1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
2CV5C 5B33B 1P3MD 3AV2B 3AZGB 3MGRD 4XZQC 1P3MC 5GSUB 4J8UB 4LD9A 4EO5C 1P3KC 3LZ1C 4H9OB 5AV5D 5GT3D 4X23D 4WU9C 2HUEC 5AV5C 1S32C 4AWLC 4X23C 1KX5D 4J8VA 5JRGA 4JJNB 3X1TA 1AOIB 3AZHB 3WA9D 4H9NA 3WKJA 3X1SB 4HGAC 3REJA 3C1BB 3RELB 4NFTA 3MGSC 3V9RA 3AZMB 5CPJC 1KX3B 1A7WA 4DRBA 1ULYA 3MGPA 5F99A 5B24D 3UTAA 5B40A 4R8PD 3W97B 5B32D 3AZND 4R8PC 3WTPC 4ZBJC 4QLCB 4KUDA 2YFVA 5CPIA 2BYKA 2NQBC 5B32G 3TU4A 1ZLAC 2HIOC 3AZJD 5KDMB 1U35D 4NE3A 3AFAC 4H9RA 3AZFC 3AYWC 1R4VA 3X1VA 4ZUXA 3LJAC 5AV6D 5B0YA 3X1TB 4KGCC 1HQ3B 3KUYA 5AV6C 5B2JA 4H9NB 3WKJB 5GXQD 3REJB 1P3IC 4Z5TA 2F8NH 3B6FD 4YS3B 3MGQA 1F66D 3V9RB 3REIA 3B6FC 1M19D 1F66C 3AZID 5CPKD 5DNMB 4UUZA 5F99B 1B6WA 3UTAB 5JRGD 1M18A 2JSSA 1BH8A 2IO5C 5E5AC 5DNNC 4WNNB 4KUDB 1KU5A 3MVDC 5B1MC 4CAYB 2BYKB 3A6ND 3O62B 4J8WC 3TU4B 1P3MA 3A6NC 4H9QA 3MGRA 1WWIA 4H9PA 3W98D 3W98C 4ZUXB 3REHB 5B0YB 1P3PC 2PYOB 1BH9A 3KXBB 5G49A 5AV5A 1S32A 5GT3A 4X23A 1KX5A 3W99C 1M1AD 2RVQC 3MGQB 4Z66C 3REIB 5AV8D 3LELB 2FJ7D 3WA9A 3X1UB 5AV8C 3VH6A 3WTPE 1KX4D 5AY8D 5BS7A 3KWQD 3X1VD 1KX4C 4WV4B 5AY8C 3REKD 1M18B 3UTBD 3AZEB 3B0CT 4Z5TD 4R8PA 4H9QB 5B32A 3MGRB 3AZNA 1ID3D 1WWSA 5B0ZD 5C3IC 3MNNC 4CSRA 1ID3C 4M6BA 1ZLAA 3O62C 5AV9D 1BH9B 3AZJA 5GT0D 5G49B 1U35A 4WU8C 5GT3B 5AV9C 3C1CC 1P3FD 5GT0C 3UT9B 3B0DB 1KX5B 5AVBC 3AN2B 2CV5D 4KGCA 4Z2MH 5AV6A 4J8XC 5FUGB 1P3LC 4XZQD 3WA9B 2F8NA 5GXQA 3B6GB 3AV1B 1P3KD 4XUJC 3B6FA 3LZ1D 5B31C 1F66A 1M19A 4WU9D 3AZIA 1S32D 5AVCC 5CPKA 3B0BA 1TZYC 5B24B 5DNNA 1P3BB 5B32B 3AZNB 4KHAA 3AZKC 5B2ID 2NZDC 4CSRB 5B2IC 1P3OC 3A6NA 5B1LC 3LZ0C 4YM6C 3AZJB 3MGSD 1U35B 1F1EA 5CPJD 3W96D 3R45B 4H9SA 3W98A 5CP6C 3W96C 5BNVA 2AROD 3WAAB 4G92B 1EQZC 3AZLC 2AROC 1P3GD 1P3AC 3WTPD 1P3GC 5GXQB 3W99A 3NQJA 4G91C 1P34C 1M1AA 2NQBD 1ZLAD 4LD9B 1N1JA 2HIOD 3AV2D 5AV8A 1M19B 4NE6A 3AFAD 5B33C 3AV2C 2FJ7A 3AYWD 3AZFD 3AZGC 3AZIB 4J8UD 1KX4A 5AY8A 3LJAD 5GSUC 5JRGB 3KWQA 4J8UC 4J8VB 4KGCD 5BNXA 3REKA 3UTBA 2F8ND 1P3ID 4JJND 1ID3A 5B0ZA 4JJNC 2F8NG 1AOIC 3X1SD 3AZHC 3X1SC 4E45A 5JA4A 5AV9A 3MGPB 3C1CA 5GT0A 3C1BC 3RELC 5E5AD 5DNND 5B40B 1P3FA 3AZMD 3MVDD 5B1MD 1KX3D 3AZMC 2CV5A 4J8WD 4WZSB 1M1AB 2YFVB 5CPIB 1KX3C 3W97D 4XZQA 2FJ7B 3W97C 4QLCD 4H9RB 1P3KA 4QLCC 3KWQB 3X1VB 1P3PD 3LZ1A 3REKB 5AVCA 3UTBB 3KUYB 4WU9A 5B2JB 3W99D 5BO0A 4Z5TB 2RVQD 4Z66D 3NQUA 1HQ3D 5B0ZB 5B2IA 3X1TC 2YFWA 1HQ3C 3WKJC 4UUZB 3MGSA 3REJC 4YS3D 1P3FB 5CPJA 3W96A 4YS3C 3VH5W 1BH8B 2CV5B 2AROA 1JFIA 5DNMD 1P3GA 5DNMC 4XZQB 1P3MB 5F99C 3UTAC 3WTPA 3MNND 4H9PB 4EO5B 1P3KB 4KUDC 2NQBA 3O62D 2HIOA 3LZ1B 3AV2A 3AZGA 3TU4C 4WU8D 3C1CD 3AFAA 4WU9B 2HUEB 3AYWA 3AZFA 5AV5B 1S32B 4AWLB 4X23B 5AVBD 4J8UA 5BO0B 2L5AA 3LJAA 4J8XD 2PYOD 3NQUB 4ZUXC 4H9OA 3KXBD 1P3LD 3REHC 5B0YC 2PYOC 2YFWB 4HGAB 3KXBC 1P3IA 4XUJD 3MGSB 5B31D 4JJNA 5CPJB 3LELD 3VH6W 3MGQC 3X1SA 5AVCD 3X1UD 3LELC 3REIC 1TZYD 5B31G 1JFIB 2F8NK 3X1UC 3RELA 5E5AA 4R8PB 3AZKD 2NZDD 3WTPB 3AZMA 4ZBJB 3MVDA 3AZED 5B1MA 1M18C 1P3OD 1KX3A 1BFMA 5B1LD 4J8WA 2NQBB 3AZEC 1ZLAB 3LZ0D 4YM6D 2HIOB 3W97A 3AFAB 3AYWB 3AZFB 5CP6D 4QLCA 2BYMA 3MGRC 1HTAA 3LJAB 1P3PA 1EQZD 3AZLD 4KGCB 4E44A 5AV6B 5KDMA 1P3AD 3KSYA 3UT9D 2F8NB 1P3IB 5GT3C 1P34D 3UT9C 3AN2D 3B0DC 1KX5C 4Z66A 3AN2C 3B6FB 1HQ3A 5B33D 1F66B 3AZGD 3B6GD 3AV1D 3WA9C 5CPKB 3B6GC 5GSUD 3AV1C 3B0CW 4YS3A 5E5AB 2IO5B 5DNNB 5BS7C 3MVDB 4KHAB 5B1MB 4J8WB 1H3OA 5DNMA 3A6NB 1P3BD 5B24C 3VH5T 3MNNA 1P3BC 4WNNA 5B32C 2BYMB 3AZNC 1AOID 3AZHD 4CAYA 3W98B 5BNVB 3O62A 1P3PB 3C1BD 3RELD 4WU8A 3AZJC 1B67A 1U35C 5AVBA 3W99B 3NQJB 3WAAD 4J8XA 3REHA 4Z66B 2PYOA 1N1JB 3WAAC 3KXBA 1P3LA 4NE5A 4G92C 5AV8B 2CWEA 4XUJA 5GXQC 1KX4B 5B31A 4LD9D 5AY8B 1TAFA 4LD9C 3LELA 5BNXB 3X1UA 3VH5A 1M19C 1TZYA 1H3OB 3AZIC 5CPKC 4J8VD 3AZKA 2NZDA 3X1TD 5C3IB 5JRGC 3VH6T 3MNNB 4J8VC 1ID3B 3AZEA 1P3OA 1Q9CA 5B1LA 3WKJD 3LZ0A 4YM6A 3REJD 2LY8A 4WU8B 5JA4B 5AV9B 3C1CB 5GT0B 5CP6A 5AVBB 4H9SC 1EQZA 4J8XB 3AZLA 3MGPD 1P3LB 5F99D 1P3AA 3UTAD 5B40D 3MGPC 5CHLB 3UT9A 5B40C 1P34A 4XUJB 4KUDD 3AN2A 5B31B 5CPID 1M1AC 5FUGA 5BT1D 3TU4D 1TAFB 5CPIC 5B33A 5BT1C 5AVCB 4DRAA 3B6GA 3AV1A 1TZYB 2FJ7C 5GSUA 4ZUXD 3AZKB 2NZDB 3REHD 5B0YD 3X1VC 3KWQC 3KUYD 3REKC 5B2IB 1P3OB 5B2JD 5B1LB 3UTBC 3KUYC 3LZ0B 4YM6B 4Z2MG 5B2JC 5B24A 1P3BA 4Z5TC 3MGQD 5CP6B 1AOIA 3REID 3W96B 5B0ZC 3AZHA 1EQZB 3AZLB 2AROB 3C1BA 1P3AB 1P3GB 3R45A 4G91B 1M18D 1P34B 1P3FC 3WAAA
