDB 5BNVA 1P3GA 3AYWD 1M1AA 3MGQA 2NZDA 4XUJA 5DNMC 4LD9C 3EPKA 3LZ0C 3REID 1KX4D 1H3OB 5E5AD 5B0ZD 5DNMB 3REHC 4LD9B 4X23B 1P3LC 3B6GD 3W96C 3C1BD 5AVBC 4EO5B 5B24D 3WTPC 3LZ0A 4WU9C 3LZ1D 1P34D 1HQ3A 3REHA 3WAAD 3TU4D 3W96B 5AVBB 3AZGC 4WU9B 3WTPB 1P3LA 5JA4B 3MVDC 3W96A 3C1CD 3AZGB 3X1VD 2J8PA 4J8XD 1KX5B 4J8WC 3MVDB 4WZSB 3LELD 3P5JB 3REJD 3WKJB 3H0RC 3AZEB 3NQUA 4H9RB 3AZHD 1P3IC 3MVDA 3KWQB 2G5HC 4WNNA 1KX3C 5CP6B 5GXQD 2XD5A 4YM6A 3AFAD 2IO5B 3KUYD 4J8WA 5B2JB 3AYWA 5BT1D 1P3IA 4J8VA 5GT0C 5B40D 1TZYD 1KX3A 4H9QA 1M19A 2L5AA 2FJ7C 5B1MA 2VQRA 1P3BC 5BNXB 1P3AD 1S32D 2FJ7B 5B32C 4Z5TD 1P3BB 5AV6D 5GT0A 1P3PD 3O62A 2JCHA 3RELC 2FJ7A 5B32B 1P3BA 4QLCB 5CPJC 3W97A 5AY8D 4Z66C 3RELB 3TU4A 1M18C 5CPJB 1ULYA 3RELA 4Z66B 1WWSA 4XZQC 3C1CA 2BYMB 4E44A 1U35C 5B1LC 4XZQB 3B6FD 1M18A 1ID3C 4KUDC 4UPKA 1BH9B 5B1LB 5F99D 3VH5A 2F8NB 1P3GD 4G91B 2RVQC 2UWXA 1M1AD 1U35A 5DNNC 5B1LA 3LJAA 4ZUXC 1P3KC 3MGQD 1ID3A 2NZDD 4XUJD 5CPKC 4KUDA 1P3KB 4KHAA 3AZFB 4YS3C 5DNNA 4ZUXA 3MNNC 3VH5T 1T3UA 3AN2B 1ZLAB 3AZLB 5AV8C 2Y2LA 5CPKA 4YS3B 3AZNC 3MNNB 3LZ0D 3AZKC 2CV5C 3AV2B 1F66C 4Z2MH 5AV8B 2PYOB 3REHD 3MNNA 3AZNB 3AZKB 2CV5B 5AV8A 1F66B 1P3LD 2BYKB 5B2IC 3W96D 3AZJC 3WA9B 2CV5A 3REKA 5JRGB 1P3OA 5B2IB 3UTBB 3AZJB 4H9OA 5GT3B 5B0YC 2Y2PA 3EPJA 3MVDD 5B2IA 3X1SC 1AOIA 4CSRB 4YM6D 5AV5C 5AVCA 5B0YB 2Y2IA 5BS7C 3X1SB 4J8WD 3MGSC 5B0YA 5AV5B 2Y2KA 1P3ID 4J8VD 3X1SA 3WTPE 5CHLB 1KX3D 2CWEA 3MGSB 1M19D 5AV9C 2ZY5A 2F8NK 5B1MD 2HIOC 2F8NH 5BS7A 3W99C 3V9RB 3AL0C 4X23C 5AV9B 2HIOB 4EO5C 3MGRC 1H3OA 5GT0D 3O62D 3W99B 5DNMA 4ZBJB 5CPIB 2FJ7D 4WU8B 4WJ3C 1R4VA 4LD9A 5GSUC 1P3BD 3MGRB 5FUGB 3W97D 4X23A 5KDMB 5GSUB 3MGRA 3MGPC 3AZIC 3RELD 1KX5C 3KXBC 5B31C 5GSUA 5AVBA 3AZEC 3WTPA 4WU9A 3WKJC 3MGPB 1BH8B 3NQJB 3AZIB 3W98C 5JA4A 3KWQC 3KXBB 5B31B 5CP6C 1M18D 3AZGA 3MGPA 3AV1B 2IO5C 3W98B 1KX5A 5B2JC 3WKJA 3AZEA 4H9RA 1Z2CB 2AROB 5B33C 3AZMC 3W98A 3KWQA 1U35D 5B1LD 5CP6A 3LJAD 4JJNC 1ID3D 5B33B 3AZMB 4KUDD 5B2JA 4JJNB 5B33A 2RIQA 3AZMA 3UTAC 5DNND 4JJNA 4ZUXD 2NQBC 4CAYB 4Z2MG 3A6NB 1JFIB 5CPKD 4QLCC 3UTAB 3UT9B 5BNXA 2NQBB 4CAYA 3UTAA 2HUEC 3MNND 2NQBA 5B32G 5AV8D 5B32A 4QLCA 2HUEB 3REIB 1KX4B 2CV5D 3REKD 5B0ZB 1P3OD 3B0DC 5CPJA 4Z66A 3WAAC 3B0DB 3B6GB 5B2ID 2BYMA 4G91C 1AOID 1P34B 4XZQA 5AVCD 3WAAB 1N1JB 4NE3A 4J8UC 1BH9A 5B0YD 2F8NG 2F8NA 3X1SD 3B0CW 3AZFC 3H0LC 4J8UB 3AZHC 4NFTA 3LELB 3REJB 3AN2C 1ZLAC 3AZLC 3KUYC 3AZHB 1P3KA 2F2AC 3AV2C 5GXQB 3AZFA 2Y2HA 5DNMD 2PYOC 5AV9D 3KUYB 2W8SA 2HIOD 4LD9D 3AN2A 1ZLAA 3AZLA 3IP4C 4X23D 4YS3A 2DQNC 3WA9C 5B40B 3MGRD 3AV2A 1P3FC 5JRGC 1EQZC 4NE6A 2YFVB 2PYOA 4R8PC 3UTBC 3AZNA 5GSUD 5AVBD 4WU9D 5GT3C 3WTPD 3AZKA 1F66A 1P3FB 1EQZB 2YFWB 2YFVA 2BYKA 4R8PB 3WA9A 3KSYA 1P3PB 3AZGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP D;  3AZI D;  1P3F A;  5JRG A;  1EQZ A;  1KX5 D;  4R8P A;  3UTB A;  3AZJ A;  3WKJ D;  3AZE D;  5GT3 A;  5AY8 B;  3W98 D;  3KWQ D;  5CP6 D;  