1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/virus/dna
molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
1P3PB 3AZMC 5F99D 3LZ0C 5AV6B 2NQBA 5B2JD 3AYWA 3AV2B 3B0BA 1P3AD 3MNNB 1ID3B 4YM6B 2L5AA 1F66B 5B32C 3AN2C 1KX3B 4H9PA 3WAAD 4J8UA 1TZYD 1P3OC 1P3IB 3UTAB 2AROD 4Z5TD 5B1LC 3REHB 5GT3D 4JJNA 1P3GA 2PYOC 4J8VD 3C1CB 3O62D 3MGQB 1P3MD 1M19B 4Z2MG 4X23C 1EQZD 2PYOA 4NE6A 5JRGB 3W99C 1P3FB 5AY8B 4CSRA 3A6NB 3MNND 3X1TA 4UUZA 3REKB 1ID3D 1HQ3C 5B40C 5CPKB 5B1MA 2YFVB 4H9QB 5B31B 1P3KC 2AROC 4Z5TC 4H9RA 4ZUXA 1P3ID 3W98A 3X1SA 4XZQD 3REHD 4WZSB 1B67A 1HQ3A 3O62C 5GSUB 4G92B 5AVCA 4ZBJC 5DNNC 3RELB 5B33C 3AZHB 3AV1B 1P3PC 5BT1D 4M6BA 5FUGA 3MGSD 5AV6C 4YS3A 5AY8D 1BFMA 3AV2C 3V9RB 1ID3C 4YM6C 1F66C 4XUJC 2F8NG 5AV6A 1KX3C 5AV9D 3AZGD 3KUYA 4QLCA 3UTAC 4YM6A 5B2IA 2F8NA 3UT9A 2HIOA 3AZJA 4XUJA 2YFWA 3C1CC 3AZNB 5GSUD 3MGQC 3KWQC 1M19C 3LELB 1S32B 1KU5A 1P3LA 1KX5B 3X1VD 3REIB 4KUDB 3WTPA 5JRGC 1KX4A 1M18D 4WU8A 3MGQA 1P3FC 3KWQA 2NZDA 4J8WD 5CP6B 3VH5W 5CPIB 5AVBD 3AZKB 4WNNB 1AOIA 3A6NC 3REKC 3VH5T 3UTBB 3MGPA 2CV5A 1P34D 5CPKC 4EO5B 5B31C 5B0ZB 3REKA 3AZLC 1A7WA 3WKJB 3WTPE 4KGCD 1ULYA 3LZ1A 3C1BB 3AZND 3KXBA 5CPKA 2YFVA 4G92C 1B6WA 1S32D 4Z66B 3AZHC 4NE5A 3RELC 3W97B 3W96A 3AZLA 3AV1C 4LD9D 5F99B 5JA4B 5CPID 3RELA 3AZKD 5B2JB 1JFIA 1ZLAD 4CAYB 3X1UC 3LJAD 3WAAB 5GXQB 5BNXB 1TZYB 4WU9D 1H3OB 5B0ZD 2HUEB 5AV5B 5GT3B 3WKJD 3B6FC 1BH9B 3X1UA 2BYKB 4J8VB 3AZNC 3C1BD 5G49B 3LELC 3AZIB 3AYWD 1P3MB 3W97D 4Z66D 1KX5C 1P3BA 3REIC 4KUDC 5E5AA 1EQZB 3NQJB 4DRAA 3MGRA 3B0CT 3B6FA 4Z2MH 4R8PA 3B6GA 5CP6C 1P3GD 3AZKC 3VH6A 4JJND 3REIA 4J8XA 1TAFB 3UTBC 3AZMA 5CPJC 2CWEA 3AZFC 3REJB 3LZ0A 3WA9B 5GXQD 5B32G 5BO0B 5AV5D 4XZQB 3WKJC 4DRBA 5KDMA 5CPJA 5B32A 3AZFA 3AN2A 3C1BC 3AZID 3W97C 1P3OA 