chains in the Genus database with same CATH superfamily
2CV5C 5B33B 1P3MD 3AV2B 3AZGB 3MGRD 3F6TA 4XZQC 1P3MC 5GSUB 4J8UB 4LD9A 4EO5C 1P3KC 3LZ1C 4H9OB 5AV5D 2VQRA 5GT3D 4X23D 4WU9C 2HUEC 5AV5C 1S32C 4AWLC 4X23C 1KX5D 4J8VA 5JRGA 4JJNB 3X1TA 3FDDA 1AOIB 3AZHB 3WA9D 4H9NA 3WKJA 3X1SB 4HGAC 3REJA 2XD5A 3C1BB 3RELB 4NFTA 3MGSC 3V9RA 3AZMB 5CPJC 1KX3B 1A7WA 2Y2OA 2RIQA 4DRBA 1ULYA 3MGPA 5F99A 5B24D 3UTAA 5B40A 4R8PD 3W97B 5B32D 3AZND 4R8PC 3WTPC 4ZBJC 4QLCB 4KUDA 2YFVA 5CPIA 2BYKA 2NQBC 5B32G 3TU4A 1ZLAC 2HIOC 3AZJD 5KDMB 1U35D 4NE3A 3AFAC 4H9RA 3AZFC 3AYWC 1R4VA 3X1VA 2ZY3A 4ZUXA 3LJAC 5AV6D 5B0YA 3X1TB 4KGCC 1HQ3B 3KUYA 5AV6C 5B2JA 4H9NB 3WKJB 5GXQD 3REJB 1P3IC 4Z5TA 1M19B 2F8NH 2BG1A 3B6FD 4YS3B 3MGQA 1F66D 3V9RB 3REIA 3B6FC 1M19D 1F66C 2ZY4A 3EPHA 3AZID 5CPKD 5DNMB 4UUZA 5F99B 1B6WA 2G5IC 3UTAB 5JRGD 1Z2CB 1M18A 2JSSA 1BH8A 5DNNC 2IO5C 5E5AC 4WNNB 4KUDB 1KU5A 3MVDC 5B1MC 4CAYB 2BYKB 3A6ND 3O62B 4J8WC 3TU4B 1P3MA 3A6NC 4H9QA 3MGRA 1WWIA 4H9PA 3W98D 2Y2MA 3W98C 4ZUXB 3REHB 5B0YB 1P3PC 2PYOB 1BH9A 3KXBB 5G49A 5AV5A 1S32A 5GT3A 4X23A 1KX5A 3W99C 1M1AD 2RVQC 3MGQB 4Z66C 3REIB 5AV8D 3LELB 2FJ7D 3WA9A 3X1UB 5AV8C 3VH6A 3WTPE 1KX4D 5AY8D 5BS7A 3KWQD 3X1VD 1KX4C 4WV4B 5AY8C 3REKD 1M18B 3A1IA 3UTBD 3AZEB 3B0CT 4Z5TD 4R8PA 4H9QB 5B32A 3MGRB 3AZNA 1ID3D 1WWSA 5B0ZD 5C3IC 3MNNC 4CSRA 1ID3C 4M6BA 1ZLAA 3H0MC 3O62C 5AV9D 1BH9B 3AZJA 5GT0D 5G49B 1U35A 4WU8C 5GT3B 5AV9C 3C1CC 1P3FD 5GT0C 3UT9B 3B0DB 2G5HC 1KX5B 5AVBC 3AN2B 2CV5D 4KGCA 4Z2MH 5AV6A 4J8XC 2Y2GA 5FUGB 1P3LC 4XZQD 3WA9B 2F8NA 5GXQA 3B6GB 3AV1B 1P3KD 4XUJC 3B6FA 3LZ1D 5B31C 1F66A 1M19A 4WU9D 3AZIA 1S32D 5AVCC 5CPKA 3B0BA 1TZYC 5B24B 5DNNA 1P3BB 5B32B 3AZNB 2ZM5A 4KHAA 3AZKC 5B2ID 2NZDC 4CSRB 5B2IC 1P3OC 3A6NA 5B1LC 2Y2QA 3LZ0C 4YM6C 3AZJB 3MGSD 1U35B 1F1EA 5CPJD 3W96D 3R45B 4H9SA 3W98A 5CP6C 3W96C 2UWXA 5BNVA 2AROD 3WAAB 4G92B 3IP4C 1EQZC 3AZLC 2AROC 1P3GD 1P3AC 3WTPD 1P3GC 5GXQB 3W99A 3NQJA 4G91C 3H0LC 1P34C 1M1AA 2NQBD 1ZLAD 4LD9B 1N1JA 2HIOD 3AV2D 5AV8A 1W2EA 2W8SA 4NE6A 3AFAD 5B33C 3AV2C 3AYWD 3AZFD 3AZGC 3AZIB 2FJ7A 4J8UD 1KX4A 5AY8A 3LJAD 5GSUC 5JRGB 3KWQA 4J8UC 4J8VB 4KGCD 5BNXA 3REKA 3UTBA 2F8ND 1P3ID 2Y2NA 4JJND 1ID3A 5B0ZA 2Y2HA 4JJNC 2F8NG 2JE5A 1AOIC 3X1SD 3AZHC 3X1SC 4E45A 5JA4A 5AV9A 3MGPB 3C1CA 5GT0A 3C1BC 3RELC 5E5AD 5DNND 5B40B 1P3FA 3AZMD 3MVDD 4DQYB 5B1MD 1KX3D 3AZMC 2CV5A 4J8WD 4WZSB 1M1AB 2YFVB 5CPIB 1KX3C 3W97D 4XZQA 2FJ7B 3W97C 4QLCD 4H9RB 1P3KA 4QLCC 3KWQB 3X1VB 1P3PD 3LZ1A 3REKB 1PZRA 5AVCA 2Y2PA 3UTBB 3KUYB 4WU9A 2JCHA 5B2JB 3W99D 5BO0A 4Z5TB 2RVQD 4Z66D 3NQUA 1HQ3D 3EG5B 5B0ZB 5B2IA 3X1TC 2YFWA 1HQ3C 2Y2LA 3WKJC 4UUZB 3MGSA 3REJC 4YS3D 1P3FB 5CPJA 3W96A 4YS3C 3VH5W 1BH8B 2CV5B 2AROA 1JFIA 5DNMD 1P3GA 5DNMC 4XZQB 1P3MB 2Y2IA 5F99C 3UTAC 3WTPA 3MNND 4H9PB 4EO5B 1P3KB 4KUDC 2NQBA 3O62D 2HIOA 3LZ1B 3AV2A 3AZGA 3TU4C 4WU8D 3C1CD 3AFAA 4WU9B 2HUEB 3AYWA 3AZFA 5AV5B 1S32B 4AWLB 4X23B 3EPLA 5AVBD 4J8UA 4UPKA 5BO0B 2L5AA 3LJAA 4J8XD 2PYOD 3NQUB 4ZUXC 4H9OA 3KXBD 1P3LD 3REHC 5B0YC 2PYOC 2YFWB 4HGAB 3KXBC 1P3IA 4XUJD 3MGSB 5B31D 2DQNC 4JJNA 5CPJB 3LELD 3VH6W 3MGQC 4WJ3C 3X1SA 5AVCD 3X1UD 3LELC 3REIC 1TZYD 5B31G 1JFIB 2F8NK 3X1UC 3RELA 5E5AA 4R8PB 3AZKD 2NZDD 3WTPB 3AZMA 4ZBJB 3MVDA 3AZED 5B1MA 1M18C 1P3OD 1KX3A 1BFMA 5B1LD 4J8WA 2NQBB 3AZEC 1ZLAB 3LZ0D 4YM6D 2HIOB 3W97A 3AFAB 3P5JB 3AYWB 3AZFB 5CP6D 4QLCA 2BYMA 3MGRC 1HTAA 3LJAB 1P3PA 1EQZD 3AZLD 4KGCB 4E44A 5AV6B 5KDMA 1P3AD 3A1KA 3KSYA 3UT9D 2F8NB 1P3IB 5GT3C 1P34D 3UT9C 3AN2D 3B0DC 1KX5C 4Z66A 2F2AC 3AN2C 3B6FB 1HQ3A 5B33D 1F66B 3AZGD 3B6GD 2DF4C 3AV1D 3WA9C 5CPKB 3B6GC 5GSUD 3AV1C 3B0CW 4YS3A 5E5AB 2IO5B 5DNNB 5BS7C 3MVDB 4KHAB 5B1MB 4J8WB 1H3OA 5DNMA 3A6NB 1P3BD 5B24C 3VH5T 3MNNA 1P3BC 4WNNA 5B32C 2BYMB 1T3UA 3AZNC 1AOID 3AZHD 4CAYA 3W98B 5BNVB 2Y2JA 3O62A 1P3PB 3KFUG 3C1BD 3RELD 4WU8A 3AZJC 1B67A 1U35C 5AVBA 3W99B 3NQJB 3WAAD 4J8XA 3REHA 4Z66B 2PYOA 1N1JB 3WAAC 3KXBA 1P3LA 4NE5A 4G92C 5AV8B 2CWEA 4XUJA 5GXQC 3EPKA 1KX4B 5B31A 4LD9D 5AY8B 1TAFA 4LD9C 3LELA 5BNXB 3X1UA 3VH5A 1M19C 1TZYA 1H3OB 3AZIC 5CPKC 4J8VD 3AZKA 2NZDA 3X1TD 2FFFB 5C3IB 3VH6T 5JRGC 3MNNB 4J8VC 1ID3B 3AZEA 1P3OA 1Q9CA 5B1LA 3WKJD 3LZ0A 4YM6A 3REJD 2LY8A 4WU8B 5JA4B 5AV9B 3C1CB 5GT0B 5CP6A 5AVBB 4H9SC 1EQZA 4J8XB 3AZLA 2ZY5A 3MGPD 1P3LB 5F99D 1P3AA 3UTAD 5B40D 3MGPC 5CHLB 3UT9A 5B40C 1P34A 4XUJB 4KUDD 3AN2A 2XD1A 5B31B 5CPID 1M1AC 5FUGA 5BT1D 3TU4D 1TAFB 5CPIC 5B33A 3AL0C 3EPJA 5BT1C 5AVCB 4DRAA 3B6GA 3AV1A 1TZYB 2FJ7C 5GSUA 4ZUXD 3AZKB 2NZDB 3REHD 5B0YD 3X1VC 3KWQC 3KUYD 3REKC 5B2IB 1P3OB 5B2JD 3H0RC 5B1LB 3UTBC 3KUYC 3LZ0B 4YM6B 4Z2MG 5B2JC 2J8PA 5B24A 1P3BA 4Z5TC 3MGQD 5CP6B 1AOIA 3REID 3W96B 5B0ZC 3AZHA 1EQZB 3AZLB 2Y2KA 2AROB 3C1BA 1P3AB 1P3GB 3R45A 4G91B 1M18D 1P34B 1P3FC 2ZY2A 3WAAA