4CSR A;  1Q9C A;  4NE5 A;  5B2J D;  3B6F C;  4H9P B;  5BO0 B;  5AV5 A;  5B33 D;  1HTA A;  3AZM D;  3B6F B;  4JJN D;  4H9P A;  5BO0 A;  3MGS A;  5G49 B;  4ZBJ C;  5CPI C;  4WU8 C;  1WWI A;  3X1T C;  3V9R A;  5F99 B;  1P3G B;  5AV9 A;  4XUJ C;  2HIO A;  1M1A B;  3UTA D;  3X1T B;  3W99 A;  2NQB D;  5CPI A;  4HGA C;  4WU8 A;  5B32 D;  4XUJ B;  1B67 A;  4QLC D;  3X1T A;  5FUG A;  4DRB A;  5KDM A;  4HGA B;  1P3M C;  5CPJ D;  3AV1 C;  4Z66 D;  1HQ3 C;  3B0C T;  1P3M B;  4H9S C;  3X1U C;  1BH8 A;  3NQJ A;  3LZ0 B;  3AZI A;  2ARO C;  5B31 G;  3KXB A;  1HQ3 B;  5B31 A;  4XZQ D;  1P3M A;  4KGC C;  3REH B;  3X1U B;  3AV1 A;  4H9S A;  4KGC B;  1P3L B;  3X1U A;  2F8N D;  2ARO A;  4M6B A;  4KGC A;  3VH5 W;  1TAF B;  4G92 C;  3VH6 W;  3A6N C;  1BFM A;  3NQU B;  2RVQ D;  4YM6 C;  4J8U D;  3UT9 C;  1TAF A;  1P3K D;  4G92 B;  4WNN B;  3AYW C;  3AZF D;  4YM6 B;  4J8V C;  4J8W B;  3AN2 D;  1ZLA D;  3AZL D;  1M19 C;  3A6N A;  3AYW B;  1JFI A;  3UT9 A;  5B1M C;  4YS3 D;  3REI C;  4J8V B;  1P3I B;  1KX4 C;  1B6W A;  1KX3 B;  5E5A C;  3AV2 D;  4H9Q B;  1M19 B;  5B0Z C;  2PYO D;  5B1M B;  3AZN D;  3AZK D;  1F1E A;  5E5A B;  3O62 C;  1F66 D;  4H9N B;  3B6G C;  3C1B C;  5B24 C;  3REI A;  3WA9 D;  1KX4 A;  5GT0 B;  3W97 C;  3LZ1 C;  5E5A A;  1P34 C;  3O62 B;  5JRG D;  5B0Z A;  1P3F D;  1EQZ D;  4H9N A;  3TU4 C;  4R8P D;  3C1B B;  5B24 B;  3UTB D;  3AZJ D;  5GT3 D;  3W97 B;  3LZ1 B;  2JSS A;  3TU4 B;  3B6G A;  3C1B A;  5B24 A;  3C1C C;  3LZ1 A;  1P34 A;  3X1V C;  4J8X C;  3WAA A;  3LEL C;  3REJ C;  1N1J A;  3B0B A;  3C1C B;  3X1V B;  5AV5 D;  4J8X B;  5GXQ C;  1M18 B;  3MGS D;  3AFA C;  4J8U A;  3X1V A;  4J8X A;  3LEL A;  3REJ A;  3LJA C;  4WV4 B;  4AWL C;  3AFA B;  5BT1 C;  3AZH A;  1U35 B;  5B40 C;  1TZY C;  4UUZ B;  3LJA B;  5GXQ A;  1ID3 B;  3W99 D;  4AWL B;  3AFA A;  3VH6 A;  3KUY A;  4WU8 D;  5CPI D;  4KUD B;  4UUZ A;  1TZY B;  3X1T D;  1P3A C;  1S32 C;  4KHA B;  4Z5T C;  5AV6 C;  1P3P C;  5DNN B;  1TZY A;  5C3I C;  5B40 A;  4ZUX B;  1P3A B;  1S32 B;  5CPK B;  4Z5T B;  5AV6 B;  5C3I B;  5AY8 C;  4E45 A;  1P3A A;  2YFW A;  3VH6 T;  3R45 B;  1S32 A;  3KXB D;  4Z5T A;  5B31 D;  1P3M D;  5AV6 A;  1P3P A;  3AV1 D;  3REK C;  3R45 A;  1HQ3 D;  1P3O C;  3X1U D;  5AY8 A;  2ARO D;  4DRA A;  3REK B;  4KGC D;  1P3O B;  2LY8 A;  1AOI C;  4H9O B;  5AVC C;  1A7W A;  5F99 C;  1P3G C;  1AOI B;  1M1A C;  1KU5 A;  5AVC B;  3B6F A;  3MGQ C;  2NZD C;  5G49 A;  5BNV B;  3A6N D;  3UT9 D;  3MGQ B;  5F99 A;  2NZD B;  5BNV A;  1P3G A;  3AYW D;  1M1A A;  3MGQ A;  2NZD A;  4XUJ A;  5DNM C;  4LD9 C;  3LZ0 C;  3REI D;  1KX4 D;  1H3O B;  5E5A D;  5B0Z D;  5DNM B;  3REH C;  4LD9 B;  4X23 B;  1P3L C;  3B6G D;  3W96 C;  3C1B D;  5AVB C;  4EO5 B;  5B24 D;  3WTP C;  3LZ0 A;  4WU9 C;  3LZ1 D;  1P34 D;  1HQ3 A;  3REH A;  3WAA D;  3TU4 D;  3W96 B;  5AVB B;  3AZG C;  4WU9 B;  3WTP B;  1P3L A;  5JA4 B;  3MVD C;  3W96 A;  3C1C D;  3AZG B;  