1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
3LJAD 1HQ3D 4Z5TC 1P3GD 4H9QB 5B1LD 4DRBA 5CPID 1ULYA 3AZNC 1KX3C 3B6FC 3W99C 4J8VB 3WKJB 5AVCD 4H9PA 5B31C 3AYWA 4QLCB 3AZKC 5GT0B 3UT9B 3AZEA 1P3OC 2CV5B 2CV5C 3UTBD 1BH8A 2HIOD 1P3PD 2BYKB 3TU4C 5GSUB 3REKA 3AN2A 4YS3A 1P3BD 5AV5D 1F66C 1P3KA 1P34D 3REIC 2CV5D 5GT3D 4QLCA 3MGRA 5B1LA 5B2IC 3X1UD 3KUYD 1KX4D 3MNNC 4AWLC 1H3OA 3LJAA 3AYWD 5B24B 2NZDD 4XZQD 5AVCC 3NQUB 1P34B 4ZUXB 5B2IA 2NZDA 1ID3A 2NQBB 5BNXA 2PYOB 3VH5W 1TZYC 1P3GC 4J8WA 3AZLD 1HQ3C 4YS3C 5FUGB 3AZHD 1S32B 1EQZC 1ZLAB 1P3IC 1ID3B 3R45B 3MVDA 4KUDC 5AV5A 1KU5A 2F8NK 3X1SC 4KGCC 2HUEB 3UTAA 5F99B 2PYOD 5B40B 5JA4B 3WTPE 5CP6D 5B1LB 4NE3A 3AZHC 1P3LB 3AZLC 1M19B 3AZJD 5CP6A 3AZMA 5DNMB 5JRGD 4YS3B 4UUZA 1P3OA 4Z5TA 5GXQB 5BNVB 4XZQA 4WNNA 4M6BA 3AYWC 5BS7C 1JFIA 4X23B 3X1UC 4ZUXC 4WU8D 3MGSB 3W98D 1P34C 1TAFA 1P3BC 3MNNB 5CPJA 1M18D 3TU4D 2HIOC 5CHLB 1P3PC 3AZMD 5CPKA 4KHAA 5B33C 2FJ7D 3C1CA 1P3LC 1M19C 4Z2MG 5AV8B 3AZGD 1KX3D 3UTBA 3WKJA 4NE6A 3REHA 4G91B 3AV1C 2F8NA 5B32C 3LZ0C 4KUDB 3VH6W 5CPJC 4JJNA 5B1MA 4CSRA 1P3AD 1Q9CA 3REJB 5AY8B 5BNVA 4Z5TB 3AZJB 5AY8A 1M1AD 2L5AA 5F99D 1AOIB 5B1MB 5AV9C 4WZSB 5CP6B 4QLCD 3REJD 1P3FA 1P34A 4KGCB 1U35C 3WTPB 3B0BA 4J8WC 4YM6C 3AV2C 1EQZA 3X1VC 2AROB 3KWQD 3C1CB 4H9SA 4NE5A 3LZ1B 4KHAB 3C1BA 3UT9C 3X1TB 3NQJB 4H9OA 4E45A 3RELB 5B24D 2NZDB 3UT9D 5C3IC 5CPIA 3A6NB 4J8UC 2BYMA 2YFWA 1F66B 3C1BC 5B40A 3AZGB 3WTPA 3X1VD 3B6FB 3KWQA 3VH6T 2F8ND 5GSUA 3REKB 3AN2B 5GT0C 5GXQA 5B32G 4J8WB 4QLCC 4XUJD 3AZFD 3WTPC 4R8PD 5E5AB 5DNNC 5B2JD 5B40C 5F99C 4Z66A 1P3FC 5B0YB 5B1MC 3AZNB 4J8UA 5DNMD 1N1JA 5AV6B 4J8XB 1EQZB 1P3GB 1N1JB 5AV6A 3WA9C 5CPJD 4KGCA 1P3AA 3REKC 3AN2C 4R8PC 3MVDB 3WTPD 3X1VA 2IO5B 1KX5D 1S32A 5FUGA 4J8XD 1KX4A 3VH5A 3C1BB 3AZGC 1P3LD 1M19D 3AZEB 2FJ7C 4G91C 3REIB 4J8UD 3LELB 1M18C 3O62A 5AVBB 3O62C 3MGRC 3AZED 5B2JA 3W97A 3KSYA 4WU8B 3B0CT 4LD9B 3A6ND 5BT1D 3MGPA 1F1EA 2LY8A 3B6GB 4J8WD 3AZMB 3AYWB 5B31A 1U35D 3KXBD 5AY8C 3REJC 1ID3D 3AZJC 1M1AB 5B32B 3LZ0B 3X1SA 3B6GA 3VH5T 3AZJA 1WWSA 4KGCD 1ZLAA 1HTAA 4J8VD 3AZIA 4KUDD 2PYOA 3V9RB 5BS7A 3X1SB 5JRGB 5DNMA 5B32D 4YS3D 3LZ0D 3UTAC 1EQZD 4WU9D 3AV1D 4KUDA 3KWQB 5CPKD 4R8PA 4XZQC 1HQ3B 3WA9A 5B0ZC 5B33D 5KDMA 3RELD 1KX4C 3REIA 3KUYC 5B2ID 1P3KC 5B31G 3AZMC 5GT3C 5GT3B 5E5AA 3B0DB 3REID 5AVCB 5AV5C 1F66D 4WU8A 2CV5A 3X1UA 5GXQC 5GT0A 3MGQD 3AZKA 1P3BA 5KDMB 5BO0B 4ZUXD 5B24A 1P3KD 1P3OD 3AZGA 3MGRB 2F8NH 1BH9B 3AZKB 3AZNA 3MGQB 3NQJA 3AZND 5CPIC 5AV6C 5B1LC 4WU9C 1R4VA 2CWEA 3UTAD 3KXBB 2YFVB 3LJAC 5CP6C 4J8VC 3MVDC 3AZHA 1BH9A 4JJNB 3WA9B 3VH6A 1P3GA 3X1SD 5JA4A 4R8PB 2YFWB 2BYMB 1F66A 1S32D 5B0ZA 1P3ID 3A6NA 2NQBC 4YM6A 4H9QA 5B0YC 4HGAB 3AV2A 1P3IA 1TZYD 5AV6D 4EO5B 3KXBC 3MGPB 3AV1B 4AWLB 3KUYA 5G49A 5AV9A 1BH8B 2NZDC 5B2IB 1P3MB 5BT1C 3MNND 3LZ1D 2AROA 5B33B 3MNNA 2RVQC 5GXQD 4CAYB 3MGQC 3AZID 1TAFB 2F8NG 4H9SC 4CAYA 3AZEC 2FJ7B 5B31B 3O62D 3WAAB 3B6GD 3UTBC 3LELD 3X1TC 1U35B 3AZIB 2JSSA 3AZKD 3B0DC 3RELC 2IO5C 1U35A 4H9RA 5B0ZD 3C1CC 5B31D 2AROC 3W99D 5CPKC 3AFAC 4HGAC 3B6FD 4J8XC 5E5AD 5B2JB 1P3AB 1KX5C 4Z2MH 2F8NB 5B0ZB 4Z5TD 1BFMA 3REKD 3AN2D 5B33A 3WA9D 3W97D 3MGPC 4JJNC 3UTAB 4NFTA 3AZHB 1ZLAD 1JFIB 5B0YA 3R45A 3REHC 3AV1A 1P3FD 1B67A 5B40D 5DNND 5B2JC 3W96D 4H9NA 3AFAB 1P3IB 4XUJC 4ZUXA 3AZFC 1ID3C 5CPJB 1P3LA 5AY8D 5GT0D 3MGQA 1M19A 1M1AA 1P3MD 3AZLA 2HIOB 1P3PB 1AOID 4J8XA 3A6NC 3C1BD 4J8UB 4WU9B 1P3BB 3W98B 5AV5B 5CPIB 5AV8C 4ZBJB 4Z66B 3WAAC 5AVBD 3RELA 3KXBA 3WKJD 3X1TA 1KX4B 4G92B 4UUZB 3MGSD 5DNNA 2NQBA 3MGRD 3WAAA 4YM6B 3AV2B 5GSUC 4WU9A 1WWIA 5AVBC 3O62B 3WAAD 3TU4B 5AV8D 3KWQC 4J8VA 4ZBJC 5F99A 4Z66C 1TZYA 4LD9D 4EO5C 4X23A 1AOIC 4YM6D 3AV2D 4WNNB 5AV9B 3KUYB 4X23C 1AOIA 5AVCA 3UT9A 1M1AC 4CSRB 3REHD 3NQUA 1TZYB 5DNMC 1HQ3A 4XUJB 3AZFB 1H3OB 3LJAB 5B1MD 3AZLB 1A7WA 3MGPD 2HUEC 5BO0A 4H9NB 3AFAA 4X23D 5E5AC 5DNNB 5AV8A 3W96B 3AFAD 4H9RB 2AROD 5BNXB 3LZ1A 4LD9C 3REJA 4Z66D 3C1CD 5CPKB 1KX5B 3W99A 3W98A 3B6FA 4DRAA 3X1TD 4H9PB 3LELC 5GSUD 4G92C 3TU4A 3B6GC 5AVBA 5B24C 3B0CW 3UTBB 3MGSC 3LELA 5C3IB 1P3KB 3AZIC 3X1UB 4H9OB 3WKJC 2RVQD 3W98C 5JRGA 4WU8C 1KX5A 3W99B 1P3MA 1KX3B 2BYKA 4XZQB 3LZ1C 5GT3A 5G49B 4LD9A 1KX3A 1P3OB 3W96A 1M18B 5B32A 3LZ0A 3W97B 1P3MC 3X1VB 2FJ7A 5JRGC 2HIOA 1P3PA 3W96C 5B0YD 3REHB 3MGSA 5AV9D 2NQBD 1P3FB 4XUJA 4E44A 3AZFA 4WV4B 1S32C 1B6WA 1M18A 3V9RA 2PYOC 1P3AC 1ZLAC 2YFVA 3MVDD 4JJND 3W97C