chains in the Genus database with same CATH topology
2CV5C 5B33B 1P3MD 3AV2B 3AZGB 3MGRD 3F6TA 4XZQC 1P3MC 5GSUB 4J8UB 4LD9A 4EO5C 1P3KC 3LZ1C 4H9OB 5AV5D 2VQRA 5GT3D 4X23D 4WU9C 2HUEC 5AV5C 1S32C 4AWLC 4X23C 1KX5D 4J8VA 5JRGA 4JJNB 3X1TA 3FDDA 1AOIB 3AZHB 3WA9D 4H9NA 3WKJA 3X1SB 4HGAC 3REJA 2XD5A 3C1BB 3RELB 4NFTA 3MGSC 3V9RA 3AZMB 5CPJC 1KX3B 1A7WA 2Y2OA 2RIQA 4DRBA 1ULYA 3MGPA 5F99A 5B24D 3UTAA 5B40A 4R8PD 3W97B 5B32D 3AZND 4R8PC 3WTPC 4ZBJC 4QLCB 4KUDA 2YFVA 5CPIA 2BYKA 2NQBC 5B32G 3TU4A 1ZLAC 2HIOC 3AZJD 5KDMB 1U35D 4NE3A 3AFAC 4H9RA 3AZFC 3AYWC 1R4VA 3X1VA 2ZY3A 4ZUXA 3LJAC 5AV6D 5B0YA 3X1TB 4KGCC 1HQ3B 3KUYA 5AV6C 5B2JA 4H9NB 3WKJB 5GXQD 3REJB 1P3IC 4Z5TA 1M19B 2F8NH 2BG1A 3B6FD 4YS3B 3MGQA 1F66D 3V9RB 3REIA 3B6FC 1M19D 1F66C 2ZY4A 3EPHA 3AZID 5CPKD 5DNMB 4UUZA 5F99B 1B6WA 2G5IC 3UTAB 5JRGD 1Z2CB 1M18A 2JSSA 1BH8A 5DNNC 2IO5C 5E5AC 4WNNB 4KUDB 1KU5A 3MVDC 5B1MC 4CAYB 2BYKB 3A6ND 3O62B 4J8WC 3TU4B 1P3MA 3A6NC 4H9QA 3MGRA 1WWIA 4H9PA 3W98D 2Y2MA 3W98C 4ZUXB 3REHB 5B0YB 1P3PC 2PYOB 1BH9A 3KXBB 5G49A 5AV5A 1S32A 5GT3A 4X23A 1KX5A 3W99C 1M1AD 2RVQC 3MGQB 4Z66C 3REIB 5AV8D 3LELB 2FJ7D 3WA9A 3X1UB 5AV8C 3VH6A 3WTPE 1KX4D 5AY8D 5BS7A 3KWQD 3X1VD 1KX4C 4WV4B 5AY8C 3REKD 1M18B 3A1IA 3UTBD 3AZEB 3B0CT 4Z5TD 4R8PA 4H9QB 5B32A 3MGRB 3AZNA 1ID3D 1WWSA 5B0ZD 5C3IC 3MNNC 4CSRA 1ID3C 4M6BA 1ZLAA 3H0MC 3O62C 5AV9D 1BH9B 3AZJA 5GT0D 5G49B 1U35A 4WU8C 5GT3B 5AV9C 3C1CC 1P3FD 5GT0C 3UT9B 3B0DB 2G5HC 1KX5B 5AVBC 3AN2B 2CV5D 4KGCA 4Z2MH 5AV6A 4J8XC 2Y2GA 5FUGB 1P3LC 4XZQD 3WA9B 2F8NA 5GXQA 3B6GB 3AV1B 1P3KD 4XUJC 3B6FA 3LZ1D 5B31C 1F66A 1M19A 4WU9D 3AZIA 1S32D 5AVCC 5CPKA 3B0BA 1TZYC 5B24B 5DNNA 1P3BB 5B32B 3AZNB 2ZM5A 4KHAA 3AZKC 5B2ID 2NZDC 4CSRB 5B2IC 1P3OC 3A6NA 5B1LC 2Y2QA 3LZ0C 4YM6C 3AZJB 3MGSD 1U35B 1F1EA 5CPJD 3W96D 3R45B 4H9SA 3W98A 5CP6C 3W96C 2UWXA 5BNVA 2AROD 3WAAB 4G92B 3IP4C 1EQZC 3AZLC 2AROC 1P3GD 1P3AC 3WTPD 1P3GC 5GXQB 3W99A 3NQJA 4G91C 3H0LC 1P34C 1M1AA 2NQBD 1ZLAD 4LD9B 1N1JA 2HIOD 3AV2D 5AV8A 1W2EA 2W8SA 4NE6A 3AFAD 5B33C 3AV2C 3AYWD 3AZFD 3AZGC 3AZIB 2FJ7A 4J8UD 1KX4A 5AY8A 3LJAD 5GSUC 5JRGB 3KWQA 4J8UC 4J8VB 4KGCD 5BNXA 3REKA 3UTBA 2F8ND 1P3ID 2Y2NA 4JJND 1ID3A 5B0ZA 2Y2HA 4JJNC 2F8NG 2JE5A 1AOIC 3X1SD 3AZHC 3X1SC 4E45A 5JA4A 5AV9A 3MGPB 3C1CA 5GT0A 3C1BC 3RELC 5E5AD 5DNND 5B40B 1P3FA 3AZMD 3MVDD 4DQYB 5B1MD 1KX3D 3AZMC 2CV5A 4J8WD 4WZSB 1M1AB 2YFVB 5CPIB 1KX3C 3W97D 4XZQA 2FJ7B 3W97C 4QLCD 4H9RB 1P3KA 4QLCC 3KWQB 3X1VB 1P3PD 3LZ1A 3REKB 1PZRA 5AVCA 2Y2PA 3UTBB 3KUYB 4WU9A 2JCHA 5B2JB 3W99D 5BO0A 4Z5TB 2RVQD 4Z66D 3NQUA 1HQ3D 3EG5B 5B0ZB 5B2IA 3X1TC 2YFWA 1HQ3C 2Y2LA 3WKJC 4UUZB 3MGSA 3REJC 4YS3D 1P3FB 5CPJA 3W96A 4YS3C 3VH5W 1BH8B 2CV5B 2AROA 1JFIA 5DNMD 1P3GA 5DNMC 4XZQB 1P3MB 2Y2IA 5F99C 3UTAC 3WTPA 3MNND 4H9PB 4EO5B 1P3KB 4KUDC 2NQBA 3O62D 2HIOA 3LZ1B 3AV2A 3AZGA 3TU4C 4WU8D 3C1CD 3AFAA 4WU9B 2HUEB 3AYWA 3AZFA 5AV5B 1S32B 4AWLB 4X23B 3EPLA 5AVBD 4J8UA 4UPKA 5BO0B 2L5AA 3LJAA 4J8XD 2PYOD 3NQUB 4ZUXC 4H9OA 3KXBD 1P3LD 3REHC 5B0YC 2PYOC 2YFWB 4HGAB 3KXBC 1P3IA 4XUJD 3MGSB 5B31D 2DQNC 4JJNA 5CPJB 3LELD 3VH6W 3MGQC 4WJ3C 3X1SA 5AVCD 3X1UD 3LELC 3REIC 1TZYD 5B31G 1JFIB 2F8NK 3X1UC 3RELA 5E5AA 4R8PB 3AZKD 2NZDD 3WTPB 3AZMA 4ZBJB 3MVDA 3AZED 5B1MA 1M18C 1P3OD 1KX3A 1BFMA 5B1LD 4J8WA 2NQBB 3AZEC 1ZLAB 3LZ0D 4YM6D 2HIOB 3W97A 3AFAB 3P5JB 3AYWB 3AZFB 5CP6D 4QLCA 2BYMA 3MGRC 1HTAA 3LJAB 1P3PA 1EQZD 3AZLD 4KGCB 4E44A 5AV6B 5KDMA 1P3AD 3A1KA 3KSYA 3UT9D 2F8NB 1P3IB 5GT3C 1P34D 3UT9C 3AN2D 3B0DC 1KX5C 4Z66A 2F2AC 3AN2C 3B6FB 1HQ3A 5B33D 1F66B 3AZGD 3B6GD 2DF4C 3AV1D 3WA9C 5CPKB 3B6GC 5GSUD 3AV1C 3B0CW 4YS3A 5E5AB 2IO5B 5DNNB 5BS7C 3MVDB 4KHAB 5B1MB 4J8WB 1H3OA 5DNMA 3A6NB 1P3BD 5B24C 3VH5T 3MNNA 1P3BC 4WNNA 5B32C 2BYMB 1T3UA 3AZNC 1AOID 3AZHD 4CAYA 3W98B 5BNVB 2Y2JA 3O62A 1P3PB 3KFUG 3C1BD 3RELD 4WU8A 3AZJC 1B67A 1U35C 5AVBA 3W99B 3NQJB 3WAAD 