3X1TD 5B1LA 5F99C 5B1MD 3MGSB 4ZUXD 3NQUB 2LY8A 3X1SD 5B2JC 4AWLB 4X23A 4H9NB 4HGAB 1P3AC 5BNVB 4NE3A 3W99A 2BYMB 5AVCD 3REJD 5AV9B 3WAAC 3AZGB 3WA9D 1TZYC 3AFAB 2HUEC 1BH8A 5AV5C 1P3AA 5GT3C 2F8NH 4YS3D 4J8VC 5B40A 5BNXA 3AZIC 1P3MC 3R45B 1H3OA 1P3KA 3X1VB 2AROA 4Z5TA 1EQZC 4H9OA 1M18B 3O62A 3KUYD 4QLCD 4J8WB 2F8ND 5AVBB 5B33A 2IO5B 2HIOD 2RVQD 5DNNA 3UT9D 3AZJD 2F8NK 3MNNC 1P3PA 1P34B 1P3LD 3REJC 4KHAB 3WA9C 5BS7C 3WTPD 3TU4B 1KX4D 3AFAD 3AV2A 1WWSA 1P3IC 4WU8D 3MNNA 4XZQC 3REHC 1ID3A 1F66A 4KGCB 1KX3A 1U35B 5B0YD 1AOID 2FJ7D 2CV5D 3MGPD 3UTAA 1P3IA 3REHA 3AZEB 4LD9B 5BT1C 3C1CA 3MGSC 1M19A 4AWLC 5AY8C 5AV8B 4HGAC 5GT0D 5JRGA 3KXBD 1P3FA 1ZLAB 5AV9C 1N1JB 3AZGC 3LJAB 5AY8A 5DNMB 3TU4D 4WU9B 3A6NA 5B31G 2NQBB 5GSUC 1U35D 3AYWB 4H9QA 5B31A 3MVDD 3X1VC 3VH6T 3AZED 1M18C 4H9PB 4J8UB 5GSUA 5B24D 4J8WC 5AVBC 3AZHA 2IO5C 5AV8D 4JJNB 1P3GB 1Q9CA 1M1AD 3AV1A 1P34C 3B0DB 5E5AD 5DNMD 3V9RA 4R8PD 4KGCC 4KHAA 2NQBD 4CSRB 4J8XD 1S32C 3B0CW 3X1TB 4UUZB 3AZMD 4LD9C 3LZ0D 4J8UD 3AZNA 5B1MB 3LELA 1S32A 5CPIC 4ZUXB 4H9RB 3W98B 5AV8C 1KX5A 3X1SB 4KUDA 1HQ3B 3AN2D 1ZLAC 5AVCB 3VH5A 5CP6A 3LJAC 5CPIA 5B1LD 5DNMC 4EO5C 3AZKA 2PYOD 4WU9C 4WNNA 5B0ZC 3UTBA 5FUGB 4YS3B 1ZLAA 2NQBC 3AYWC 4Z66C 5B0ZA 3W99D 3WKJA 4J8UC 3C1BA 1F1EA 3KUYB 3W97A 4QLCB 4Z66A 1P3GC 3W98D 4JJNC 2F8NB 5B2IB 3UT9B 2HIOB 3AZJB 4XUJB 1HQ3D 2YFWB 5B40D 4E45A 3B0DC 5F99A 1P3LB 5JA4A 1P3KD 5GXQC 3WTPB 5B2JA 1KX4B 4WU8B 1HTAA 3KWQB 2NZDB 4CAYA 5B33D 5DNND 3WAAA 5GXQA 1TZYA 5B0YB 1AOIB 3X1TC 2FJ7B 1P3PD 2CV5B 3MGPB 5AV5A 5GT3A 5AV6D 1BH9A 4J8VA 2BYKA 5B1MC 5G49A 3AZIA 1P3MA 3AV2D 4ZUXC 3W98C 3X1SC 4YM6D 5B2ID 4E44A 1F66D 1EQZA 5GT0B 3NQJA 4XUJD 1KX3D 3LZ1B 3KXBB 5AVCC 3W96B 3UTAD 3AZLB 1TAFA 3C1CD 5C3IB 3MGQD 4YS3C 3KWQD 1M19D 2NZDD 3REJA 3WA9A 