chains in the Genus database with same CATH superfamily
3LJAD 1HQ3D 4Z5TC 1P3GD 4H9QB 5B1LD 4DRBA 5CPID 1ULYA 3AZNC 1KX3C 3B6FC 3W99C 4J8VB 3WKJB 2JE5A 5AVCD 4H9PA 5B31C 3AYWA 4QLCB 3AZKC 5GT0B 3UT9B 3AZEA 1P3OC 2CV5B 2CV5C 3UTBD 1BH8A 2VQRA 2HIOD 1P3PD 2BYKB 3TU4C 3IP4C 5GSUB 3REKA 3AN2A 4YS3A 1P3BD 5AV5D 1F66C 2DF4C 1P3KA 1P34D 3REIC 2CV5D 5GT3D 4QLCA 3MGRA 5B1LA 5B2IC 3X1UD 2Y2MA 3KUYD 1KX4D 3MNNC 4AWLC 1H3OA 3LJAA 3AYWD 5B24B 2NZDD 4XZQD 5AVCC 3NQUB 1P34B 3AL0C 4ZUXB 5B2IA 2NZDA 1ID3A 2NQBB 5BNXA 2PYOB 3VH5W 1TZYC 1P3GC 4J8WA 3AZLD 1HQ3C 4YS3C 5FUGB 3AZHD 1S32B 1EQZC 1ZLAB 1P3IC 1ID3B 3R45B 3MVDA 4KUDC 5AV5A 1KU5A 2F8NK 3X1SC 4KGCC 2HUEB 3UTAA 5F99B 2PYOD 5B40B 5JA4B 3WTPE 2DQNC 5CP6D 5B1LB 4NE3A 3AZHC 1P3LB 3AZLC 1M19B 3AZJD 5CP6A 3AZMA 5DNMB 5JRGD 4YS3B 4UUZA 1P3OA 4Z5TA 5GXQB 5BNVB 3A1KA 4XZQA 4WNNA 4M6BA 3AYWC 5BS7C 2ZM5A 1JFIA 4X23B 3X1UC 2ZY2A 4ZUXC 4WU8D 3EG5B 3MGSB 3W98D 1P34C 1TAFA 1P3BC 3MNNB 5CPJA 1M18D 3TU4D 2HIOC 5CHLB 1P3PC 2ZY3A 3AZMD 5CPKA 4KHAA 5B33C 2FJ7D 3C1CA 1P3LC 1M19C 4Z2MG 5AV8B 3AZGD 1KX3D 3UTBA 3WKJA 4NE6A 3REHA 4G91B 3AV1C 2F8NA 2Y2LA 5B32C 3LZ0C 4KUDB 3VH6W 5CPJC 4JJNA 5B1MA 4CSRA 1P3AD 1Q9CA 3REJB 5AY8B 5BNVA 4Z5TB 3AZJB 5AY8A 1M1AD 2L5AA 5F99D 1AOIB 5B1MB 5AV9C 4WZSB 5CP6B 4QLCD 3REJD 1P3FA 1P34A 4KGCB 1U35C 3WTPB 3B0BA 4J8WC 4YM6C 3AV2C 1EQZA 3X1VC 2AROB 3KWQD 3C1CB 4H9SA 4NE5A 3LZ1B 4KHAB 3C1BA 3EPKA 3UT9C 3X1TB 3NQJB 4H9OA 4E45A 3RELB 5B24D 2NZDB 3UT9D 5C3IC 5CPIA 3H0MC 4WJ3C 3A6NB 4J8UC 2FFFB 2BYMA 2YFWA 1F66B 3C1BC 5B40A 3AZGB 3WTPA 3X1VD 3B6FB 3KWQA 3VH6T 2F8ND 5GSUA 3REKB 3AN2B 5GT0C 5GXQA 5B32G 4J8WB 4QLCC 4XUJD 3AZFD 3WTPC 4R8PD 5E5AB 5DNNC 5B2JD 5B40C 5F99C 4Z66A 1P3FC 2Y2PA 5B0YB 5B1MC 3AZNB 4J8UA 5DNMD 5AV6B 1N1JA 4J8XB 1EQZB 1P3GB 1N1JB 5AV6A 3WA9C 5CPJD 4KGCA 1P3AA 3REKC 3AN2C 4R8PC 3MVDB 3WTPD 3X1VA 2IO5B 1KX5D 1S32A 5FUGA 4J8XD 1KX4A 3VH5A 3C1BB 3AZGC 1PZRA 1P3LD 1M19D 3AZEB 2FJ7C 4G91C 3REIB 4J8UD 3LELB 1M18C 3O62A 5AVBB 3O62C 3MGRC 3AZED 5B2JA 3W97A 3KSYA 4WU8B 3B0CT 4LD9B 2Y2QA 5BT1D 3A6ND 3MGPA 1F1EA 2LY8A 3B6GB 4J8WD 3AZMB 3AYWB 5B31A 1U35D 3KXBD 5AY8C 3REJC 3EPHA 1ID3D 3AZJC 1M1AB 5B32B 3LZ0B 3X1SA 3B6GA 3VH5T 2ZY4A 3AZJA 1WWSA 4KGCD 1ZLAA 1HTAA 4J8VD 3AZIA 4KUDD 2PYOA 3V9RB 5BS7A 3X1SB 5JRGB 5DNMA 5B32D 4YS3D 3LZ0D 3EPJA 3UTAC 2G5HC 1EQZD 4WU9D 3AV1D 4KUDA 3KWQB 5CPKD 4R8PA 3A1IA 4XZQC 1HQ3B 3WA9A 5B0ZC 5B33D 5KDMA 3RELD 1KX4C 3REIA 3KUYC 5B2ID 1P3KC 5B31G 3AZMC 5GT3C 5GT3B 5E5AA 3B0DB 3REID 5AVCB 5AV5C 1F66D 4WU8A 2JCHA 2CV5A 3X1UA 5GXQC 5GT0A 3MGQD 3AZKA 1P3BA 5KDMB 5BO0B 4ZUXD 5B24A 1P3KD 1P3OD 3FDDA 3AZGA 3MGRB 2F8NH 1BH9B 3AZKB 3AZNA 3MGQB 3NQJA 3AZND 5CPIC 5AV6C 5B1LC 4WU9C 1R4VA 2CWEA 3UTAD 3KXBB 2YFVB 3LJAC 5CP6C 4UPKA 4J8VC 3MVDC 3AZHA 1BH9A 4JJNB 3WA9B 3VH6A 1P3GA 3X1SD 2W8SA 5JA4A 2YFWB 2BYMB 4R8PB 1F66A 1S32D 5B0ZA 1P3ID 3A6NA 2NQBC 4YM6A 4H9QA 5B0YC 4HGAB 3AV2A 1P3IA 1TZYD 2Y2IA 3KFUG 5AV6D 4EO5B 3KXBC 3MGPB 3AV1B 4AWLB 3KUYA 5G49A 5AV9A 1BH8B 2NZDC 5B2IB 1P3MB 5BT1C 3MNND 3LZ1D 2XD1A 2AROA 5B33B 3MNNA 2RVQC 5GXQD 4CAYB 3MGQC 3AZID 1TAFB 2F8NG 4H9SC 4CAYA 3AZEC 2FJ7B 2Y2NA 5B31B 3O62D 3WAAB 3B6GD 3F6TA 3UTBC 3LELD 3X1TC 1U35B 3AZIB 2JSSA 3AZKD 3B0DC 3RELC 2IO5C 1U35A 4H9RA 5B0ZD 3C1CC 5B31D 2AROC 3W99D 5CPKC 3AFAC 4HGAC 3B6FD 4J8XC 5E5AD 5B2JB 1P3AB 1KX5C 4Z2MH 2F8NB 5B0ZB 4Z5TD 1BFMA 3REKD 3AN2D 5B33A 3WA9D 3W97D 3MGPC 4JJNC 3UTAB 4NFTA 3AZHB 1ZLAD 1JFIB 5B0YA 2Y2GA 3R45A 3H0LC 3REHC 3AV1A 1P3FD 1B67A 3P5JB 5B40D 5DNND 5B2JC 3W96D 4H9NA 3AFAB 1P3IB 4XUJC 4ZUXA 3AZFC 1ID3C 5CPJB 1P3LA 5AY8D 5GT0D 3MGQA 1M19A 1Z2CB 2Y2KA 1M1AA 1P3MD 3AZLA 2HIOB 4DQYB 1P3PB 2Y2HA 4J8XA 1AOID 3A6NC 3C1BD 4J8UB 2Y2JA 4WU9B 1P3BB 5AV5B 3W98B 5CPIB 5AV8C 3EPLA 4ZBJB 4Z66B 3WAAC 5AVBD 3RELA 3KXBA 3WKJD 1W2EA 3X1TA 2RIQA 1KX4B 4G92B 4UUZB 3MGSD 5DNNA 2NQBA 3MGRD 3WAAA 4YM6B 3AV2B 5GSUC 4WU9A 1WWIA 5AVBC 3O62B 3WAAD 3TU4B 5AV8D 3KWQC 4J8VA 4ZBJC 5F99A 4Z66C 1TZYA 4LD9D 4EO5C 4X23A 1AOIC 4YM6D 3AV2D 4WNNB 5AV9B 3KUYB 4X23C 1AOIA 5AVCA 3UT9A 1M1AC 4CSRB 3REHD 3NQUA 1TZYB 5DNMC 1HQ3A 4XUJB 3AZFB 1H3OB 3LJAB 5B1MD 2J8PA 2UWXA 2XD5A 3AZLB 1A7WA 3MGPD 2HUEC 5BO0A 4H9NB 3AFAA 4X23D 5E5AC 5DNNB 5AV8A 3W96B 3AFAD 4H9RB 3H0RC 2F2AC 2AROD 5BNXB 3LZ1A 4LD9C 3REJA 4Z66D 3C1CD 5CPKB 1KX5B 3W99A 3W98A 3B6FA 4DRAA 3X1TD 4H9PB 1T3UA 3LELC 5GSUD 4G92C 3TU4A 3B6GC 5AVBA 5B24C 2Y2OA 2ZY5A 3B0CW 3UTBB 3MGSC 3LELA 5C3IB 1P3KB 3AZIC 3X1UB 4H9OB 3WKJC 2RVQD 3W98C 5JRGA 4WU8C 1KX5A 3W99B 1P3MA 1KX3B 2BYKA 4XZQB 3LZ1C 5GT3A 5G49B 4LD9A 1KX3A 1P3OB 2BG1A 3W96A 1M18B 5B32A 3LZ0A 3W97B 1P3MC 3X1VB 2FJ7A 5JRGC 2HIOA 1P3PA 2G5IC 3W96C 5B0YD 3REHB 3MGSA 5AV9D 2NQBD 1P3FB 4XUJA 4E44A 3AZFA 4WV4B 1S32C 1B6WA 1M18A 3V9RA 2PYOC 1P3AC 1ZLAC 2YFVA 3MVDD 4JJND 3W97C