4J8XA 3REHA 4Z66B 2PYOA 1N1JB 3WAAC 3KXBA 1P3LA 4NE5A 4G92C 5AV8B 2CWEA 4XUJA 5GXQC 3EPKA 1KX4B 5B31A 4LD9D 5AY8B 1TAFA 4LD9C 3LELA 5BNXB 3X1UA 3VH5A 1M19C 1TZYA 1H3OB 3AZIC 5CPKC 4J8VD 3AZKA 2NZDA 3X1TD 2FFFB 5C3IB 3VH6T 5JRGC 3MNNB 4J8VC 1ID3B 3AZEA 1P3OA 1Q9CA 5B1LA 3WKJD 3LZ0A 4YM6A 3REJD 2LY8A 4WU8B 5JA4B 5AV9B 3C1CB 5GT0B 5CP6A 5AVBB 4H9SC 1EQZA 4J8XB 3AZLA 2ZY5A 3MGPD 1P3LB 5F99D 1P3AA 3UTAD 5B40D 3MGPC 5CHLB 3UT9A 5B40C 1P34A 4XUJB 4KUDD 3AN2A 2XD1A 5B31B 5CPID 1M1AC 5FUGA 5BT1D 3TU4D 1TAFB 5CPIC 5B33A 3AL0C 3EPJA 5BT1C 5AVCB 4DRAA 3B6GA 3AV1A 1TZYB 2FJ7C 5GSUA 4ZUXD 3AZKB 2NZDB 3REHD 5B0YD 3X1VC 3KWQC 3KUYD 3REKC 5B2IB 1P3OB 5B2JD 3H0RC 5B1LB 3UTBC 3KUYC 3LZ0B 4YM6B 4Z2MG 5B2JC 2J8PA 5B24A 1P3BA 4Z5TC 3MGQD 5CP6B 1AOIA 3REID 3W96B 5B0ZC 3AZHA 1EQZB 3AZLB 2Y2KA 2AROB 3C1BA 1P3AB 1P3GB 3R45A 4G91B 1M18D 1P34B 1P3FC 2ZY2A 3WAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 C;  5B33 B;  1P3M D;  3AV2 B;  3AZG B;  3MGR D;  4XZQ C;  1P3M C;  5GSU B;  4J8U B;  4LD9 A;  4EO5 C;  1P3K C;  3LZ1 C;  4H9O B;  5AV5 D;  5GT3 D;  4X23 D;  4WU9 C;  2HUE C;  5AV5 C;  1S32 C;  4AWL C;  4X23 C;  1KX5 D;  4J8V A;  5JRG A;  4JJN B;  3X1T A;  1AOI B;  3AZH B;  3WA9 D;  4H9N A;  3WKJ A;  3X1S B;  4HGA C;  3REJ A;  3C1B B;  3REL B;  4NFT A;  3MGS C;  3V9R A;  3AZM B;  5CPJ C;  1KX3 B;  1A7W A;  4DRB A;  1ULY A;  3MGP A;  5F99 A;  5B24 D;  3UTA A;  5B40 A;  4R8P D;  3W97 B;  5B32 D;  3AZN D;  4R8P C;  3WTP C;  4ZBJ C;  4QLC B;  4KUD A;  2YFV A;  5CPI A;  2BYK A;  2NQB C;  5B32 G;  3TU4 A;  1ZLA C;  2HIO C;  3AZJ D;  5KDM B;  1U35 D;  4NE3 A;  3AFA C;  4H9R A;  3AZF C;  3AYW C;  1R4V A;  3X1V A;  4ZUX A;  3LJA C;  5AV6 D;  5B0Y A;  3X1T B;  4KGC C;  1HQ3 B;  3KUY A;  5AV6 C;  5B2J A;  4H9N B;  3WKJ B;  5GXQ D;  3REJ B;  1P3I C;  4Z5T A;  2F8N H;  3B6F D;  4YS3 B;  3MGQ A;  1F66 D;  3V9R B;  3REI A;  3B6F C;  1M19 D;  1F66 C;  3AZI D;  5CPK D;  5DNM B;  4UUZ A;  5F99 B;  1B6W A;  3UTA B;  5JRG D;  1M18 A;  2JSS A;  1BH8 A;  2IO5 C;  5E5A C;  5DNN C;  4WNN B;  4KUD B;  1KU5 A;  3MVD C;  5B1M C;  4CAY B;  2BYK B;  3A6N D;  3O62 B;  4J8W C;  3TU4 B;  1P3M A;  3A6N C;  4H9Q A;  3MGR A;  1WWI A;  4H9P A;  3W98 D;  3W98 C;  4ZUX B;  3REH B;  5B0Y B;  1P3P C;  2PYO B;  1BH9 A;  3KXB B;  5G49 A;  5AV5 A;  1S32 A;  5GT3 A;  4X23 A;  1KX5 A;  3W99 C;  1M1A D;  2RVQ C;  3MGQ B;  4Z66 C;  3REI B;  5AV8 D;  3LEL B;  2FJ7 D;  3WA9 A;  3X1U B;  5AV8 C;  3VH6 A;  3WTP E;  1KX4 D;  5AY8 D;  5BS7 A;  3KWQ D;  3X1V D;  1KX4 C;  4WV4 B;  5AY8 C;  3REK D;  1M18 B;  3UTB D;  3AZE B;  3B0C T;  4Z5T D;  4R8P A;  4H9Q B;  5B32 A;  3MGR B;  3AZN A;  1ID3 D;  1WWS A;  5B0Z D;  5C3I C;  3MNN C;  4CSR A;  1ID3 C;  4M6B A;  1ZLA A;  3O62 C;  5AV9 D;  1BH9 B;  3AZJ A;  5GT0 D;  5G49 B;  1U35 A;  4WU8 C;  5GT3 B;  5AV9 C;  3C1C C;  1P3F D;  5GT0 C;  3UT9 B;  3B0D B;  1KX5 B;  5AVB C;  3AN2 B;  2CV5 D;  4KGC A;  4Z2M H;  5AV6 A;  4J8X C;  5FUG B;  1P3L C;  4XZQ D;  3WA9 B;  2F8N A;  5GXQ A;  3B6G B;  3AV1 B;  1P3K D;  4XUJ C;  3B6F A;  3LZ1 D;  5B31 C;  1F66 A;  1M19 A;  4WU9 D;  3AZI A;  1S32 D;  5AVC C;  5CPK A;  3B0B A;  1TZY C;  5B24 B;  5DNN A;  1P3B B;  5B32 B;  3AZN B;  4KHA A;  3AZK C;  5B2I D;  2NZD C;  4CSR B;  5B2I C;  1P3O C;  3A6N A;  5B1L C;  3LZ0 C;  4YM6 C;  3AZJ B;  3MGS D;  1U35 B;  1F1E A;  5CPJ D;  3W96 D;  3R45 B;  4H9S A;  3W98 A;  5CP6 C;  3W96 C;  5BNV A;  2ARO D;  3WAA B;  4G92 B;  1EQZ C;  3AZL C;  2ARO C;  1P3G D;  1P3A C;  3WTP D;  1P3G C;  5GXQ B;  3W99 A;  3NQJ A;  4G91 C;  1P34 C;  1M1A A;  2NQB D;  1ZLA D;  4LD9 B;  1N1J A;  2HIO D;  3AV2 D;  5AV8 A;  1M19 B;  4NE6 A;  3AFA D;  5B33 C;  3AV2 C;  2FJ7 A;  3AYW D;  3AZF D;  3AZG C;  3AZI B;  4J8U D;  1KX4 A;  5AY8 A;  3LJA D;  5GSU C;  5JRG B;  3KWQ A;  4J8U C;  4J8V B;  4KGC D;  5BNX A;  3REK A;  3UTB A;  2F8N D;  1P3I D;  4JJN D;  1ID3 A;  5B0Z A;  4JJN C;  2F8N G;  1AOI C;  3X1S D;  3AZH C;  3X1S C;  4E45 A;  5JA4 A;  5AV9 A;  3MGP B;  3C1C A;  5GT0 A;  3C1B C;  3REL C;  5E5A D;  5DNN D;  5B40 B;  1P3F A;  3AZM D;  3MVD D;  5B1M D;  1KX3 D;  3AZM C;  2CV5 A;  4J8W D;  4WZS B;  1M1A B;  2YFV B;  5CPI B;  1KX3 C;  3W97 D;  4XZQ A;  2FJ7 B;  3W97 C;  4QLC D;  4H9R B;  1P3K A;  4QLC C;  3KWQ B;  3X1V B;  1P3P D;  3LZ1 A;  3REK B;  5AVC A;  3UTB B;  