3X1V D;  4J8X D;  1KX5 B;  4J8W C;  3MVD B;  4WZS B;  3LEL D;  3REJ D;  3WKJ B;  3AZE B;  3NQU A;  4H9R B;  3AZH D;  1P3I C;  3MVD A;  3KWQ B;  4WNN A;  1KX3 C;  5CP6 B;  5GXQ D;  4YM6 A;  3AFA D;  2IO5 B;  3KUY D;  4J8W A;  5B2J B;  3AYW A;  5BT1 D;  1P3I A;  4J8V A;  5GT0 C;  5B40 D;  1TZY D;  1KX3 A;  4H9Q A;  1M19 A;  2L5A A;  2FJ7 C;  5B1M A;  1P3B C;  5BNX B;  1P3A D;  1S32 D;  2FJ7 B;  5B32 C;  4Z5T D;  1P3B B;  5AV6 D;  5GT0 A;  1P3P D;  3O62 A;  3REL C;  2FJ7 A;  5B32 B;  1P3B A;  4QLC B;  5CPJ C;  3W97 A;  5AY8 D;  4Z66 C;  3REL B;  3TU4 A;  1M18 C;  5CPJ B;  1ULY A;  3REL A;  4Z66 B;  1WWS A;  4XZQ C;  3C1C A;  2BYM B;  4E44 A;  1U35 C;  5B1L C;  4XZQ B;  3B6F D;  1M18 A;  1ID3 C;  4KUD C;  1BH9 B;  5B1L B;  5F99 D;  3VH5 A;  2F8N B;  1P3G D;  4G91 B;  2RVQ C;  1M1A D;  1U35 A;  5DNN C;  5B1L A;  3LJA A;  4ZUX C;  1P3K C;  3MGQ D;  1ID3 A;  2NZD D;  4XUJ D;  5CPK C;  4KUD A;  1P3K B;  4KHA A;  3AZF B;  4YS3 C;  5DNN A;  4ZUX A;  3MNN C;  3VH5 T;  3AN2 B;  1ZLA B;  3AZL B;  5AV8 C;  5CPK A;  4YS3 B;  3AZN C;  3MNN B;  3LZ0 D;  3AZK C;  2CV5 C;  3AV2 B;  1F66 C;  4Z2M H;  5AV8 B;  2PYO B;  3REH D;  3MNN A;  3AZN B;  3AZK B;  2CV5 B;  5AV8 A;  1F66 B;  1P3L D;  2BYK B;  5B2I C;  3W96 D;  3AZJ C;  3WA9 B;  2CV5 A;  3REK A;  5JRG B;  1P3O A;  5B2I B;  3UTB B;  3AZJ B;  4H9O A;  5GT3 B;  5B0Y C;  3MVD D;  5B2I A;  3X1S C;  1AOI A;  4CSR B;  4YM6 D;  5AV5 C;  5AVC A;  5B0Y B;  5BS7 C;  4J8W D;  3X1S B;  3MGS C;  5B0Y A;  5AV5 B;  1P3I D;  4J8V D;  3X1S A;  3WTP E;  5CHL B;  1KX3 D;  2CWE A;  3MGS B;  1M19 D;  5AV9 C;  2F8N K;  5B1M D;  2HIO C;  2F8N H;  5BS7 A;  3W99 C;  3V9R B;  4X23 C;  5AV9 B;  2HIO B;  4EO5 C;  3MGR C;  1H3O A;  5GT0 D;  3O62 D;  3W99 B;  5DNM A;  4ZBJ B;  5CPI B;  2FJ7 D;  4WU8 B;  1R4V A;  4LD9 A;  5GSU C;  1P3B D;  3MGR B;  5FUG B;  3W97 D;  4X23 A;  5KDM B;  5GSU B;  3MGR A;  3MGP C;  3AZI C;  3REL D;  1KX5 C;  3KXB C;  5B31 C;  5GSU A;  5AVB A;  3AZE C;  3WTP A;  4WU9 A;  3WKJ C;  3MGP B;  1BH8 B;  3NQJ B;  3AZI B;  3W98 C;  5JA4 A;  3KWQ C;  3KXB B;  5B31 B;  5CP6 C;  1M18 D;  3AZG A;  3MGP A;  3AV1 B;  2IO5 C;  3W98 B;  1KX5 A;  5B2J C;  3WKJ A;  3AZE A;  4H9R A;  5B33 C;  2ARO B;  3W98 A;  3AZM C;  3KWQ A;  1U35 D;  5B1L D;  5CP6 A;  3LJA D;  4JJN C;  1ID3 D;  5B33 B;  3AZM B;  4KUD D;  5B2J A;  4JJN B;  5B33 A;  3AZM A;  3UTA C;  5DNN D;  4JJN A;  4ZUX D;  2NQB C;  4CAY B;  4Z2M G;  3A6N B;  1JFI B;  5CPK D;  4QLC C;  3UTA B;  3UT9 B;  5BNX A;  2NQB B;  4CAY A;  3UTA A;  2HUE C;  3MNN D;  2NQB A;  5B32 G;  5AV8 D;  5B32 A;  4QLC A;  2HUE B;  3REI B;  1KX4 B;  2CV5 D;  3REK D;  5B0Z B;  1P3O D;  3B0D C;  5CPJ A;  4Z66 A;  3WAA C;  3B0D B;  3B6G B;  5B2I D;  2BYM A;  4G91 C;  1AOI D;  1P34 B;  4XZQ A;  5AVC D;  3WAA B;  1N1J B;  4NE3 A;  4J8U C;  1BH9 A;  5B0Y D;  2F8N G;  2F8N A;  3X1S D;  3B0C W;  3AZF C;  4J8U B;  3AZH C;  4NFT A;  3LEL B;  