chains in the Genus database with same CATH topology
3LJAD 1HQ3D 4Z5TC 1P3GD 4H9QB 5B1LD 4DRBA 5CPID 1ULYA 3AZNC 1KX3C 3B6FC 3W99C 4J8VB 3WKJB 2JE5A 5AVCD 4H9PA 5B31C 3AYWA 4QLCB 3AZKC 5GT0B 3UT9B 3AZEA 1P3OC 2CV5B 2CV5C 3UTBD 1BH8A 2VQRA 2HIOD 1P3PD 2BYKB 3TU4C 3IP4C 5GSUB 3REKA 3AN2A 4YS3A 1P3BD 5AV5D 1F66C 2DF4C 1P3KA 1P34D 3REIC 2CV5D 5GT3D 4QLCA 3MGRA 5B1LA 5B2IC 3X1UD 2Y2MA 3KUYD 1KX4D 3MNNC 4AWLC 1H3OA 3LJAA 3AYWD 5B24B 2NZDD 4XZQD 5AVCC 3NQUB 1P34B 3AL0C 4ZUXB 5B2IA 2NZDA 1ID3A 2NQBB 5BNXA 2PYOB 3VH5W 1TZYC 1P3GC 4J8WA 3AZLD 1HQ3C 4YS3C 5FUGB 3AZHD 1S32B 1EQZC 1ZLAB 1P3IC 1ID3B 3R45B 3MVDA 4KUDC 5AV5A 1KU5A 2F8NK 3X1SC 4KGCC 2HUEB 3UTAA 5F99B 2PYOD 5B40B 5JA4B 3WTPE 2DQNC 5CP6D 5B1LB 4NE3A 3AZHC 1P3LB 3AZLC 1M19B 3AZJD 5CP6A 3AZMA 5DNMB 5JRGD 4YS3B 4UUZA 1P3OA 4Z5TA 5GXQB 5BNVB 3A1KA 4XZQA 4WNNA 4M6BA 3AYWC 5BS7C 2ZM5A 1JFIA 4X23B 3X1UC 2ZY2A 4ZUXC 4WU8D 3EG5B 3MGSB 3W98D 1P34C 1TAFA 1P3BC 3MNNB 5CPJA 1M18D 3TU4D 2HIOC 5CHLB 1P3PC 2ZY3A 3AZMD 5CPKA 4KHAA 5B33C 2FJ7D 3C1CA 1P3LC 1M19C 4Z2MG 5AV8B 3AZGD 1KX3D 3UTBA 3WKJA 4NE6A 3REHA 4G91B 3AV1C 2F8NA 2Y2LA 5B32C 3LZ0C 4KUDB 3VH6W 5CPJC 4JJNA 5B1MA 4CSRA 1P3AD 1Q9CA 3REJB 5AY8B 5BNVA 4Z5TB 3AZJB 5AY8A 1M1AD 2L5AA 5F99D 1AOIB 5B1MB 5AV9C 4WZSB 5CP6B 4QLCD 3REJD 1P3FA 1P34A 4KGCB 1U35C 3WTPB 3B0BA 4J8WC 4YM6C 3AV2C 1EQZA 3X1VC 2AROB 3KWQD 3C1CB 4H9SA 4NE5A 3LZ1B 4KHAB 3C1BA 3EPKA 3UT9C 3X1TB 3NQJB 4H9OA 4E45A 3RELB 5B24D 2NZDB 3UT9D 5C3IC 5CPIA 3H0MC 4WJ3C 3A6NB 4J8UC 2FFFB 2BYMA 2YFWA 1F66B 3C1BC 5B40A 3AZGB 3WTPA 3X1VD 3B6FB 3KWQA 3VH6T 2F8ND 5GSUA 3REKB 3AN2B 5GT0C 5GXQA 5B32G 4J8WB 4QLCC 4XUJD 3AZFD 3WTPC 4R8PD 5E5AB 5DNNC 5B2JD 5B40C 5F99C 4Z66A 1P3FC 2Y2PA 5B0YB 5B1MC 3AZNB 4J8UA 5DNMD 5AV6B 1N1JA 4J8XB 1EQZB 1P3GB 1N1JB 5AV6A 3WA9C 5CPJD 4KGCA 1P3AA 3REKC 3AN2C 4R8PC 3MVDB 3WTPD 3X1VA 2IO5B 1KX5D 1S32A 5FUGA 4J8XD 1KX4A 3VH5A 3C1BB 3AZGC 1PZRA 1P3LD 1M19D 3AZEB 2FJ7C 4G91C 3REIB 4J8UD 3LELB 1M18C 3O62A 5AVBB 3O62C 3MGRC 3AZED 5B2JA 3W97A 3KSYA 4WU8B 3B0CT 4LD9B 2Y2QA 5BT1D 3A6ND 3MGPA 1F1EA 2LY8A 3B6GB 4J8WD 3AZMB 3AYWB 5B31A 1U35D 3KXBD 5AY8C 3REJC 3EPHA 1ID3D 3AZJC 1M1AB 5B32B 3LZ0B 3X1SA 3B6GA 3VH5T 2ZY4A 3AZJA 1WWSA 4KGCD 1ZLAA 1HTAA 4J8VD 3AZIA 4KUDD 2PYOA 3V9RB 5BS7A 3X1SB 5JRGB 5DNMA 5B32D 4YS3D 3LZ0D 3EPJA 3UTAC 2G5HC 1EQZD 4WU9D 3AV1D 4KUDA 3KWQB 5CPKD 4R8PA 3A1IA 4XZQC 1HQ3B 3WA9A 5B0ZC 5B33D 5KDMA 3RELD 1KX4C 3REIA 3KUYC 5B2ID 1P3KC 5B31G 3AZMC 5GT3C 5GT3B 5E5AA 3B0DB 3REID 5AVCB 5AV5C 1F66D 4WU8A 2JCHA 2CV5A 3X1UA 5GXQC 5GT0A 3MGQD 3AZKA 1P3BA 5KDMB 5BO0B 4ZUXD 5B24A 1P3KD 1P3OD 3FDDA 3AZGA 3MGRB 2F8NH 1BH9B 3AZKB 3AZNA 3MGQB 3NQJA 3AZND 5CPIC 5AV6C 5B1LC 4WU9C 1R4VA 2CWEA 3UTAD 3KXBB 2YFVB 3LJAC 5CP6C 4UPKA 4J8VC 3MVDC 3AZHA 1BH9A 4JJNB 3WA9B 3VH6A 1P3GA 3X1SD 2W8SA 5JA4A 2YFWB 2BYMB 4R8PB 1F66A 1S32D 5B0ZA 1P3ID 3A6NA 2NQBC 4YM6A 4H9QA 5B0YC 4HGAB 3AV2A 1P3IA 1TZYD 2Y2IA 3KFUG 5AV6D 4EO5B 3KXBC 3MGPB 3AV1B 4AWLB 3KUYA 5G49A 5AV9A 1BH8B 2NZDC 5B2IB 1P3MB 5BT1C 3MNND 3LZ1D 2XD1A 2AROA 5B33B 3MNNA 2RVQC 5GXQD 4CAYB 3MGQC 3AZID 1TAFB 2F8NG 4H9SC 4CAYA 3AZEC 2FJ7B 2Y2NA 5B31B 3O62D 3WAAB 3B6GD 3F6TA 3UTBC 3LELD 3X1TC 1U35B 3AZIB 2JSSA 3AZKD 3B0DC 3RELC 2IO5C 1U35A 4H9RA 5B0ZD 3C1CC 5B31D 2AROC 3W99D 5CPKC 3AFAC 4HGAC 3B6FD 4J8XC 5E5AD 5B2JB 1P3AB 1KX5C 4Z2MH 2F8NB 5B0ZB 4Z5TD 1BFMA 3REKD 3AN2D 5B33A 3WA9D 3W97D 3MGPC 4JJNC 3UTAB 4NFTA 3AZHB 1ZLAD 1JFIB 5B0YA 2Y2GA 3R45A 3H0LC 3REHC 3AV1A 1P3FD 1B67A 3P5JB 5B40D 5DNND 5B2JC 3W96D 4H9NA 3AFAB 1P3IB 4XUJC 4ZUXA 3AZFC 1ID3C 5CPJB 1P3LA 5AY8D 5GT0D 3MGQA 1M19A 1Z2CB 2Y2KA 1M1AA 1P3MD 3AZLA 2HIOB 4DQYB 1P3PB 2Y2HA 4J8XA 1AOID 3A6NC 3C1BD 4J8UB 2Y2JA 4WU9B 1P3BB 5AV5B 3W98B 5CPIB 5AV8C 3EPLA 4ZBJB 4Z66B 3WAAC 5AVBD 3RELA 3KXBA 3WKJD 1W2EA 3X1TA 2RIQA 1KX4B 4G92B 4UUZB 3MGSD 5DNNA 2NQBA 3MGRD 3WAAA 4YM6B 3AV2B 5GSUC 4WU9A 1WWIA 