3KUY B;  4WU9 A;  5B2J B;  3W99 D;  5BO0 A;  4Z5T B;  2RVQ D;  4Z66 D;  3NQU A;  1HQ3 D;  5B0Z B;  5B2I A;  3X1T C;  2YFW A;  1HQ3 C;  3WKJ C;  4UUZ B;  3MGS A;  3REJ C;  4YS3 D;  1P3F B;  5CPJ A;  3W96 A;  4YS3 C;  3VH5 W;  1BH8 B;  2CV5 B;  2ARO A;  1JFI A;  5DNM D;  1P3G A;  5DNM C;  4XZQ B;  1P3M B;  5F99 C;  3UTA C;  3WTP A;  3MNN D;  4H9P B;  4EO5 B;  1P3K B;  4KUD C;  2NQB A;  3O62 D;  2HIO A;  3LZ1 B;  3AV2 A;  3AZG A;  3TU4 C;  4WU8 D;  3C1C D;  3AFA A;  4WU9 B;  2HUE B;  3AYW A;  3AZF A;  5AV5 B;  1S32 B;  4AWL B;  4X23 B;  5AVB D;  4J8U A;  5BO0 B;  2L5A A;  3LJA A;  4J8X D;  2PYO D;  3NQU B;  4ZUX C;  4H9O A;  3KXB D;  1P3L D;  3REH C;  5B0Y C;  2PYO C;  2YFW B;  4HGA B;  3KXB C;  1P3I A;  4XUJ D;  3MGS B;  5B31 D;  4JJN A;  5CPJ B;  3LEL D;  3VH6 W;  3MGQ C;  3X1S A;  5AVC D;  3X1U D;  3LEL C;  3REI C;  1TZY D;  5B31 G;  1JFI B;  2F8N K;  3X1U C;  3REL A;  5E5A A;  4R8P B;  3AZK D;  2NZD D;  3WTP B;  3AZM A;  4ZBJ B;  3MVD A;  3AZE D;  5B1M A;  1M18 C;  1P3O D;  1KX3 A;  1BFM A;  5B1L D;  4J8W A;  2NQB B;  3AZE C;  1ZLA B;  3LZ0 D;  4YM6 D;  2HIO B;  3W97 A;  3AFA B;  3AYW B;  3AZF B;  5CP6 D;  4QLC A;  2BYM A;  3MGR C;  1HTA A;  3LJA B;  1P3P A;  1EQZ D;  3AZL D;  4KGC B;  4E44 A;  5AV6 B;  5KDM A;  1P3A D;  3KSY A;  3UT9 D;  2F8N B;  1P3I B;  5GT3 C;  1P34 D;  3UT9 C;  3AN2 D;  3B0D C;  1KX5 C;  4Z66 A;  3AN2 C;  3B6F B;  1HQ3 A;  5B33 D;  1F66 B;  3AZG D;  3B6G D;  3AV1 D;  3WA9 C;  5CPK B;  3B6G C;  5GSU D;  3AV1 C;  3B0C W;  4YS3 A;  5E5A B;  2IO5 B;  5DNN B;  5BS7 C;  3MVD B;  4KHA B;  5B1M B;  4J8W B;  1H3O A;  5DNM A;  3A6N B;  1P3B D;  5B24 C;  3VH5 T;  3MNN A;  1P3B C;  4WNN A;  5B32 C;  2BYM B;  3AZN C;  1AOI D;  3AZH D;  4CAY A;  3W98 B;  5BNV B;  3O62 A;  1P3P B;  3C1B D;  3REL D;  4WU8 A;  3AZJ C;  1B67 A;  1U35 C;  5AVB A;  3W99 B;  3NQJ B;  3WAA D;  4J8X A;  3REH A;  4Z66 B;  2PYO A;  1N1J B;  3WAA C;  3KXB A;  1P3L A;  4NE5 A;  4G92 C;  5AV8 B;  2CWE A;  4XUJ A;  5GXQ C;  1KX4 B;  5B31 A;  4LD9 D;  5AY8 B;  1TAF A;  4LD9 C;  3LEL A;  5BNX B;  3X1U A;  3VH5 A;  1M19 C;  1TZY A;  1H3O B;  3AZI C;  5CPK C;  4J8V D;  3AZK A;  2NZD A;  3X1T D;  5C3I B;  5JRG C;  3VH6 T;  3MNN B;  4J8V C;  1ID3 B;  3AZE A;  1P3O A;  1Q9C A;  5B1L A;  3WKJ D;  3LZ0 A;  4YM6 A;  3REJ D;  2LY8 A;  4WU8 B;  5JA4 B;  5AV9 B;  3C1C B;  5GT0 B;  5CP6 A;  5AVB B;  4H9S C;  1EQZ A;  4J8X B;  3AZL A;  3MGP D;  1P3L B;  5F99 D;  1P3A A;  3UTA D;  5B40 D;  3MGP C;  5CHL B;  3UT9 A;  5B40 C;  1P34 A;  4XUJ B;  4KUD D;  3AN2 A;  5B31 B;  5CPI D;  1M1A C;  5FUG A;  5BT1 D;  3TU4 D;  1TAF B;  5CPI C;  5B33 A;  5BT1 C;  5AVC B;  4DRA A;  3B6G A;  3AV1 A;  1TZY B;  2FJ7 C;  5GSU A;  4ZUX D;  3AZK B;  2NZD B;  3REH D;  5B0Y D;  3X1V C;  3KWQ C;  3KUY D;  3REK C;  5B2I B;  1P3O B;  5B2J D;  5B1L B;  3UTB C;  3KUY C;  3LZ0 B;  4YM6 B;  4Z2M G;  5B2J C;  5B24 A;  1P3B A;  4Z5T C;  3MGQ D;  5CP6 B;  1AOI A;  3REI D;  3W96 B;  5B0Z C;  3AZH A;  1EQZ B;  3AZL B;  2ARO B;  3C1B A;  1P3A B;  1P3G B;  3R45 A;  4G91 B;  1M18 D;  1P34 B;  1P3F C;  3WAA A; 
#chains in the Genus database with same CATH topology
 2CV5 C;  5B33 B;  1P3M D;  3AV2 B;  3AZG B;  3MGR D;  3F6T A;  4XZQ C;  1P3M C;  5GSU B;  4J8U B;  4LD9 A;  4EO5 C;  1P3K C;  3LZ1 C;  4H9O B;  5AV5 D;  2VQR A;  5GT3 D;  4X23 D;  4WU9 C;  2HUE C;  5AV5 C;  1S32 C;  4AWL C;  4X23 C;  1KX5 D;  4J8V A;  5JRG A;  4JJN B;  3X1T A;  3FDD A;  1AOI B;  3AZH B;  3WA9 D;  4H9N A;  3WKJ A;  3X1S B;  4HGA C;  3REJ A;  2XD5 A;  3C1B B;  3REL B;  4NFT A;  3MGS C;  3V9R A;  3AZM B;  5CPJ C;  1KX3 B;  1A7W A;  2Y2O A;  2RIQ A;  4DRB A;  1ULY A;  3MGP A;  5F99 A;  5B24 D;  3UTA A;  5B40 A;  4R8P D;  3W97 B;  5B32 D;  3AZN D;  4R8P C;  3WTP C;  4ZBJ C;  4QLC B;  4KUD A;  2YFV A;  5CPI A;  2BYK A;  2NQB C;  5B32 G;  3TU4 A;  1ZLA C;  2HIO C;  3AZJ D;  5KDM B;  1U35 D;  4NE3 A;  3AFA C;  4H9R A;  3AZF C;  3AYW C;  1R4V A;  3X1V A;  2ZY3 A;  4ZUX A;  3LJA C;  5AV6 D;  5B0Y A;  3X1T B;  4KGC C;  1HQ3 B;  3KUY A;  5AV6 C;  5B2J A;  4H9N B;  3WKJ B;  5GXQ D;  3REJ B;  1P3I C;  4Z5T A;  1M19 B;  2F8N H;  2BG1 A;  3B6F D;  4YS3 B;  3MGQ A;  1F66 D;  3V9R B;  3REI A;  3B6F C;  1M19 D;  1F66 C;  2ZY4 A;  3EPH A;  3AZI D;  5CPK D;  5DNM B;  4UUZ A;  5F99 B;  1B6W A;  2G5I C;  3UTA