5BS7A 5JRGD 3MVDB 5BO0A 1JFIB 4WV4B 4XZQA 1P3FD 2JSSA 3KUYC 4QLCC 5B24B 3A6ND 5B2IC 3REKD 2HIOC 2RVQC 3UT9C 3AZJC 3X1UB 1M1AB 3LZ1D 5CPKD 1P3LC 3MGSA 5B31D 1P3BB 3W96D 3NQUA 5E5AB 3WTPC 1R4VA 3AZLD 1KX4C 4H9NA 3AFAC 3MGRB 3B6FB 4WU8C 5BNVA 4R8PB 3B6GB 2NZDC 2BYMA 3AZHD 3RELD 5AV9A 3VH6W 3AZGA 4G91B 5B0YC 4J8XB 1AOIC 2FJ7C 3AV1D 3AFAA 2CV5C 3MGPC 3AZMB 3LZ0B 3KSYA 5B0YA 3R45A 2FJ7A 3X1VA 5KDMB 5GT0C 5CPJB 5B32B 3X1UD 3AZFB 3LZ1C 3AN2B 1M18A 3KXBC 4H9SC 1P3OB 3W96C 1P3BD 4J8WA 5AVBA 5B1LB 2PYOB 3TU4C 5GT0A 3MGRD 3B6FD 5C3IC 1P34A 3B6GD 3LELD 4H9SA 1KX5D 4NFTA 3REID 1U35C 4X23B 4KUDD 3TU4A 3MVDC 3AZEC 3W99B 5CP6D 4KGCA 1U35A 5B24C 1BH8B 3MVDA 1P3AB 3UTBD 3AZEA 5CPJD 1M1AC 5B32D 1WWIA 5B40B 3AZFD 4LD9A 1P3BC 5B24A 1P3OD 1P3KB 2AROB 4Z5TB 5E5AC 5AV8A 4H9OB 5CHLB 3MGRC 1M1AA 4R8PC 3O62B 3B6GC 1N1JA 4ZBJB 5DNNB 5B33B 4G91C 3LJAA 4X23D 4J8XC 5DNMA 4WU9A
chains in the Genus database with same CATH superfamily
1P3PB 3AZMC 5F99D 3LZ0C 5AV6B 2NQBA 5B2JD 3AYWA 3AV2B 3B0BA 1P3AD 3MNNB 1ID3B 4YM6B 2L5AA 1F66B 5B32C 3AN2C 1KX3B 4H9PA 3WAAD 4J8UA 1TZYD 1P3OC 1P3IB 3UTAB 2AROD 4Z5TD 5B1LC 3REHB 5GT3D 4JJNA 1P3GA 2PYOC 4J8VD 4WJ3C 3C1CB 3O62D 3F6TA 3MGQB 1P3MD 1M19B 4Z2MG 4X23C 2Y2GA 1EQZD 2PYOA 4NE6A 5JRGB 2G5HC 3W99C 1P3FB 5AY8B 4CSRA 3A6NB 3MNND 3X1TA 4UUZA 3REKB 1ID3D 1HQ3C 5B40C 5CPKB 5B1MA 2YFVB 4H9QB 5B31B 1P3KC 2AROC 4Z5TC 4H9RA 4ZUXA 1P3ID 3W98A 3X1SA 4XZQD 3REHD 4WZSB 1B67A 1HQ3A 3O62C 5GSUB 4G92B 5AVCA 4ZBJC 5DNNC 3RELB 5B33C 3AZHB 3AV1B 1P3PC 5BT1D 4M6BA 5FUGA 3MGSD 5AV6C 4YS3A 5AY8D 2RIQA 1BFMA 3AV2C 3V9RB 2J8PA 1ID3C 4YM6C 1F66C 4XUJC 2F8NG 5AV6A 1KX3C 5AV9D 3AZGD 2Y2MA 3KUYA 4QLCA 3UTAC 3P5JB 4YM6A 5B2IA 2ZY5A 3UT9A 2HIOA 3AZJA 2F8NA 4XUJA 2YFWA 3C1CC 3AZNB 5GSUD 3MGQC 3KWQC 1M19C 3LELB 1S32B 