5AVBC 3O62B 3WAAD 3TU4B 5AV8D 3KWQC 4J8VA 4ZBJC 5F99A 4Z66C 1TZYA 4LD9D 4EO5C 4X23A 1AOIC 4YM6D 3AV2D 4WNNB 5AV9B 3KUYB 4X23C 1AOIA 5AVCA 3UT9A 1M1AC 4CSRB 3REHD 3NQUA 1TZYB 5DNMC 1HQ3A 4XUJB 3AZFB 1H3OB 3LJAB 5B1MD 2J8PA 2UWXA 2XD5A 3AZLB 1A7WA 3MGPD 2HUEC 5BO0A 4H9NB 3AFAA 4X23D 5E5AC 5DNNB 5AV8A 3W96B 3AFAD 4H9RB 3H0RC 2F2AC 2AROD 5BNXB 3LZ1A 4LD9C 3REJA 4Z66D 3C1CD 5CPKB 1KX5B 3W99A 3W98A 3B6FA 4DRAA 3X1TD 4H9PB 1T3UA 3LELC 5GSUD 4G92C 3TU4A 3B6GC 5AVBA 5B24C 2Y2OA 2ZY5A 3B0CW 3UTBB 3MGSC 3LELA 5C3IB 1P3KB 3AZIC 3X1UB 4H9OB 3WKJC 2RVQD 3W98C 5JRGA 4WU8C 1KX5A 3W99B 1P3MA 1KX3B 2BYKA 4XZQB 3LZ1C 5GT3A 5G49B 4LD9A 1KX3A 1P3OB 2BG1A 3W96A 1M18B 5B32A 3LZ0A 3W97B 1P3MC 3X1VB 2FJ7A 5JRGC 2HIOA 1P3PA 2G5IC 3W96C 5B0YD 3REHB 3MGSA 5AV9D 2NQBD 1P3FB 4XUJA 4E44A 3AZFA 4WV4B 1S32C 1B6WA 1M18A 3V9RA 2PYOC 1P3AC 1ZLAC 2YFVA 3MVDD 4JJND 3W97C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA D;  1HQ3 D;  4Z5T C;  1P3G D;  4H9Q B;  5B1L D;  4DRB A;  5CPI D;  1ULY A;  3AZN C;  1KX3 C;  3B6F C;  3W99 C;  4J8V B;  3WKJ B;  5AVC D;  4H9P A;  5B31 C;  3AYW A;  4QLC B;  3AZK C;  5GT0 B;  3UT9 B;  3AZE A;  1P3O C;  2CV5 B;  2CV5 C;  3UTB D;  1BH8 A;  2HIO D;  1P3P D;  2BYK B;  3TU4 C;  5GSU B;  3REK A;  3AN2 A;  4YS3 A;  1P3B D;  5AV5 D;  1F66 C;  1P3K A;  1P34 D;  3REI C;  2CV5 D;  5GT3 D;  4QLC A;  3MGR A;  5B1L A;  5B2I C;  3X1U D;  3KUY D;  1KX4 D;  3MNN C;  4AWL C;  1H3O A;  3LJA A;  3AYW D;  5B24 B;  2NZD D;  4XZQ D;  5AVC C;  3NQU B;  1P34 B;  4ZUX B;  5B2I A;  2NZD A;  1ID3 A;  2NQB B;  5BNX A;  2PYO B;  3VH5 W;  1TZY C;  1P3G C;  4J8W A;  3AZL D;  1HQ3 C;  4YS3 C;  5FUG B;  3AZH D;  1S32 B;  1EQZ C;  1ZLA B;  1P3I C;  1ID3 B;  3R45 B;  3MVD A;  4KUD C;  5AV5 A;  1KU5 A;  2F8N K;  3X1S C;  4KGC C;  2HUE B;  3UTA A;  5F99 B;  2PYO D;  5B40 B;  5JA4 B;  3WTP E;  5CP6 D;  5B1L B;  4NE3 A;  3AZH C;  1P3L B;  3AZL C;  1M19 B;  3AZJ D;  5CP6 A;  3AZM A;  5DNM B;  5JRG D;  4YS3 B;  4UUZ A;  1P3O A;  4Z5T A;  5GXQ B;  5BNV B;  4XZQ A;  4WNN A;  4M6B A;  3AYW C;  5BS7 C;  1JFI A;  4X23 B;  3X1U C;  4ZUX C;  4WU8 D;  3MGS B;  3W98 D;  1P34 C;  1TAF A;  1P3B C;  3MNN B;  5CPJ A;  1M18 D;  3TU4 D;  2HIO C;  5CHL B;  1P3P C;  3AZM D;  5CPK A;  4KHA A;  5B33 C;  2FJ7 D;  3C1C A;  1P3L C;  1M19 C;  4Z2M G;  5AV8 B;  3AZG D;  1KX3 D;  3UTB A;  3WKJ A;  4NE6 A;  3REH A;  4G91 B;  3AV1 C;  2F8N A;  5B32 C;  3LZ0 C;  4KUD B;  3VH6 W;  5CPJ C;  4JJN A;  5B1M A;  4CSR A;  1P3A D;  1Q9C A;  3REJ B;  5AY8 B;  5BNV A;  4Z5T B;  3AZJ B;  5AY8 A;  1M1A D;  2L5A A;  5F99 D;  1AOI B;  5B1M B;  5AV9 C;  4WZS B;  5CP6 B;  4QLC D;  3REJ D;  1P3F A;  1P34 A;  4KGC B;  1U35 C;  3WTP B;  3B0B A;  4J8W C;  4YM6 C;  3AV2 C;  1EQZ A;  3X1V C;  2ARO B;  3KWQ D;  3C1C B;  4H9S A;  4NE5 A;  3LZ1 B;  4KHA B;  3C1B A;  3UT9 C;  3X1T B;  3NQJ B;  4H9O A;  4E45 A;  3REL B;  5B24 D;  2NZD B;  3UT9 D;  5C3I C;  5CPI A;  3A6N B;  4J8U C;  2BYM A;  2YFW A;  1F66 B;  3C1B C;  5B40 A;  3AZG B;  3WTP A;  3X1V D;  3B6F B;  3KWQ A;  3VH6 T;  2F8N D;  5GSU A;  3REK B;  3AN2 B;  5GT0 C;  5GXQ A;  5B32 G;  4J8W B;  4QLC C;  4XUJ D;  3AZF D;  3WTP C;  4R8P D;  5E5A B;  5DNN C;  5B2J D;  5B40 C;  5F99 C;  4Z66 A;  1P3F C;  5B0Y B;  5B1M C;  3AZN B;  4J8U A;  5DNM D;  1N1J A;  5AV6 B;  4J8X B;  1EQZ B;  1P3G B;  1N1J B;  5AV6 A;  3WA9 C;  5CPJ D;  4KGC A;  1P3A A;  3REK C;  3AN2 C;  4R8P C;  3MVD B;  3WTP D;  3X1V A;  2IO5 B;  1KX5 D;  1S32 A;  5FUG A;  4J8X D;  1KX4 A;  3VH5 A;  3C1B B;  3AZG C;  1P3L D;  1M19 D;  3AZE B;  2FJ7 C;  4G91 C;  3REI B;  4J8U D;  3LEL B;  1M18 C;  3O62 A;  5AVB B;  3O62 C;  3MGR C;  3AZE D;  5B2J A;  3W97 A;  3KSY A;  4WU8 B;  3B0C T;  4LD9 B;  3A6N D;  5BT1 D;  3MGP A;  1F1E A;  2LY8 A;  3B6G B;  4J8W D;  3AZM B;  3AYW B;  5B31 A;  1U35 D;  3KXB D;  5AY8 C;  3REJ C;  1ID3 D;  3AZJ C;  1M1A B;  5B32 B;  3LZ0 B;  3X1S A;  3B6G A;  3VH5 T;  3AZJ A;  1WWS A;  4KGC D;  1ZLA A;  1HTA A;  4J8V D;  3AZI A;  4KUD D;  2PYO A;  3V9R B;  5BS7 A;  3X1S B;  5JRG B;  5DNM A;  5B32 D;  4YS3 D;  3LZ0 D;  3UTA C;  1EQZ D;  4WU9 D;  3AV1 D;  4KUD A;  3KWQ B;  5CPK D;  4R8P A;  4XZQ C;  1HQ3 B;  3WA9 A;  5B0Z C;  5B33 D;  5KDM A;  3REL D;  1KX4 C;  3REI A;  3KUY C;  5B2I D;  1P3K C;  5B31 G;  3AZM C;  5GT3 C;  5GT3 B;  5E5A A;  3B0D B;  