3REJ B;  3AN2 C;  1ZLA C;  3AZL C;  3KUY C;  3AZH B;  1P3K A;  3AV2 C;  5GXQ B;  3AZF A;  5DNM D;  2PYO C;  5AV9 D;  3KUY B;  2HIO D;  4LD9 D;  3AN2 A;  1ZLA A;  3AZL A;  4X23 D;  4YS3 A;  3WA9 C;  5B40 B;  3MGR D;  3AV2 A;  1P3F C;  5JRG C;  1EQZ C;  4NE6 A;  2YFV B;  2PYO A;  4R8P C;  3UTB C;  3AZN A;  5GSU D;  5AVB D;  4WU9 D;  5GT3 C;  3WTP D;  3AZK A;  1F66 A;  1P3F B;  1EQZ B;  2YFW B;  2YFV A;  2BYK A;  4R8P B;  3WA9 A;  3KSY A;  1P3P B;  3AZG D; 
#chains in the Genus database with same CATH topology
 3MGP D;  3AZI D;  2DF4 C;  1P3F A;  5JRG A;  1EQZ A;  1KX5 D;  4R8P A;  3UTB A;  3AZJ A;  3WKJ D;  2FFF B;  5GT3 A;  3AZE D;  5AY8 B;  3W98 D;  3KWQ D;  5CP6 D;  4CSR A;  1Q9C A;  4NE5 A;  5B2J D;  3B6F C;  4H9P B;  5BO0 B;  3A1I A;  5AV5 A;  5B33 D;  1HTA A;  3AZM D;  3B6F B;  4JJN D;  4H9P A;  5BO0 A;  3MGS A;  5G49 B;  4ZBJ C;  5CPI C;  4WU8 C;  1WWI A;  2Y2N A;  3X1T C;  3V9R A;  5F99 B;  1P3G B;  5AV9 A;  4XUJ C;  2HIO A;  1M1A B;  3UTA D;  3X1T B;  3W99 A;  2NQB D;  5CPI A;  4HGA C;  4WU8 A;  5B32 D;  4XUJ B;  1B67 A;  4QLC D;  3X1T A;  5FUG A;  2G5I C;  4DRB A;  5KDM A;  4HGA B;  1P3M C;  2ZY2 A;  1W2E A;  5CPJ D;  3AV1 C;  4Z66 D;  1HQ3 C;  3B0C T;  1P3M B;  4H9S C;  3X1U C;  2ZY3 A;  1BH8 A;  2BG1 A;  3NQJ A;  3LZ0 B;  3AZI A;  2ARO C;  4DQY B;  5B31 G;  3KXB A;  1HQ3 B;  5B31 A;  4XZQ D;  1P3M A;  4KGC C;  2XD1 A;  3REH B;  3X1U B;  2ZY4 A;  3AV1 A;  4H9S A;  4KGC B;  1P3L B;  3X1U A;  2F8N D;  2ARO A;  4M6B A;  4KGC A;  3VH5 W;  1TAF B;  4G92 C;  3VH6 W;  3A6N C;  1BFM A;  3NQU B;  2RVQ D;  4YM6 C;  4J8U D;  3UT9 C;  1TAF A;  1P3K D;  4G92 B;  4WNN B;  3AYW C;  3AZF D;  4YM6 B;  3EPL A;  4J8V C;  4J8W B;  3AN2 D;  1ZLA D;  3AZL D;  1M19 C;  3A6N A;  3AYW B;  1JFI A;  3UT9 A;  5B1M C;  4YS3 D;  3REI C;  4J8V B;  1P3I B;  1KX4 C;  1B6W A;  3A1K A;  1KX3 B;  5E5A C;  3AV2 D;  4H9Q B;  1M19 B;  5B0Z C;  2PYO D;  5B1M B;  3AZN D;  3AZK D;  1F1E A;  5E5A B;  3O62 C;  1F66 D;  4H9N B;  3B6G C;  3C1B C;  5B24 C;  3REI A;  3WA9 D;  1KX4 A;  5GT0 B;  3W97 C;  3LZ1 C;  5E5A A;  1P34 C;  3O62 B;  5JRG D;  5B0Z A;  1P3F D;  1EQZ D;  4H9N A;  3TU4 C;  4R8P D;  3C1B B;  2Y2O A;  5B24 B;  3UTB D;  3AZJ D;  5GT3 D;  3W97 B;  3LZ1 B;  2JSS A;  3TU4 B;  3B6G A;  3C1B A;  5B24 A;  3C1C C;  3FDD A;  3LZ1 A;  1P34 A;  3X1V C;  4J8X C;  3WAA A;  3LEL C;  1PZR A;  3REJ C;  1N1J A;  3B0B A;  3C1C B;  2JE5 A;  3X1V B;  5AV5 D;  4J8X B;  5GXQ C;  1M18 B;  3MGS D;  3AFA C;  4J8U A;  3X1V A;  4J8X A;  3LEL A;  3REJ A;  3LJA C;  4WV4 B;  4AWL C;  3AFA B;  5BT1 C;  3AZH A;  1U35 B;  5B40 C;  1TZY C;  4UUZ B;  3LJA B;  3H0M C;  5GXQ A;  1ID3 B;  3W99 D;  4AWL B;  3AFA A;  3VH6 A;  3KUY A;  4WU8 D;  5CPI D;  2Y2J A;  4KUD B;  3EPH A;  4UUZ A;  1TZY B;  3EG5 B;  3X1T D;  1P3A C;  1S32 C;  3F6T A;  4KHA B;  4Z5T C;  5AV6 C;  1P3P C;  5DNN B;  1TZY A;  5C3I C;  5B40 A;  4ZUX B;  1P3A B;  1S32 