B;  5JRG D;  1Z2C B;  1M18 A;  2JSS A;  1BH8 A;  5DNN C;  2IO5 C;  5E5A C;  4WNN B;  4KUD B;  1KU5 A;  3MVD C;  5B1M C;  4CAY B;  2BYK B;  3A6N D;  3O62 B;  4J8W C;  3TU4 B;  1P3M A;  3A6N C;  4H9Q A;  3MGR A;  1WWI A;  4H9P A;  3W98 D;  2Y2M A;  3W98 C;  4ZUX B;  3REH B;  5B0Y B;  1P3P C;  2PYO B;  1BH9 A;  3KXB B;  5G49 A;  5AV5 A;  1S32 A;  5GT3 A;  4X23 A;  1KX5 A;  3W99 C;  1M1A D;  2RVQ C;  3MGQ B;  4Z66 C;  3REI B;  5AV8 D;  3LEL B;  2FJ7 D;  3WA9 A;  3X1U B;  5AV8 C;  3VH6 A;  3WTP E;  1KX4 D;  5AY8 D;  5BS7 A;  3KWQ D;  3X1V D;  1KX4 C;  4WV4 B;  5AY8 C;  3REK D;  1M18 B;  3A1I A;  3UTB D;  3AZE B;  3B0C T;  4Z5T D;  4R8P A;  4H9Q B;  5B32 A;  3MGR B;  3AZN A;  1ID3 D;  1WWS A;  5B0Z D;  5C3I C;  3MNN C;  4CSR A;  1ID3 C;  4M6B A;  1ZLA A;  3H0M C;  3O62 C;  5AV9 D;  1BH9 B;  3AZJ A;  5GT0 D;  5G49 B;  1U35 A;  4WU8 C;  5GT3 B;  5AV9 C;  3C1C C;  1P3F D;  5GT0 C;  3UT9 B;  3B0D B;  2G5H C;  1KX5 B;  5AVB C;  3AN2 B;  2CV5 D;  4KGC A;  4Z2M H;  5AV6 A;  4J8X C;  2Y2G A;  5FUG B;  1P3L C;  4XZQ D;  3WA9 B;  2F8N A;  5GXQ A;  3B6G B;  3AV1 B;  1P3K D;  4XUJ C;  3B6F A;  3LZ1 D;  5B31 C;  1F66 A;  1M19 A;  4WU9 D;  3AZI A;  1S32 D;  5AVC C;  5CPK A;  3B0B A;  1TZY C;  5B24 B;  5DNN A;  1P3B B;  5B32 B;  3AZN B;  2ZM5 A;  4KHA A;  3AZK C;  5B2I D;  2NZD C;  4CSR B;  5B2I C;  1P3O C;  3A6N A;  5B1L C;  2Y2Q A;  3LZ0 C;  4YM6 C;  3AZJ B;  3MGS D;  1U35 B;  1F1E A;  5CPJ D;  3W96 D;  3R45 B;  4H9S A;  3W98 A;  5CP6 C;  3W96 C;  2UWX A;  5BNV A;  2ARO D;  3WAA B;  4G92 B;  3IP4 C;  1EQZ C;  3AZL C;  2ARO C;  1P3G D;  1P3A C;  3WTP D;  1P3G C;  5GXQ B;  3W99 A;  3NQJ A;  4G91 C;  3H0L C;  1P34 C;  1M1A A;  2NQB D;  1ZLA D;  4LD9 B;  1N1J A;  2HIO D;  3AV2 D;  5AV8 A;  1W2E A;  2W8S A;  4NE6 A;  3AFA D;  5B33 C;  3AV2 C;  3AYW D;  3AZF D;  3AZG C;  3AZI B;  2FJ7 A;  4J8U D;  1KX4 A;  5AY8 A;  3LJA D;  5GSU C;  5JRG B;  3KWQ A;  4J8U C;  4J8V B;  4KGC D;  5BNX A;  3REK A;  3UTB A;  2F8N D;  1P3I D;  2Y2N A;  4JJN D;  1ID3 A;  5B0Z A;  2Y2H A;  4JJN C;  2F8N G;  2JE5 A;  1AOI C;  3X1S D;  3AZH C;  3X1S C;  4E45 A;  5JA4 A;  5AV9 A;  3MGP B;  3C1C A;  5GT0 A;  3C1B C;  3REL C;  5E5A D;  5DNN D;  5B40 B;  1P3F A;  3AZM D;  3MVD D;  4DQY B;  5B1M D;  1KX3 D;  3AZM C;  2CV5 A;  4J8W D;  4WZS B;  1M1A B;  2YFV B;  5CPI B;  1KX3 C;  3W97 D;  4XZQ A;  2FJ7 B;  3W97 C;  4QLC D;  4H9R B;  1P3K A;  4QLC C;  3KWQ B;  3X1V B;  1P3P D;  3LZ1 A;  3REK B;  1PZR A;  5AVC A;  2Y2P A;  3UTB B;  3KUY B;  4WU9 A;  2JCH A;  5B2J B;  3W99 D;  5BO0 A;  4Z5T B;  2RVQ D;  4Z66 D;  3NQU A;  1HQ3 D;  3EG5 B;  5B0Z B;  5B2I A;  3X1T C;  2YFW A;  1HQ3 C;  2Y2L A;  3WKJ C;  4UUZ B;  3MGS A;  3REJ C;  4YS3 D;  1P3F B;  5CPJ A;  3W96 A;  4YS3 C;  3VH5 W;  1BH8 B;  2CV5 B;  2ARO A;  1JFI A;  5DNM D;  1P3G A;  5DNM C;  4XZQ B;  1P3M B;  2Y2I A;  5F99 C;  3UTA C;  3WTP A;  3MNN D;  4H9P B;  4EO5 B;  1P3K B;  4KUD C;  2NQB A;  3O62 D;  2HIO A;  3LZ1 B;  3AV2 A;  3AZG A;  3TU4 C;  4WU8 D;  3C1C D;  3AFA A;  4WU9 B;  2HUE B;  3AYW A;  3AZF A;  5AV5 B;  1S32 B;  4AWL B;  4X23 B;  3EPL A;  5AVB D;  4J8U A;  4UPK A;  5BO0 B;  2L5A A;  3LJA A;  4J8X D;  2PYO D;  3NQU B;  4ZUX C;  4H9O A;  3KXB D;  1P3L D;  3REH C;  5B0Y C;  2PYO C;  2YFW B;  4HGA B;  3KXB C;  1P3I A;  4XUJ D;  3MGS B;  5B31 D;  2DQN C;  4JJN A;  5CPJ B;  3LEL D;  3VH6 W;  3MGQ C;  4WJ3 C;  3X1S A;  5AVC D;  3X1U D;  3LEL C;  3REI C;  1TZY D;  5B31 G;  1JFI B;  2F8N K;  3X1U C;  3REL A;  5E5A A;  4R8P B;  3AZK D;  2NZD D;  3WTP B;  3AZM A;  4ZBJ B;  3MVD A;  3AZE D;  5B1M A;  1M18 C;  1P3O D;  1KX3 A;  1BFM A;  5B1L D;  4J8W A;  2NQB B;  3AZE C;  1ZLA B;  3LZ0 D;  4YM6 D;  2HIO B;  3W97 A;  3AFA B;  3P5J B;  3AYW B;  3AZF B;  5CP6 D;  4QLC A;  2BYM A;  3MGR C;  1HTA A;  3LJA B;  1P3P A;  1EQZ D;  3AZL D;  4KGC B;  4E44 A;  5AV6 B;  5KDM A;  1P3A D;  3A1K A;  3KSY A;  3UT9 D;  2F8N B;  1P3I B;  5GT3 C;  1P34 D;  3UT9 C;  3AN2 D;  3B0D C;  1KX5 C;  4Z66 A;  2F2A C;  3AN2 C;  3B6F B;  1HQ3 A;  5B33 D;  1F66 B;  3AZG D;  3B6G D;  2DF4 C;  3AV1 D;  3WA9 C;  5CPK B;  3B6G C;  5GSU D;  3AV1 C;  3B0C W;  4YS3 A;  5E5A B;  2IO5 B;  5DNN B;  5BS7 C;  3MVD B;  4KHA B;  5B1M B;  4J8W B;  1H3O A;  5DNM A;  3A6N B;  1P3B D;  5B24 C;  3VH5 T;  3MNN A;  1P3B C;  4WNN A;  5B32 C;  