3REI D;  5AVC B;  5AV5 C;  1F66 D;  4WU8 A;  2CV5 A;  3X1U A;  5GXQ C;  5GT0 A;  3MGQ D;  3AZK A;  1P3B A;  5KDM B;  5BO0 B;  4ZUX D;  5B24 A;  1P3K D;  1P3O D;  3AZG A;  3MGR B;  2F8N H;  1BH9 B;  3AZK B;  3AZN A;  3MGQ B;  3NQJ A;  3AZN D;  5CPI C;  5AV6 C;  5B1L C;  4WU9 C;  1R4V A;  2CWE A;  3UTA D;  3KXB B;  2YFV B;  3LJA C;  5CP6 C;  4J8V C;  3MVD C;  3AZH A;  1BH9 A;  4JJN B;  3WA9 B;  3VH6 A;  1P3G A;  3X1S D;  5JA4 A;  4R8P B;  2YFW B;  2BYM B;  1F66 A;  1S32 D;  5B0Z A;  1P3I D;  3A6N A;  2NQB C;  4YM6 A;  4H9Q A;  5B0Y C;  4HGA B;  3AV2 A;  1P3I A;  1TZY D;  5AV6 D;  4EO5 B;  3KXB C;  3MGP B;  3AV1 B;  4AWL B;  3KUY A;  5G49 A;  5AV9 A;  1BH8 B;  2NZD C;  5B2I B;  1P3M B;  5BT1 C;  3MNN D;  3LZ1 D;  2ARO A;  5B33 B;  3MNN A;  2RVQ C;  5GXQ D;  4CAY B;  3MGQ C;  3AZI D;  1TAF B;  2F8N G;  4H9S C;  4CAY A;  3AZE C;  2FJ7 B;  5B31 B;  3O62 D;  3WAA B;  3B6G D;  3UTB C;  3LEL D;  3X1T C;  1U35 B;  3AZI B;  2JSS A;  3AZK D;  3B0D C;  3REL C;  2IO5 C;  1U35 A;  4H9R A;  5B0Z D;  3C1C C;  5B31 D;  2ARO C;  3W99 D;  5CPK C;  3AFA C;  4HGA C;  3B6F D;  4J8X C;  5E5A D;  5B2J B;  1P3A B;  1KX5 C;  4Z2M H;  2F8N B;  5B0Z B;  4Z5T D;  1BFM A;  3REK D;  3AN2 D;  5B33 A;  3WA9 D;  3W97 D;  3MGP C;  4JJN C;  3UTA B;  4NFT A;  3AZH B;  1ZLA D;  1JFI B;  5B0Y A;  3R45 A;  3REH C;  3AV1 A;  1P3F D;  1B67 A;  5B40 D;  5DNN D;  5B2J C;  3W96 D;  4H9N A;  3AFA B;  1P3I B;  4XUJ C;  4ZUX A;  3AZF C;  1ID3 C;  5CPJ B;  1P3L A;  5AY8 D;  5GT0 D;  3MGQ A;  1M19 A;  1M1A A;  1P3M D;  3AZL A;  2HIO B;  1P3P B;  1AOI D;  4J8X A;  3A6N C;  3C1B D;  4J8U B;  4WU9 B;  1P3B B;  3W98 B;  5AV5 B;  5CPI B;  5AV8 C;  4ZBJ B;  4Z66 B;  3WAA C;  5AVB D;  3REL A;  3KXB A;  3WKJ D;  3X1T A;  1KX4 B;  4G92 B;  4UUZ B;  3MGS D;  5DNN A;  2NQB A;  3MGR D;  3WAA A;  4YM6 B;  3AV2 B;  5GSU C;  4WU9 A;  1WWI A;  5AVB C;  3O62 B;  3WAA D;  3TU4 B;  5AV8 D;  3KWQ C;  4J8V A;  4ZBJ C;  5F99 A;  4Z66 C;  1TZY A;  4LD9 D;  4EO5 C;  4X23 A;  1AOI C;  4YM6 D;  3AV2 D;  4WNN B;  5AV9 B;  3KUY B;  4X23 C;  1AOI A;  5AVC A;  3UT9 A;  1M1A C;  4CSR B;  3REH D;  3NQU A;  1TZY B;  5DNM C;  1HQ3 A;  4XUJ B;  3AZF B;  1H3O B;  3LJA B;  5B1M D;  3AZL B;  1A7W A;  3MGP D;  2HUE C;  5BO0 A;  4H9N B;  3AFA A;  4X23 D;  5E5A C;  5DNN B;  5AV8 A;  3W96 B;  3AFA D;  4H9R B;  2ARO D;  5BNX B;  3LZ1 A;  4LD9 C;  3REJ A;  4Z66 D;  3C1C D;  5CPK B;  1KX5 B;  3W99 A;  3W98 A;  3B6F A;  4DRA A;  3X1T D;  4H9P B;  3LEL C;  5GSU D;  4G92 C;  3TU4 A;  3B6G C;  5AVB A;  5B24 C;  3B0C W;  3UTB B;  3MGS C;  3LEL A;  5C3I B;  1P3K B;  3AZI C;  3X1U B;  4H9O B;  3WKJ C;  2RVQ D;  3W98 C;  5JRG A;  4WU8 C;  1KX5 A;  3W99 B;  1P3M A;  1KX3 B;  2BYK A;  4XZQ B;  3LZ1 C;  5GT3 A;  5G49 B;  4LD9 A;  1KX3 A;  1P3O B;  3W96 A;  1M18 B;  5B32 A;  3LZ0 A;  3W97 B;  1P3M C;  3X1V B;  2FJ7 A;  5JRG C;  2HIO A;  1P3P A;  3W96 C;  5B0Y D;  3REH B;  3MGS A;  5AV9 D;  2NQB D;  1P3F B;  4XUJ A;  4E44 A;  3AZF A;  4WV4 B;  1S32 C;  1B6W A;  1M18 A;  3V9R A;  2PYO C;  1P3A C;  1ZLA C;  2YFV A;  3MVD D;  4JJN D;  3W97 C; 
#chains in the Genus database with same CATH topology
 3LJA D;  1HQ3 D;  4Z5T C;  1P3G D;  4H9Q B;  5B1L D;  4DRB A;  5CPI D;  1ULY A;  3AZN C;  1KX3 C;  3B6F C;  3W99 C;  4J8V B;  3WKJ B;  2JE5 A;  5AVC D;  4H9P A;  5B31 C;  3AYW A;  4QLC B;  3AZK C;  5GT0 B;  3UT9 B;  3AZE A;  1P3O C;  2CV5 B;  2CV5 C;  3UTB D;  1BH8 A;  2VQR A;  2HIO D;  1P3P D;  2BYK B;  3TU4 C;  3IP4 C;  5GSU B;  3REK A;  3AN2 A;  4YS3 A;  1P3B D;  5AV5 D;  1F66 C;  2DF4 C;  1P3K A;  1P34 D;  3REI C;  2CV5 D;  5GT3 D;  4QLC A;  3MGR A;  5B1L A;  5B2I C;  3X1U D;  2Y2M A;  3KUY D;  1KX4 D;  3MNN C;  4AWL C;  1H3O A;  3LJA A;  3AYW D;  5B24 B;  2NZD D;  4XZQ D;  5AVC C;  3NQU B;  1P34 B;  3AL0 C;  4ZUX B;  5B2I A;  2NZD A;  1ID3 A;  2NQB B;  5BNX A;  2PYO B;  3VH5 W;  1TZY C;  1P3G C;  4J8W A;  3AZL D;  1HQ3 C;  4YS3 C;  5FUG B;  3AZH D;  1S32 B;  1EQZ C;  1ZLA B;  1P3I C;  1ID3 B;  3R45 B;  3MVD A;  4KUD C;  5AV5 A;  1KU5 A;  2F8N K;  3X1S C;  4KGC C;  2HUE B;  3UTA A;  5F99 B;  2PYO D;  5B40 B;  5JA4 B;  3WTP E;  2DQN C;  5CP6 D;  5B1L B;  4NE3 A;  3AZH C;  1P3L B;  3AZL C;  1M19 B;  3AZJ D;  5CP6 A;  3AZM A;  5DNM B;  5JRG D;  4YS3 B;  4UUZ A;  1P3O A;  4Z5T A;  5GXQ B;  5BNV B;  3A1K