B;  5CPK B;  4Z5T B;  5AV6 B;  5C3I B;  5AY8 C;  4E45 A;  1P3A A;  2YFW A;  3VH6 T;  3R45 B;  1S32 A;  3KXB D;  4Z5T A;  5B31 D;  1P3M D;  5AV6 A;  3KFU G;  1P3P A;  3AV1 D;  3REK C;  3R45 A;  2Y2M A;  1HQ3 D;  1P3O C;  3X1U D;  2Y2Q A;  5AY8 A;  2ARO D;  4DRA A;  3REK B;  4KGC D;  1P3O B;  2LY8 A;  1AOI C;  4H9O B;  5AVC C;  1A7W A;  5F99 C;  2ZM5 A;  1P3G C;  1AOI B;  1M1A C;  1KU5 A;  5AVC B;  3B6F A;  3MGQ C;  2NZD C;  5G49 A;  5BNV B;  3A6N D;  3UT9 D;  3MGQ B;  5F99 A;  2Y2G A;  2NZD B;  5BNV A;  1P3G A;  3AYW D;  1M1A A;  3MGQ A;  2NZD A;  4XUJ A;  5DNM C;  4LD9 C;  3EPK A;  3LZ0 C;  3REI D;  1KX4 D;  1H3O B;  5E5A D;  5B0Z D;  5DNM B;  3REH C;  4LD9 B;  4X23 B;  1P3L C;  3B6G D;  3W96 C;  3C1B D;  5AVB C;  4EO5 B;  5B24 D;  3WTP C;  3LZ0 A;  4WU9 C;  3LZ1 D;  1P34 D;  1HQ3 A;  3REH A;  3WAA D;  3TU4 D;  3W96 B;  5AVB B;  3AZG C;  4WU9 B;  3WTP B;  1P3L A;  5JA4 B;  3MVD C;  3W96 A;  3C1C D;  3AZG B;  3X1V D;  2J8P A;  4J8X D;  1KX5 B;  4J8W C;  3MVD B;  4WZS B;  3LEL D;  3P5J B;  3REJ D;  3WKJ B;  3H0R C;  3AZE B;  3NQU A;  4H9R B;  3AZH D;  1P3I C;  3MVD A;  3KWQ B;  2G5H C;  4WNN A;  1KX3 C;  5CP6 B;  5GXQ D;  2XD5 A;  4YM6 A;  3AFA D;  2IO5 B;  3KUY D;  4J8W A;  5B2J B;  3AYW A;  5BT1 D;  1P3I A;  4J8V A;  5GT0 C;  5B40 D;  1TZY D;  1KX3 A;  4H9Q A;  1M19 A;  2L5A A;  2FJ7 C;  5B1M A;  2VQR A;  1P3B C;  5BNX B;  1P3A D;  1S32 D;  2FJ7 B;  5B32 C;  4Z5T D;  1P3B B;  5AV6 D;  5GT0 A;  1P3P D;  3O62 A;  2JCH A;  3REL C;  2FJ7 A;  5B32 B;  1P3B A;  4QLC B;  5CPJ C;  3W97 A;  5AY8 D;  4Z66 C;  3REL B;  3TU4 A;  1M18 C;  5CPJ B;  1ULY A;  3REL A;  4Z66 B;  1WWS A;  4XZQ C;  3C1C A;  2BYM B;  4E44 A;  1U35 C;  5B1L C;  4XZQ B;  3B6F D;  1M18 A;  1ID3 C;  4KUD C;  4UPK A;  1BH9 B;  5B1L B;  5F99 D;  3VH5 A;  2F8N B;  1P3G D;  4G91 B;  2RVQ C;  2UWX A;  1M1A D;  1U35 A;  5DNN C;  5B1L A;  3LJA A;  4ZUX C;  1P3K C;  3MGQ D;  1ID3 A;  2NZD D;  4XUJ D;  5CPK C;  4KUD A;  1P3K B;  4KHA A;  3AZF B;  4YS3 C;  5DNN A;  4ZUX A;  3MNN C;  3VH5 T;  1T3U A;  3AN2 B;  1ZLA B;  3AZL B;  5AV8 C;  2Y2L A;  5CPK A;  4YS3 B;  3AZN C;  3MNN B;  3LZ0 D;  3AZK C;  2CV5 C;  3AV2 B;  1F66 C;  4Z2M H;  5AV8 B;  2PYO B;  3REH D;  3MNN A;  3AZN B;  3AZK B;  2CV5 B;  5AV8 A;  1F66 B;  1P3L D;  2BYK B;  5B2I C;  3W96 D;  3AZJ C;  3WA9 B;  2CV5 A;  3REK A;  5JRG B;  1P3O A;  5B2I B;  3UTB B;  3AZJ B;  4H9O A;  5GT3 B;  5B0Y C;  2Y2P A;  3EPJ A;  3MVD D;  5B2I A;  3X1S C;  1AOI A;  4CSR B;  4YM6 D;  5AV5 C;  5AVC A;  5B0Y B;  2Y2I A;  5BS7 C;  3X1S B;  4J8W D;  3MGS C;  5B0Y A;  5AV5 B;  2Y2K A;  1P3I D;  4J8V D;  3X1S A;  3WTP E;  5CHL B;  1KX3 D;  2CWE A;  3MGS B;  1M19 D;  5AV9 C;  2ZY5 A;  2F8N K;  5B1M D;  2HIO C;  2F8N H;  5BS7 A;  3W99 C;  3V9R B;  3AL0 C;  4X23 C;  5AV9 B;  2HIO B;  4EO5 C;  3MGR C;  1H3O A;  5GT0 D;  3O62 D;  3W99 B;  5DNM A;  4ZBJ B;  5CPI B;  2FJ7 D;  4WU8 B;  4WJ3 C;  1R4V