2BYM B;  1T3U A;  3AZN C;  1AOI D;  3AZH D;  4CAY A;  3W98 B;  5BNV B;  2Y2J A;  3O62 A;  1P3P B;  3KFU G;  3C1B D;  3REL D;  4WU8 A;  3AZJ C;  1B67 A;  1U35 C;  5AVB A;  3W99 B;  3NQJ B;  3WAA D;  4J8X A;  3REH A;  4Z66 B;  2PYO A;  1N1J B;  3WAA C;  3KXB A;  1P3L A;  4NE5 A;  4G92 C;  5AV8 B;  2CWE A;  4XUJ A;  5GXQ C;  3EPK A;  1KX4 B;  5B31 A;  4LD9 D;  5AY8 B;  1TAF A;  4LD9 C;  3LEL A;  5BNX B;  3X1U A;  3VH5 A;  1M19 C;  1TZY A;  1H3O B;  3AZI C;  5CPK C;  4J8V D;  3AZK A;  2NZD A;  3X1T D;  2FFF B;  5C3I B;  3VH6 T;  5JRG C;  3MNN B;  4J8V C;  1ID3 B;  3AZE A;  1P3O A;  1Q9C A;  5B1L A;  3WKJ D;  3LZ0 A;  4YM6 A;  3REJ D;  2LY8 A;  4WU8 B;  5JA4 B;  5AV9 B;  3C1C B;  5GT0 B;  5CP6 A;  5AVB B;  4H9S C;  1EQZ A;  4J8X B;  3AZL A;  2ZY5 A;  3MGP D;  1P3L B;  5F99 D;  1P3A A;  3UTA D;  5B40 D;  3MGP C;  5CHL B;  3UT9 A;  5B40 C;  1P34 A;  4XUJ B;  4KUD D;  3AN2 A;  2XD1 A;  5B31 B;  5CPI D;  1M1A C;  5FUG A;  5BT1 D;  3TU4 D;  1TAF B;  5CPI C;  5B33 A;  3AL0 C;  3EPJ A;  5BT1 C;  5AVC B;  4DRA A;  3B6G A;  3AV1 A;  1TZY B;  2FJ7 C;  5GSU A;  4ZUX D;  3AZK B;  2NZD B;  3REH D;  5B0Y D;  3X1V C;  3KWQ C;  3KUY D;  3REK C;  5B2I B;  1P3O B;  5B2J D;  3H0R C;  5B1L B;  3UTB C;  3KUY C;  3LZ0 B;  4YM6 B;  4Z2M G;  5B2J C;  2J8P A;  5B24 A;  1P3B A;  4Z5T C;  3MGQ D;  5CP6 B;  1AOI A;  3REI D;  3W96 B;  5B0Z C;  3AZH A;  1EQZ B;  3AZL B;  2Y2K A;  2ARO B;  3C1B A;  1P3A B;  1P3G B;  3R45 A;  4G91 B;  1M18 D;  1P34 B;  1P3F C;  2ZY2 A;  3WAA A; 
#chains in the Genus database with same CATH homology
 2CV5 C;  5B33 B;  1P3M D;  3AV2 B;  3AZG B;  3MGR D;  3F6T A;  4XZQ C;  1P3M C;  5GSU B;  4J8U B;  4LD9 A;  4EO5 C;  1P3K C;  3LZ1 C;  4H9O B;  5AV5 D;  2VQR A;  5GT3 D;  4X23 D;  4WU9 C;  2HUE C;  5AV5 C;  1S32 C;  4AWL C;  4X23 C;  1KX5 D;  4J8V A;  5JRG A;  4JJN B;  3X1T A;  3FDD A;  1AOI B;  3AZH B;  3WA9 D;  4H9N A;  3WKJ A;  3X1S B;  4HGA C;  3REJ A;  2XD5 A;  3C1B B;  3REL B;  4NFT A;  3MGS C;  3V9R A;  3AZM B;  5CPJ C;  1KX3 B;  1A7W A;  2Y2O A;  2RIQ A;  4DRB A;  1ULY A;  3MGP A;  5F99 A;  5B24 D;  3UTA A;  5B40 A;  4R8P D;  3W97 B;  5B32 D;  3AZN D;  4R8P C;  3WTP C;  4ZBJ C;  4QLC B;  4KUD A;  2YFV A;  5CPI A;  2BYK A;  2NQB C;  5B32 G;  3TU4 A;  1ZLA C;  2HIO C;  3AZJ D;  5KDM B;  1U35 D;  4NE3 A;  3AFA C;  4H9R A;  3AZF C;  3AYW C;  1R4V A;  3X1V A;  2ZY3 A;  4ZUX A;  3LJA C;  5AV6 D;  5B0Y A;  3X1T B;  4KGC C;  1HQ3 B;  3KUY A;  5AV6 C;  5B2J A;  4H9N B;  3WKJ B;  5GXQ D;  3REJ B;  1P3I C;  4Z5T A;  1M19 B;  2F8N H;  2BG1 A;  3B6F D;  4YS3 B;  3MGQ A;  1F66 D;  3V9R B;  3REI A;  3B6F C;  1M19 D;  1F66 C;  2ZY4 A;  3EPH A;  3AZI D;  5CPK D;  5DNM B;  4UUZ A;  5F99 B;  1B6W A;  2G5I C;  3UTA B;  5JRG D;  1Z2C B;  1M18 A;  2JSS A;  1BH8 A;  5DNN C;  2IO5 C;  5E5A C;  4WNN B;  4KUD B;  1KU5 A;  3MVD C;  5B1M C;  4CAY B;  2BYK B;  3A6N D;  3O62 B;  4J8W C;  3TU4 B;  1P3M A;  3A6N C;  4H9Q A;  3MGR A;  1WWI A;  4H9P A;  3W98 D;  2Y2M A;  3W98 C;  4ZUX B;  3REH B;  5B0Y B;  1P3P C;  2PYO B;  1BH9 A;  3KXB B;  5G49 A;  5AV5 A;  1S32 A;  5GT3 A;  4X23 A;  1KX5 A;  3W99 C;  1M1A D;  2RVQ C;  3MGQ B;  4Z66 C;  3REI B;  5AV8 D;  3LEL B;  2FJ7 D;  3WA9 A;  3X1U B;  5AV8 C;  3VH6 A;  3WTP E;  1KX4 D;  5AY8 D;  5BS7 A;  3KWQ D;  3X1V D;  1KX4 C;  4WV4 B;  5AY8 C;  3REK D;  1M18 B;  3A1I A;  3UTB D;  3AZE B;  3B0C T;  4Z5T D;  4R8P A;  4H9Q B;  5B32 A;  3MGR B;  3AZN A;  1ID3 D;  1WWS A;  5B0Z D;  5C3I C;  3MNN C;  4CSR A;  1ID3 C;  4M6B A;  1ZLA A;  3H0M C;  3O62 C;  5AV9 D;  1BH9 B;  3AZJ A;  5GT0 D;  5G49 B;  1U35 A;  4WU8 C;  5GT3 B;  5AV9 C;  3C1C C;  1P3F D;  5GT0 C;  3UT9 B;  3B0D B;  2G5H C;  1KX5 B;  5AVB C;  3AN2 B;  2CV5 D;  4KGC A;  4Z2M H;  5AV6 A;  4J8X C;  2Y2G A;  5FUG B;  1P3L C;  4XZQ D;  3WA9 B;  2F8N A;  5GXQ A;  3B6G B;  3AV1 B;  1P3K D;  4XUJ C;  3B6F A;  3LZ1 D;  5B31 C;  1F66 A;  1M19 A;  4WU9 D;  3AZI A;  1S32 D;  5AVC C;  5CPK A;  3B0B A;  1TZY C;  5B24 B;  5DNN A;  1P3B B;  5B32 B;  3AZN B;  2ZM5 A;  4KHA A;  3AZK C;  5B2I D;  2NZD C;  4CSR B;  5B2I C;  1P3O C;  3A6N A;  5B1L C;  2Y2Q A;  3LZ0 C;  4YM6 C;  3AZJ B;  3MGS D;  1U35 B;  1F1E A;  5CPJ D;  3W96 D;  3R45 B;  4H9S A;  3W98 A;  5CP6 C;  3W96 C;  2UWX A;  5BNV A;  2ARO D;  3WAA B;  4G92 B;  3IP4 C;  1EQZ C;  