A;  4XZQ A;  4WNN A;  4M6B A;  3AYW C;  5BS7 C;  2ZM5 A;  1JFI A;  4X23 B;  3X1U C;  2ZY2 A;  4ZUX C;  4WU8 D;  3EG5 B;  3MGS B;  3W98 D;  1P34 C;  1TAF A;  1P3B C;  3MNN B;  5CPJ A;  1M18 D;  3TU4 D;  2HIO C;  5CHL B;  1P3P C;  2ZY3 A;  3AZM D;  5CPK A;  4KHA A;  5B33 C;  2FJ7 D;  3C1C A;  1P3L C;  1M19 C;  4Z2M G;  5AV8 B;  3AZG D;  1KX3 D;  3UTB A;  3WKJ A;  4NE6 A;  3REH A;  4G91 B;  3AV1 C;  2F8N A;  2Y2L A;  5B32 C;  3LZ0 C;  4KUD B;  3VH6 W;  5CPJ C;  4JJN A;  5B1M A;  4CSR A;  1P3A D;  1Q9C A;  3REJ B;  5AY8 B;  5BNV A;  4Z5T B;  3AZJ B;  5AY8 A;  1M1A D;  2L5A A;  5F99 D;  1AOI B;  5B1M B;  5AV9 C;  4WZS B;  5CP6 B;  4QLC D;  3REJ D;  1P3F A;  1P34 A;  4KGC B;  1U35 C;  3WTP B;  3B0B A;  4J8W C;  4YM6 C;  3AV2 C;  1EQZ A;  3X1V C;  2ARO B;  3KWQ D;  3C1C B;  4H9S A;  4NE5 A;  3LZ1 B;  4KHA B;  3C1B A;  3EPK A;  3UT9 C;  3X1T B;  3NQJ B;  4H9O A;  4E45 A;  3REL B;  5B24 D;  2NZD B;  3UT9 D;  5C3I C;  5CPI A;  3H0M C;  4WJ3 C;  3A6N B;  4J8U C;  2FFF B;  2BYM A;  2YFW A;  1F66 B;  3C1B C;  5B40 A;  3AZG B;  3WTP A;  3X1V D;  3B6F B;  3KWQ A;  3VH6 T;  2F8N D;  5GSU A;  3REK B;  3AN2 B;  5GT0 C;  5GXQ A;  5B32 G;  4J8W B;  4QLC C;  4XUJ D;  3AZF D;  3WTP C;  4R8P D;  5E5A B;  5DNN C;  5B2J D;  5B40 C;  5F99 C;  4Z66 A;  1P3F C;  2Y2P A;  5B0Y B;  5B1M C;  3AZN B;  4J8U A;  5DNM D;  5AV6 B;  1N1J A;  4J8X B;  1EQZ B;  1P3G B;  1N1J B;  5AV6 A;  3WA9 C;  5CPJ D;  4KGC A;  1P3A A;  3REK C;  3AN2 C;  4R8P C;  3MVD B;  3WTP D;  3X1V A;  2IO5 B;  1KX5 D;  1S32 A;  5FUG A;  4J8X D;  1KX4 A;  3VH5 A;  3C1B B;  3AZG C;  1PZR A;  1P3L D;  1M19 D;  3AZE B;  2FJ7 C;  4G91 C;  3REI B;  4J8U D;  3LEL B;  1M18 C;  3O62 A;  5AVB B;  3O62 C;  3MGR C;  3AZE D;  5B2J A;  3W97 A;  3KSY A;  4WU8 B;  3B0C T;  4LD9 B;  2Y2Q A;  5BT1 D;  3A6N D;  3MGP A;  1F1E A;  2LY8 A;  3B6G B;  4J8W D;  3AZM B;  3AYW B;  5B31 A;  1U35 D;  3KXB D;  5AY8 C;  3REJ C;  3EPH A;  1ID3 D;  3AZJ C;  1M1A B;  5B32 B;  3LZ0 B;  3X1S A;  3B6G A;  3VH5 T;  2ZY4 A;  3AZJ A;  1WWS A;  4KGC D;  1ZLA A;  1HTA A;  4J8V D;  3AZI A;  4KUD D;  2PYO A;  3V9R B;  5BS7 A;  3X1S B;  5JRG B;  5DNM A;  5B32 D;  4YS3 D;  3LZ0 D;  3EPJ A;  3UTA C;  2G5H C;  1EQZ D;  4WU9 D;  3AV1 D;  4KUD A;  3KWQ B;  5CPK D;  4R8P A;  3A1I A;  4XZQ C;  1HQ3 B;  3WA9 A;  5B0Z C;  5B33 D;  5KDM A;  3REL D;  1KX4 C;  3REI A;  3KUY C;  5B2I D;  1P3K C;  5B31 G;  3AZM C;  5GT3 C;  5GT3 B;  5E5A A;  3B0D B;  3REI D;  5AVC B;  5AV5 C;  1F66 D;  4WU8 A;  2JCH A;  2CV5 A;  3X1U A;  5GXQ C;  5GT0 A;  3MGQ D;  3AZK A;  1P3B A;  5KDM B;  5BO0 B;  4ZUX D;  5B24 A;  1P3K D;  1P3O D;  3FDD A;  3AZG A;  3MGR B;  2F8N H;  1BH9 B;  3AZK B;  3AZN A;  3MGQ B;  3NQJ A;  3AZN D;  5CPI C;  5AV6 C;  5B1L C;  4WU9 C;  1R4V A;  2CWE A;  3UTA D;  3KXB B;  2YFV B;  3LJA C;  5CP6 C;  4UPK A;  4J8V C;  3MVD C;  3AZH A;  1BH9 A;  4JJN B;  3WA9 B;  3VH6 A;  1P3G A;  3X1S D;  2W8S A;  5JA4 A;  2YFW B;  2BYM B;  4R8P B;  1F66 A;  1S32 D;  5B0Z A;  1P3I D;  3A6N A;  2NQB C;  4YM6 A;  4H9Q A;  5B0Y C;  4HGA B;  3AV2 A;  1P3I A;  1TZY D;  2Y2I A;  3KFU G;  5AV6 D;  4EO5 B;  3KXB C;  3MGP B;  3AV1 B;  4AWL B;  3KUY A;  5G49 A;  5AV9 A;  1BH8 B;  2NZD C;  5B2I B;  1P3M B;  5BT1 C;  3MNN D;  3LZ1 D;  2XD1 A;  2ARO A;  5B33 B;  3MNN A;  2RVQ C;  5GXQ D;  4CAY B;  3MGQ C;  3AZI D;  1TAF B;  2F8N G;  4H9S C;  4CAY A;  3AZE C;  2FJ7 B;  2Y2N A;  5B31 B;  3O62 D;  3WAA B;  3B6G D;  3F6T A;  3UTB C;  3LEL D;  3X1T C;  1U35 B;  3AZI B;  2JSS A;  3AZK D;  3B0D C;  3REL C;  2IO5 C;  1U35 A;  4H9R A;  5B0Z D;  3C1C C;  5B31 D;  2ARO C;  3W99 D;  5CPK C;  3AFA C;  4HGA C;  3B6F D;  4J8X C;  5E5A D;  5B2J B;  1P3A B;  1KX5 C;  4Z2M H;  2F8N B;  5B0Z B;  4Z5T D;  1BFM A;  3REK D;  3AN2 D;  5B33 A;  3WA9 D;  3W97 D;  3MGP C;  4JJN C;  3UTA B;  4NFT A;  3AZH B;  1ZLA D;  1JFI B;  5B0Y A;  2Y2G A;  3R45 A;  3H0L C;  3REH C;  3AV1 A;  1P3F D;  1B67 A;  3P5J B;  5B40 D;  5DNN D;  5B2J C;  3W96 D;  4H9N A;  3AFA B;  1P3I B;  4XUJ C;  4ZUX A;  3AZF C;  1ID3 C;  5CPJ B;  1P3L A;  5AY8 D;  5GT0 D;  3MGQ A;  1M19 A;  1Z2C B;  2Y2K A;  1M1A A;  1P3M D;  3AZL A;  2HIO B;  4DQY B;  1P3P B;  2Y2H A;  4J8X A;  1AOI D;  3A6N C;  3C1B D;  4J8U B;  2Y2J A;  4WU9 B;  1P3B B;  5AV5 B;  3W98 B;  5CPI B;  5AV8 C;  3EPL A;  4ZBJ B;  