A;  4LD9 A;  5GSU C;  1P3B D;  3MGR B;  5FUG B;  3W97 D;  4X23 A;  5KDM B;  5GSU B;  3MGR A;  3MGP C;  3AZI C;  3REL D;  1KX5 C;  3KXB C;  5B31 C;  5GSU A;  5AVB A;  3AZE C;  3WTP A;  4WU9 A;  3WKJ C;  3MGP B;  1BH8 B;  3NQJ B;  3AZI B;  3W98 C;  5JA4 A;  3KWQ C;  3KXB B;  5B31 B;  5CP6 C;  1M18 D;  3AZG A;  3MGP A;  3AV1 B;  2IO5 C;  3W98 B;  1KX5 A;  5B2J C;  3WKJ A;  3AZE A;  4H9R A;  1Z2C B;  2ARO B;  5B33 C;  3AZM C;  3W98 A;  3KWQ A;  1U35 D;  5B1L D;  5CP6 A;  3LJA D;  4JJN C;  1ID3 D;  5B33 B;  3AZM B;  4KUD D;  5B2J A;  4JJN B;  5B33 A;  2RIQ A;  3AZM A;  3UTA C;  5DNN D;  4JJN A;  4ZUX D;  2NQB C;  4CAY B;  4Z2M G;  3A6N B;  1JFI B;  5CPK D;  4QLC C;  3UTA B;  3UT9 B;  5BNX A;  2NQB B;  4CAY A;  3UTA A;  2HUE C;  3MNN D;  2NQB A;  5B32 G;  5AV8 D;  5B32 A;  4QLC A;  2HUE B;  3REI B;  1KX4 B;  2CV5 D;  3REK D;  5B0Z B;  1P3O D;  3B0D C;  5CPJ A;  4Z66 A;  3WAA C;  3B0D B;  3B6G B;  5B2I D;  2BYM A;  4G91 C;  1AOI D;  1P34 B;  4XZQ A;  5AVC D;  3WAA B;  1N1J B;  4NE3 A;  4J8U C;  1BH9 A;  5B0Y D;  2F8N G;  2F8N A;  3X1S D;  3B0C W;  3AZF C;  3H0L C;  4J8U B;  3AZH C;  4NFT A;  3LEL B;  3REJ B;  3AN2 C;  1ZLA C;  3AZL C;  3KUY C;  3AZH B;  1P3K A;  2F2A C;  3AV2 C;  5GXQ B;  3AZF A;  2Y2H A;  5DNM D;  2PYO C;  5AV9 D;  3KUY B;  2W8S A;  2HIO D;  4LD9 D;  3AN2 A;  1ZLA A;  3AZL A;  3IP4 C;  4X23 D;  4YS3 A;  2DQN C;  3WA9 C;  5B40 B;  3MGR D;  3AV2 A;  1P3F C;  5JRG C;  1EQZ C;  4NE6 A;  2YFV B;  2PYO A;  4R8P C;  3UTB C;  3AZN A;  5GSU D;  5AVB D;  4WU9 D;  5GT3 C;  3WTP D;  3AZK A;  1F66 A;  1P3F B;  1EQZ B;  2YFW B;  2YFV A;  2BYK A;  4R8P B;  3WA9 A;  3KSY A;  1P3P B;  3AZG D; 
#chains in the Genus database with same CATH homology
 3MGP D;  3AZI D;  2DF4 C;  1P3F A;  5JRG A;  1EQZ A;  1KX5 D;  4R8P A;  3UTB A;  3AZJ A;  3WKJ D;  2FFF B;  5GT3 A;  3AZE D;  5AY8 B;  3W98 D;  3KWQ D;  5CP6 D;  4CSR A;  1Q9C A;  4NE5 A;  5B2J D;  3B6F C;  4H9P B;  5BO0 B;  3A1I A;  5AV5 A;  5B33 D;  1HTA A;  3AZM D;  3B6F B;  4JJN D;  4H9P A;  5BO0 A;  3MGS A;  5G49 B;  4ZBJ C;  5CPI C;  4WU8 C;  1WWI A;  2Y2N A;  3X1T C;  3V9R A;  5F99 B;  1P3G B;  5AV9 A;  4XUJ C;  2HIO A;  1M1A B;  3UTA D;  3X1T B;  3W99 A;  2NQB D;  5CPI A;  4HGA C;  4WU8 A;  5B32 D;  4XUJ B;  1B67 A;  4QLC D;  3X1T A;  5FUG A;  2G5I C;  4DRB A;  5KDM A;  4HGA B;  1P3M C;  2ZY2 A;  1W2E A;  5CPJ D;  3AV1 C;  4Z66 D;  1HQ3 C;  3B0C T;  1P3M B;  4H9S C;  3X1U C;  2ZY3 A;  1BH8 A;  2BG1 A;  3NQJ A;  3LZ0 B;  3AZI A;  2ARO C;  4DQY B;  5B31 G;  3KXB A;  1HQ3 B;  5B31 A;  4XZQ D;  1P3M A;  4KGC C;  2XD1 A;  3REH B;  3X1U B;  2ZY4 A;  3AV1 A;  4H9S A;  4KGC B;  1P3L B;  3X1U A;  2F8N D;  2ARO A;  4M6B A;  4KGC A;  3VH5 W;  1TAF B;  4G92 C;  3VH6 W;  3A6N C;  1BFM A;  3NQU B;  2RVQ D;  4YM6 C;  4J8U D;  3UT9 C;  1TAF A;  1P3K D;  4G92 B;  4WNN B;  3AYW C;  3AZF D;  4YM6 B;  3EPL A;  4J8V C;  4J8W B;  3AN2 D;  1ZLA D;  