3AZL C;  2ARO C;  1P3G D;  1P3A C;  3WTP D;  1P3G C;  5GXQ B;  3W99 A;  3NQJ A;  4G91 C;  3H0L C;  1P34 C;  1M1A A;  2NQB D;  1ZLA D;  4LD9 B;  1N1J A;  2HIO D;  3AV2 D;  5AV8 A;  1W2E A;  2W8S A;  4NE6 A;  3AFA D;  5B33 C;  3AV2 C;  3AYW D;  3AZF D;  3AZG C;  3AZI B;  2FJ7 A;  4J8U D;  1KX4 A;  5AY8 A;  3LJA D;  5GSU C;  5JRG B;  3KWQ A;  4J8U C;  4J8V B;  4KGC D;  5BNX A;  3REK A;  3UTB A;  2F8N D;  1P3I D;  2Y2N A;  4JJN D;  1ID3 A;  5B0Z A;  2Y2H A;  4JJN C;  2F8N G;  2JE5 A;  1AOI C;  3X1S D;  3AZH C;  3X1S C;  4E45 A;  5JA4 A;  5AV9 A;  3MGP B;  3C1C A;  5GT0 A;  3C1B C;  3REL C;  5E5A D;  5DNN D;  5B40 B;  1P3F A;  3AZM D;  3MVD D;  4DQY B;  5B1M D;  1KX3 D;  3AZM C;  2CV5 A;  4J8W D;  4WZS B;  1M1A B;  2YFV B;  5CPI B;  1KX3 C;  3W97 D;  4XZQ A;  2FJ7 B;  3W97 C;  4QLC D;  4H9R B;  1P3K A;  4QLC C;  3KWQ B;  3X1V B;  1P3P D;  3LZ1 A;  3REK B;  1PZR A;  5AVC A;  2Y2P A;  3UTB B;  3KUY B;  4WU9 A;  2JCH A;  5B2J B;  3W99 D;  5BO0 A;  4Z5T B;  2RVQ D;  4Z66 D;  3NQU A;  1HQ3 D;  3EG5 B;  5B0Z B;  5B2I A;  3X1T C;  2YFW A;  1HQ3 C;  2Y2L A;  3WKJ C;  4UUZ B;  3MGS A;  3REJ C;  4YS3 D;  1P3F B;  5CPJ A;  3W96 A;  4YS3 C;  3VH5 W;  1BH8 B;  2CV5 B;  2ARO A;  1JFI A;  5DNM D;  1P3G A;  5DNM C;  4XZQ B;  1P3M B;  2Y2I A;  5F99 C;  3UTA C;  3WTP A;  3MNN D;  4H9P B;  4EO5 B;  1P3K B;  4KUD C;  2NQB A;  3O62 D;  2HIO A;  3LZ1 B;  3AV2 A;  3AZG A;  3TU4 C;  4WU8 D;  3C1C D;  3AFA A;  4WU9 B;  2HUE B;  3AYW A;  3AZF A;  5AV5 B;  1S32 B;  4AWL B;  4X23 B;  3EPL A;  5AVB D;  4J8U A;  4UPK A;  5BO0 B;  2L5A A;  3LJA A;  4J8X D;  2PYO D;  3NQU B;  4ZUX C;  4H9O A;  3KXB D;  1P3L D;  3REH C;  5B0Y C;  2PYO C;  2YFW B;  4HGA B;  3KXB C;  1P3I A;  4XUJ D;  3MGS B;  5B31 D;  2DQN C;  4JJN A;  5CPJ B;  3LEL D;  3VH6 W;  3MGQ C;  4WJ3 C;  3X1S A;  5AVC D;  3X1U D;  3LEL C;  3REI C;  1TZY D;  5B31 G;  1JFI B;  2F8N K;  3X1U C;  3REL A;  5E5A A;  4R8P B;  3AZK D;  2NZD D;  3WTP B;  3AZM A;  4ZBJ B;  3MVD A;  3AZE D;  5B1M A;  1M18 C;  1P3O D;  1KX3 A;  1BFM A;  5B1L D;  4J8W A;  2NQB B;  3AZE C;  1ZLA B;  3LZ0 D;  4YM6 D;  2HIO B;  3W97 A;  3AFA B;  3P5J B;  3AYW B;  3AZF B;  5CP6 D;  4QLC A;  2BYM A;  3MGR C;  1HTA A;  3LJA B;  1P3P A;  1EQZ D;  3AZL D;  4KGC B;  4E44 A;  5AV6 B;  5KDM A;  1P3A D;  3A1K A;  3KSY A;  3UT9 D;  2F8N B;  1P3I B;  5GT3 C;  1P34 D;  3UT9 C;  3AN2 D;  3B0D C;  1KX5 C;  4Z66 A;  2F2A C;  3AN2 C;  3B6F B;  1HQ3 A;  5B33 D;  1F66 B;  3AZG D;  3B6G D;  2DF4 C;  3AV1 D;  3WA9 C;  5CPK B;  3B6G C;  5GSU D;  3AV1 C;  3B0C W;  4YS3 A;  5E5A B;  2IO5 B;  5DNN B;  5BS7 C;  3MVD B;  4KHA B;  5B1M B;  4J8W B;  1H3O A;  5DNM A;  3A6N B;  1P3B D;  5B24 C;  3VH5 T;  3MNN A;  1P3B C;  4WNN A;  5B32 C;  2BYM B;  1T3U A;  3AZN C;  1AOI D;  3AZH D;  4CAY A;  3W98 B;  5BNV B;  2Y2J A;  3O62 A;  1P3P B;  3KFU G;  3C1B D;  3REL D;  4WU8 A;  3AZJ C;  1B67 A;  1U35 C;  5AVB A;  3W99 B;  3NQJ B;  3WAA D;  4J8X A;  3REH A;  4Z66 B;  2PYO A;  1N1J B;  3WAA C;  3KXB A;  1P3L A;  4NE5 A;  4G92 C;  5AV8 B;  2CWE A;  4XUJ A;  5GXQ C;  3EPK A;  1KX4 B;  5B31 A;  4LD9 D;  5AY8 B;  1TAF A;  4LD9 C;  3LEL A;  5BNX B;  3X1U A;  3VH5 A;  1M19 C;  1TZY A;  1H3O B;  3AZI C;  5CPK C;  4J8V D;  3AZK A;  2NZD A;  3X1T D;  2FFF B;  5C3I B;  3VH6 T;  5JRG C;  3MNN B;  4J8V C;  1ID3 B;  3AZE A;  1P3O A;  1Q9C A;  5B1L A;  3WKJ D;  3LZ0 A;  4YM6 A;  3REJ D;  2LY8 A;  4WU8 B;  5JA4 B;  5AV9 B;  3C1C B;  5GT0 B;  5CP6 A;  5AVB B;  4H9S C;  1EQZ A;  4J8X B;  3AZL A;  2ZY5 A;  3MGP D;  1P3L B;  5F99 D;  1P3A A;  3UTA D;  5B40 D;  3MGP C;  5CHL B;  3UT9 A;  5B40 C;  1P34 A;  4XUJ B;  4KUD D;  3AN2 A;  2XD1 A;  5B31 B;  5CPI D;  1M1A C;  5FUG A;  5BT1 D;  3TU4 D;  1TAF B;  5CPI C;  5B33 A;  3AL0 C;  3EPJ A;  5BT1 C;  5AVC B;  4DRA A;  3B6G A;  3AV1 A;  1TZY B;  2FJ7 C;  5GSU A;  4ZUX D;  3AZK B;  2NZD B;  3REH D;  5B0Y D;  3X1V C;  3KWQ C;  3KUY D;  3REK C;  5B2I B;  1P3O B;  5B2J D;  3H0R C;  5B1L B;  3UTB C;  3KUY C;  3LZ0 B;  4YM6 B;  4Z2M G;  5B2J C;  2J8P A;  5B24 A;  1P3B A;  4Z5T C;  3MGQ D;  5CP6 B;  1AOI A;  3REI D;  3W96 B;  5B0Z C;  3AZH A;  1EQZ B;  3AZL B;  2Y2K A;  2ARO B;  3C1B A;  1P3A B;  1P3G B;  3R45 A;  4G91 B;  1M18 D;  1P34 B;  1P3F C;  2ZY2 A;  3WAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...