4Z66 B;  3WAA C;  5AVB D;  3REL A;  3KXB A;  3WKJ D;  1W2E A;  3X1T A;  2RIQ A;  1KX4 B;  4G92 B;  4UUZ B;  3MGS D;  5DNN A;  2NQB A;  3MGR D;  3WAA A;  4YM6 B;  3AV2 B;  5GSU C;  4WU9 A;  1WWI A;  5AVB C;  3O62 B;  3WAA D;  3TU4 B;  5AV8 D;  3KWQ C;  4J8V A;  4ZBJ C;  5F99 A;  4Z66 C;  1TZY A;  4LD9 D;  4EO5 C;  4X23 A;  1AOI C;  4YM6 D;  3AV2 D;  4WNN B;  5AV9 B;  3KUY B;  4X23 C;  1AOI A;  5AVC A;  3UT9 A;  1M1A C;  4CSR B;  3REH D;  3NQU A;  1TZY B;  5DNM C;  1HQ3 A;  4XUJ B;  3AZF B;  1H3O B;  3LJA B;  5B1M D;  2J8P A;  2UWX A;  2XD5 A;  3AZL B;  1A7W A;  3MGP D;  2HUE C;  5BO0 A;  4H9N B;  3AFA A;  4X23 D;  5E5A C;  5DNN B;  5AV8 A;  3W96 B;  3AFA D;  4H9R B;  3H0R C;  2F2A C;  2ARO D;  5BNX B;  3LZ1 A;  4LD9 C;  3REJ A;  4Z66 D;  3C1C D;  5CPK B;  1KX5 B;  3W99 A;  3W98 A;  3B6F A;  4DRA A;  3X1T D;  4H9P B;  1T3U A;  3LEL C;  5GSU D;  4G92 C;  3TU4 A;  3B6G C;  5AVB A;  5B24 C;  2Y2O A;  2ZY5 A;  3B0C W;  3UTB B;  3MGS C;  3LEL A;  5C3I B;  1P3K B;  3AZI C;  3X1U B;  4H9O B;  3WKJ C;  2RVQ D;  3W98 C;  5JRG A;  4WU8 C;  1KX5 A;  3W99 B;  1P3M A;  1KX3 B;  2BYK A;  4XZQ B;  3LZ1 C;  5GT3 A;  5G49 B;  4LD9 A;  1KX3 A;  1P3O B;  2BG1 A;  3W96 A;  1M18 B;  5B32 A;  3LZ0 A;  3W97 B;  1P3M C;  3X1V B;  2FJ7 A;  5JRG C;  2HIO A;  1P3P A;  2G5I C;  3W96 C;  5B0Y D;  3REH B;  3MGS A;  5AV9 D;  2NQB D;  1P3F B;  4XUJ A;  4E44 A;  3AZF A;  4WV4 B;  1S32 C;  1B6W A;  1M18 A;  3V9R A;  2PYO C;  1P3A C;  1ZLA C;  2YFV A;  3MVD D;  4JJN D;  3W97 C; 
#chains in the Genus database with same CATH homology
 3LJA D;  1HQ3 D;  4Z5T C;  1P3G D;  4H9Q B;  5B1L D;  4DRB A;  5CPI D;  1ULY A;  3AZN C;  1KX3 C;  3B6F C;  3W99 C;  4J8V B;  3WKJ B;  2JE5 A;  5AVC D;  4H9P A;  5B31 C;  3AYW A;  4QLC B;  3AZK C;  5GT0 B;  3UT9 B;  3AZE A;  1P3O C;  2CV5 B;  2CV5 C;  3UTB D;  1BH8 A;  2VQR A;  2HIO D;  1P3P D;  2BYK B;  3TU4 C;  3IP4 C;  5GSU B;  3REK A;  3AN2 A;  4YS3 A;  1P3B D;  5AV5 D;  1F66 C;  2DF4 C;  1P3K A;  1P34 D;  3REI C;  2CV5 D;  5GT3 D;  4QLC A;  3MGR A;  5B1L A;  5B2I C;  3X1U D;  2Y2M A;  3KUY D;  1KX4 D;  3MNN C;  4AWL C;  1H3O A;  3LJA A;  3AYW D;  5B24 B;  2NZD D;  4XZQ D;  5AVC C;  3NQU B;  1P34 B;  3AL0 C;  4ZUX B;  5B2I A;  2NZD A;  1ID3 A;  2NQB B;  5BNX A;  2PYO B;  3VH5 W;  1TZY C;  1P3G C;  4J8W A;  3AZL D;  1HQ3 C;  4YS3 C;  5FUG B;  3AZH D;  1S32 B;  1EQZ C;  1ZLA B;  1P3I C;  1ID3 B;  3R45 B;  3MVD A;  4KUD C;  5AV5 A;  1KU5 A;  2F8N K;  3X1S C;  4KGC C;  2HUE B;  3UTA A;  5F99 B;  2PYO D;  5B40 B;  5JA4 B;  3WTP E;  2DQN C;  5CP6 D;  5B1L B;  4NE3 A;  3AZH C;  1P3L B;  3AZL C;  1M19 B;  3AZJ D;  5CP6 A;  3AZM A;  5DNM B;  5JRG D;  4YS3 B;  4UUZ A;  1P3O A;  4Z5T A;  5GXQ B;  5BNV B;  3A1K A;  4XZQ A;  4WNN A;  4M6B A;  3AYW C;  5BS7 C;  2ZM5 A;  1JFI A;  4X23 B;  3X1U C;  2ZY2 A;  4ZUX C;  4WU8 D;  3EG5 B;  3MGS B;  3W98 D;  1P34 C;  1TAF A;  1P3B C;  3MNN B;  5CPJ A;  1M18 D;  3TU4 D;  2HIO C;  5CHL B;  1P3P C;  2ZY3 A;  3AZM D;  5CPK A;  4KHA A;  5B33 C;  2FJ7 D;  3C1C A;  1P3L C;  1M19 C;  4Z2M G;  5AV8 B;  3AZG D;  1KX3 D;  3UTB A;  3WKJ A;  4NE6 A;  3REH A;  4G91 B;  3AV1 C;  2F8N A;  2Y2L A;  5B32 C;  3LZ0 C;  4KUD B;  3VH6 W;  5CPJ C;  4JJN A;  5B1M A;  4CSR A;  1P3A D;  1Q9C A;  3REJ B;  5AY8 B;  5BNV A;  4Z5T B;  3AZJ B;  5AY8 A;  1M1A D;  2L5A A;  5F99 D;  1AOI B;  5B1M B;  5AV9 C;  4WZS B;  5CP6 B;  4QLC D;  3REJ D;  1P3F A;  1P34 A;  4KGC B;  1U35 C;  3WTP B;  3B0B A;  4J8W C;  4YM6 C;  3AV2 C;  1EQZ A;  3X1V C;  2ARO B;  3KWQ D;  3C1C B;  4H9S A;  4NE5 A;  3LZ1 B;  4KHA B;  3C1B A;  3EPK A;  3UT9 C;  3X1T B;  3NQJ B;  4H9O A;  4E45 A;  3REL B;  5B24 D;  2NZD B;  3UT9 D;  5C3I C;  5CPI A;  3H0M C;  4WJ3 C;  3A6N B;  4J8U C;  2FFF B;  2BYM A;  2YFW A;  1F66 B;  3C1B C;  5B40 A;  3AZG B;  3WTP A;  3X1V D;  3B6F B;  3KWQ A;  3VH6 T;  2F8N D;  5GSU A;  3REK B;  3AN2 B;  5GT0 C;  5GXQ A;  5B32 G;  4J8W B;  4QLC C;  4XUJ D;  3AZF D;  3WTP C;  4R8P D;  5E5A B;  5DNN C;  5B2J D;  5B40 C;  5F99 C;  4Z66 A;  1P3F C;  2Y2P A;  5B0Y B;  5B1M C;  3AZN B;  4J8U A;  5DNM D;  5AV6 B;  1N1J A;  4J8X B;  1EQZ B;  1P3G B;  1N1J B;  5AV6 A;  3WA9 C;  5CPJ D;  4KGC A;  1P3A A;  3REK C;  3AN2 C;  4R8P C;  3MVD B;  3WTP D;  3X1V A;  2IO5 B;  1KX5 D;  1S32 A;  5FUG A;  4J8X D;  1KX4 A;  