3AZL D;  1M19 C;  3A6N A;  3AYW B;  1JFI A;  3UT9 A;  5B1M C;  4YS3 D;  3REI C;  4J8V B;  1P3I B;  1KX4 C;  1B6W A;  3A1K A;  1KX3 B;  5E5A C;  3AV2 D;  4H9Q B;  1M19 B;  5B0Z C;  2PYO D;  5B1M B;  3AZN D;  3AZK D;  1F1E A;  5E5A B;  3O62 C;  1F66 D;  4H9N B;  3B6G C;  3C1B C;  5B24 C;  3REI A;  3WA9 D;  1KX4 A;  5GT0 B;  3W97 C;  3LZ1 C;  5E5A A;  1P34 C;  3O62 B;  5JRG D;  5B0Z A;  1P3F D;  1EQZ D;  4H9N A;  3TU4 C;  4R8P D;  3C1B B;  2Y2O A;  5B24 B;  3UTB D;  3AZJ D;  5GT3 D;  3W97 B;  3LZ1 B;  2JSS A;  3TU4 B;  3B6G A;  3C1B A;  5B24 A;  3C1C C;  3FDD A;  3LZ1 A;  1P34 A;  3X1V C;  4J8X C;  3WAA A;  3LEL C;  1PZR A;  3REJ C;  1N1J A;  3B0B A;  3C1C B;  2JE5 A;  3X1V B;  5AV5 D;  4J8X B;  5GXQ C;  1M18 B;  3MGS D;  3AFA C;  4J8U A;  3X1V A;  4J8X A;  3LEL A;  3REJ A;  3LJA C;  4WV4 B;  4AWL C;  3AFA B;  5BT1 C;  3AZH A;  1U35 B;  5B40 C;  1TZY C;  4UUZ B;  3LJA B;  3H0M C;  5GXQ A;  1ID3 B;  3W99 D;  4AWL B;  3AFA A;  3VH6 A;  3KUY A;  4WU8 D;  5CPI D;  2Y2J A;  4KUD B;  3EPH A;  4UUZ A;  1TZY B;  3EG5 B;  3X1T D;  1P3A C;  1S32 C;  3F6T A;  4KHA B;  4Z5T C;  5AV6 C;  1P3P C;  5DNN B;  1TZY A;  5C3I C;  5B40 A;  4ZUX B;  1P3A B;  1S32 B;  5CPK B;  4Z5T B;  5AV6 B;  5C3I B;  5AY8 C;  4E45 A;  1P3A A;  2YFW A;  3VH6 T;  3R45 B;  1S32 A;  3KXB D;  4Z5T A;  5B31 D;  1P3M D;  5AV6 A;  3KFU G;  1P3P A;  3AV1 D;  3REK C;  3R45 A;  2Y2M A;  1HQ3 D;  1P3O C;  3X1U D;  2Y2Q A;  5AY8 A;  2ARO D;  4DRA A;  3REK B;  4KGC D;  1P3O B;  2LY8 A;  1AOI C;  4H9O B;  5AVC C;  1A7W A;  5F99 C;  2ZM5 A;  1P3G C;  1AOI B;  1M1A C;  1KU5 A;  5AVC B;  3B6F A;  3MGQ C;  2NZD C;  5G49 A;  5BNV B;  3A6N D;  3UT9 D;  3MGQ B;  5F99 A;  2Y2G A;  2NZD B;  5BNV A;  1P3G A;  3AYW D;  1M1A A;  3MGQ A;  2NZD A;  4XUJ A;  5DNM C;  4LD9 C;  3EPK A;  3LZ0 C;  3REI D;  1KX4 D;  1H3O B;  5E5A D;  5B0Z D;  5DNM B;  3REH C;  4LD9 B;  4X23 B;  1P3L C;  3B6G D;  3W96 C;  3C1B D;  5AVB C;  4EO5 B;  5B24 D;  3WTP C;  3LZ0 A;  4WU9 C;  3LZ1 D;  1P34 D;  1HQ3 A;  3REH A;  3WAA D;  3TU4 D;  3W96 B;  5AVB B;  3AZG C;  4WU9 B;  3WTP B;  1P3L A;  5JA4 B;  3MVD C;  3W96 A;  3C1C D;  3AZG B;  3X1V D;  2J8P A;  4J8X D;  1KX5 B;  4J8W C;  3MVD B;  4WZS B;  3LEL D;  3P5J B;  3REJ D;  3WKJ B;  3H0R C;  3AZE B;  3NQU A;  4H9R B;  3AZH D;  1P3I C;  3MVD A;  3KWQ B;  2G5H C;  4WNN A;  1KX3 C;  5CP6 B;  5GXQ D;  2XD5 A;  4YM6 A;  3AFA D;  2IO5 B;  3KUY D;  4J8W A;  5B2J B;  3AYW A;  5BT1 D;  1P3I A;  4J8V A;  5GT0 C;  5B40 D;  1TZY D;  1KX3 A;  4H9Q A;  1M19 A;  2L5A A;  2FJ7 C;  5B1M A;  2VQR A;  1P3B C;  5BNX B;  1P3A D;  1S32 D;  2FJ7 B;  5B32 C;  4Z5T D;  1P3B B;  5AV6 D;  5GT0 A;  1P3P D;  3O62 A;  2JCH A;  3REL C;  2FJ7 A;  5B32 B;  1P3B A;  4QLC B;  5CPJ C;  3W97 A;  5AY8 D;  4Z66 C;  3REL B;  3TU4 A;  1M18 C;  5CPJ B;  1ULY A;  3REL A;  4Z66 B;  1WWS A;  4XZQ C;  3C1C A;  2BYM B;  4E44 A;  1U35 C;  5B1L C;  4XZQ B;  3B6F D;  