3VH5 A;  3C1B B;  3AZG C;  1PZR A;  1P3L D;  1M19 D;  3AZE B;  2FJ7 C;  4G91 C;  3REI B;  4J8U D;  3LEL B;  1M18 C;  3O62 A;  5AVB B;  3O62 C;  3MGR C;  3AZE D;  5B2J A;  3W97 A;  3KSY A;  4WU8 B;  3B0C T;  4LD9 B;  2Y2Q A;  5BT1 D;  3A6N D;  3MGP A;  1F1E A;  2LY8 A;  3B6G B;  4J8W D;  3AZM B;  3AYW B;  5B31 A;  1U35 D;  3KXB D;  5AY8 C;  3REJ C;  3EPH A;  1ID3 D;  3AZJ C;  1M1A B;  5B32 B;  3LZ0 B;  3X1S A;  3B6G A;  3VH5 T;  2ZY4 A;  3AZJ A;  1WWS A;  4KGC D;  1ZLA A;  1HTA A;  4J8V D;  3AZI A;  4KUD D;  2PYO A;  3V9R B;  5BS7 A;  3X1S B;  5JRG B;  5DNM A;  5B32 D;  4YS3 D;  3LZ0 D;  3EPJ A;  3UTA C;  2G5H C;  1EQZ D;  4WU9 D;  3AV1 D;  4KUD A;  3KWQ B;  5CPK D;  4R8P A;  3A1I A;  4XZQ C;  1HQ3 B;  3WA9 A;  5B0Z C;  5B33 D;  5KDM A;  3REL D;  1KX4 C;  3REI A;  3KUY C;  5B2I D;  1P3K C;  5B31 G;  3AZM C;  5GT3 C;  5GT3 B;  5E5A A;  3B0D B;  3REI D;  5AVC B;  5AV5 C;  1F66 D;  4WU8 A;  2JCH A;  2CV5 A;  3X1U A;  5GXQ C;  5GT0 A;  3MGQ D;  3AZK A;  1P3B A;  5KDM B;  5BO0 B;  4ZUX D;  5B24 A;  1P3K D;  1P3O D;  3FDD A;  3AZG A;  3MGR B;  2F8N H;  1BH9 B;  3AZK B;  3AZN A;  3MGQ B;  3NQJ A;  3AZN D;  5CPI C;  5AV6 C;  5B1L C;  4WU9 C;  1R4V A;  2CWE A;  3UTA D;  3KXB B;  2YFV B;  3LJA C;  5CP6 C;  4UPK A;  4J8V C;  3MVD C;  3AZH A;  1BH9 A;  4JJN B;  3WA9 B;  3VH6 A;  1P3G A;  3X1S D;  2W8S A;  5JA4 A;  2YFW B;  2BYM B;  4R8P B;  1F66 A;  1S32 D;  5B0Z A;  1P3I D;  3A6N A;  2NQB C;  4YM6 A;  4H9Q A;  5B0Y C;  4HGA B;  3AV2 A;  1P3I A;  1TZY D;  2Y2I A;  3KFU G;  5AV6 D;  4EO5 B;  3KXB C;  3MGP B;  3AV1 B;  4AWL B;  3KUY A;  5G49 A;  5AV9 A;  1BH8 B;  2NZD C;  5B2I B;  1P3M B;  5BT1 C;  3MNN D;  3LZ1 D;  2XD1 A;  2ARO A;  5B33 B;  3MNN A;  2RVQ C;  5GXQ D;  4CAY B;  3MGQ C;  3AZI D;  1TAF B;  2F8N G;  4H9S C;  4CAY A;  3AZE C;  2FJ7 B;  2Y2N A;  5B31 B;  3O62 D;  3WAA B;  3B6G D;  3F6T A;  3UTB C;  3LEL D;  3X1T C;  1U35 B;  3AZI B;  2JSS A;  3AZK D;  3B0D C;  3REL C;  2IO5 C;  1U35 A;  4H9R A;  5B0Z D;  3C1C C;  5B31 D;  2ARO C;  3W99 D;  5CPK C;  3AFA C;  4HGA C;  3B6F D;  4J8X C;  5E5A D;  5B2J B;  1P3A B;  1KX5 C;  4Z2M H;  2F8N B;  5B0Z B;  4Z5T D;  1BFM A;  3REK D;  3AN2 D;  5B33 A;  3WA9 D;  3W97 D;  3MGP C;  4JJN C;  3UTA B;  4NFT A;  3AZH B;  1ZLA D;  1JFI B;  5B0Y A;  2Y2G A;  3R45 A;  3H0L C;  3REH C;  3AV1 A;  1P3F D;  1B67 A;  3P5J B;  5B40 D;  5DNN D;  5B2J C;  3W96 D;  4H9N A;  3AFA B;  1P3I B;  4XUJ C;  4ZUX A;  3AZF C;  1ID3 C;  5CPJ B;  1P3L A;  5AY8 D;  5GT0 D;  3MGQ A;  1M19 A;  1Z2C B;  2Y2K A;  1M1A A;  1P3M D;  3AZL A;  2HIO B;  4DQY B;  1P3P B;  2Y2H A;  4J8X A;  1AOI D;  3A6N C;  3C1B D;  4J8U B;  2Y2J A;  4WU9 B;  1P3B B;  5AV5 B;  3W98 B;  5CPI B;  5AV8 C;  3EPL A;  4ZBJ B;  4Z66 B;  3WAA C;  5AVB D;  3REL A;  3KXB A;  3WKJ D;  1W2E A;  3X1T A;  2RIQ A;  1KX4 B;  4G92 B;  4UUZ B;  3MGS D;  5DNN A;  2NQB A;  3MGR D;  3WAA A;  4YM6 B;  3AV2 B;  5GSU C;  4WU9 A;  1WWI A;  5AVB C;  3O62 B;  3WAA D;  3TU4 B;  5AV8 D;  3KWQ C;  4J8V A;  4ZBJ C;  5F99 A;  4Z66 C;  1TZY A;  4LD9 D;  4EO5 C;  4X23 A;  1AOI C;  4YM6 D;  3AV2 D;  4WNN B;  5AV9 B;  3KUY B;  4X23 C;  1AOI A;  5AVC A;  3UT9 A;  1M1A C;  4CSR B;  3REH D;  3NQU A;  1TZY B;  5DNM C;  1HQ3 A;  4XUJ B;  3AZF B;  1H3O B;  3LJA B;  5B1M D;  2J8P A;  2UWX A;  2XD5 A;  3AZL B;  1A7W A;  3MGP D;  2HUE C;  5BO0 A;  4H9N B;  3AFA A;  4X23 D;  5E5A C;  5DNN B;  5AV8 A;  3W96 B;  3AFA D;  4H9R B;  3H0R C;  2F2A C;  2ARO D;  5BNX B;  3LZ1 A;  4LD9 C;  3REJ A;  4Z66 D;  3C1C D;  5CPK B;  1KX5 B;  3W99 A;  3W98 A;  3B6F A;  4DRA A;  3X1T D;  4H9P B;  1T3U A;  3LEL C;  5GSU D;  4G92 C;  3TU4 A;  3B6G C;  5AVB A;  5B24 C;  2Y2O A;  2ZY5 A;  3B0C W;  3UTB B;  3MGS C;  3LEL A;  5C3I B;  1P3K B;  3AZI C;  3X1U B;  4H9O B;  3WKJ C;  2RVQ D;  3W98 C;  5JRG A;  4WU8 C;  1KX5 A;  3W99 B;  1P3M A;  1KX3 B;  2BYK A;  4XZQ B;  3LZ1 C;  5GT3 A;  5G49 B;  4LD9 A;  1KX3 A;  1P3O B;  2BG1 A;  3W96 A;  1M18 B;  5B32 A;  3LZ0 A;  3W97 B;  1P3M C;  3X1V B;  2FJ7 A;  5JRG C;  2HIO A;  1P3P A;  2G5I C;  3W96 C;  5B0Y D;  3REH B;  3MGS A;  5AV9 D;  2NQB D;  1P3F B;  4XUJ A;  4E44 A;  3AZF A;  4WV4 B;  1S32 C;  1B6W A;  1M18 A;  3V9R A;  2PYO C;  1P3A C;  1ZLA C;  2YFV A;  3MVD D;  4JJN D;  3W97 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...