1M18 A;  1ID3 C;  4KUD C;  4UPK A;  1BH9 B;  5B1L B;  5F99 D;  3VH5 A;  2F8N B;  1P3G D;  4G91 B;  2RVQ C;  2UWX A;  1M1A D;  1U35 A;  5DNN C;  5B1L A;  3LJA A;  4ZUX C;  1P3K C;  3MGQ D;  1ID3 A;  2NZD D;  4XUJ D;  5CPK C;  4KUD A;  1P3K B;  4KHA A;  3AZF B;  4YS3 C;  5DNN A;  4ZUX A;  3MNN C;  3VH5 T;  1T3U A;  3AN2 B;  1ZLA B;  3AZL B;  5AV8 C;  2Y2L A;  5CPK A;  4YS3 B;  3AZN C;  3MNN B;  3LZ0 D;  3AZK C;  2CV5 C;  3AV2 B;  1F66 C;  4Z2M H;  5AV8 B;  2PYO B;  3REH D;  3MNN A;  3AZN B;  3AZK B;  2CV5 B;  5AV8 A;  1F66 B;  1P3L D;  2BYK B;  5B2I C;  3W96 D;  3AZJ C;  3WA9 B;  2CV5 A;  3REK A;  5JRG B;  1P3O A;  5B2I B;  3UTB B;  3AZJ B;  4H9O A;  5GT3 B;  5B0Y C;  2Y2P A;  3EPJ A;  3MVD D;  5B2I A;  3X1S C;  1AOI A;  4CSR B;  4YM6 D;  5AV5 C;  5AVC A;  5B0Y B;  2Y2I A;  5BS7 C;  3X1S B;  4J8W D;  3MGS C;  5B0Y A;  5AV5 B;  2Y2K A;  1P3I D;  4J8V D;  3X1S A;  3WTP E;  5CHL B;  1KX3 D;  2CWE A;  3MGS B;  1M19 D;  5AV9 C;  2ZY5 A;  2F8N K;  5B1M D;  2HIO C;  2F8N H;  5BS7 A;  3W99 C;  3V9R B;  3AL0 C;  4X23 C;  5AV9 B;  2HIO B;  4EO5 C;  3MGR C;  1H3O A;  5GT0 D;  3O62 D;  3W99 B;  5DNM A;  4ZBJ B;  5CPI B;  2FJ7 D;  4WU8 B;  4WJ3 C;  1R4V A;  4LD9 A;  5GSU C;  1P3B D;  3MGR B;  5FUG B;  3W97 D;  4X23 A;  5KDM B;  5GSU B;  3MGR A;  3MGP C;  3AZI C;  3REL D;  1KX5 C;  3KXB C;  5B31 C;  5GSU A;  5AVB A;  3AZE C;  3WTP A;  4WU9 A;  3WKJ C;  3MGP B;  1BH8 B;  3NQJ B;  3AZI B;  3W98 C;  5JA4 A;  3KWQ C;  3KXB B;  5B31 B;  5CP6 C;  1M18 D;  3AZG A;  3MGP A;  3AV1 B;  2IO5 C;  3W98 B;  1KX5 A;  5B2J C;  3WKJ A;  3AZE A;  4H9R A;  1Z2C B;  2ARO B;  5B33 C;  3AZM C;  3W98 A;  3KWQ A;  1U35 D;  5B1L D;  5CP6 A;  3LJA D;  4JJN C;  1ID3 D;  5B33 B;  3AZM B;  4KUD D;  5B2J A;  4JJN B;  5B33 A;  2RIQ A;  3AZM A;  3UTA C;  5DNN D;  4JJN A;  4ZUX D;  2NQB C;  4CAY B;  4Z2M G;  3A6N B;  1JFI B;  5CPK D;  4QLC C;  3UTA B;  3UT9 B;  5BNX A;  2NQB B;  4CAY A;  3UTA A;  2HUE C;  3MNN D;  2NQB A;  5B32 G;  5AV8 D;  5B32 A;  4QLC A;  2HUE B;  3REI B;  1KX4 B;  2CV5 D;  3REK D;  5B0Z B;  1P3O D;  3B0D C;  5CPJ A;  4Z66 A;  3WAA C;  3B0D B;  3B6G B;  5B2I D;  2BYM A;  4G91 C;  1AOI D;  1P34 B;  4XZQ A;  5AVC D;  3WAA B;  1N1J B;  4NE3 A;  4J8U C;  1BH9 A;  5B0Y D;  2F8N G;  2F8N A;  3X1S D;  3B0C W;  3AZF C;  3H0L C;  4J8U B;  3AZH C;  4NFT A;  3LEL B;  3REJ B;  3AN2 C;  1ZLA C;  3AZL C;  3KUY C;  3AZH B;  1P3K A;  2F2A C;  3AV2 C;  5GXQ B;  3AZF A;  2Y2H A;  5DNM D;  2PYO C;  5AV9 D;  3KUY B;  2W8S A;  2HIO D;  4LD9 D;  3AN2 A;  1ZLA A;  3AZL A;  3IP4 C;  4X23 D;  4YS3 A;  2DQN C;  3WA9 C;  5B40 B;  3MGR D;  3AV2 A;  1P3F C;  5JRG C;  1EQZ C;  4NE6 A;  2YFV B;  2PYO A;  4R8P C;  3UTB C;  3AZN A;  5GSU D;  5AVB D;  4WU9 D;  5GT3 C;  3WTP D;  3AZK A;  1F66 A;  1P3F B;  1EQZ B;  2YFW B;  2YFV A;  2BYK A;  4R8P B;  3WA9 A;  3KSY A;  1P3P B;  3AZG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...