1KU5A 1P3LA 2ZY3A 1KX5B 3X1VD 3REIB 4KUDB 3WTPA 5JRGC 1KX4A 1M18D 4WU8A 3MGQA 1P3FC 3KWQA 2NZDA 4J8WD 5CP6B 3VH5W 5CPIB 5AVBD 3AZKB 3EG5B 4WNNB 1AOIA 3A6NC 3REKC 3VH5T 3UTBB 3MGPA 2CV5A 1P34D 5CPKC 4EO5B 5B31C 5B0ZB 1PZRA 3REKA 3AZLC 1A7WA 3WKJB 3WTPE 4KGCD 1ULYA 3LZ1A 3C1BB 3AZND 3KXBA 5CPKA 2YFVA 4G92C 1B6WA 1S32D 4Z66B 3AZHC 4NE5A 3RELC 3W97B 3W96A 3AZLA 3AV1C 4LD9D 5F99B 3KFUG 5JA4B 5CPID 1W2EA 3RELA 3AZKD 5B2JB 1JFIA 1ZLAD 4CAYB 3X1UC 3LJAD 3H0LC 5GXQB 5BNXB 1TZYB 3WAAB 4WU9D 1H3OB 2Y2KA 2HUEB 5B0ZD 5AV5B 5GT3B 3WKJD 3B6FC 1BH9B 3X1UA 2BYKB 4J8VB 3AZNC 3C1BD 5G49B 3LELC 3AZIB 3AYWD 1P3MB 3W97D 2Y2HA 4Z66D 1KX5C 1P3BA 3REIC 4KUDC 5E5AA 1EQZB 3NQJB 4DRAA 3MGRA 3B0CT 3B6FA 2Y2IA 4Z2MH 4R8PA 3B6GA 5CP6C 1P3GD 3AZKC 3VH6A 4JJND 3REIA 4J8XA 1TAFB 3UTBC 3AZMA 3FDDA 5CPJC 2CWEA 3AZFC 3REJB 3LZ0A 3WA9B 5GXQD 5B32G 5BO0B 5AV5D 4XZQB 3WKJC 4DRBA 5KDMA 5CPJA 5B32A 3AZFA 3AN2A 3C1BC 3AZID 3W97C 1P3OA 3X1TD 5B1LA 3EPJA 3EPLA 5F99C 5B1MD 3MGSB 4ZUXD 3NQUB 2LY8A 3X1SD 5B2JC 4AWLB 4X23A 4H9NB 4HGAB 1P3AC 5BNVB 4NE3A 3W99A 2BYMB 5AVCD 3REJD 5AV9B 3WAAC 3AZGB 3WA9D 1TZYC 3AFAB 2HUEC 1BH8A 5AV5C 1P3AA 5GT3C 2F8NH 4YS3D 4J8VC 5B40A 5BNXA 3AZIC 1P3MC 3R45B 1H3OA 1P3KA 3X1VB 2AROA 4Z5TA 1EQZC 4H9OA 1M18B 3O62A 3KUYD 4QLCD 2FFFB 4J8WB 2F8ND 5AVBB 5B33A 2IO5B 2HIOD 2RVQD 5DNNA 4UPKA 3UT9D 3AZJD 2F8NK 3MNNC 1P3PA 1P34B 1P3LD 3REJC 4KHAB 3WA9C 5BS7C 1Z2CB 3WTPD 3TU4B 1KX4D 3AFAD 3AV2A 1WWSA 1P3IC 4WU8D 3MNNA 4XZQC 3REHC 1ID3A 1F66A 2BG1A 4KGCB 2Y2LA 1KX3A 1U35B 5B0YD 1AOID 2FJ7D 2CV5D 3MGPD 3UTAA 1P3IA 3REHA 3AZEB 4LD9B 5BT1C 3C1CA 3MGSC 1M19A 4AWLC 5AY8C 5AV8B 4HGAC 5GT0D 5JRGA 3KXBD 3A1IA 2VQRA 1P3FA 1ZLAB 2Y2JA 5AV9C 1N1JB 3AZGC 3LJAB 5AY8A 5DNMB 3EPHA 3TU4D 4WU9B 3A6NA 5B31G 2XD5A 2DQNC 2NQBB 5GSUC 1U35D 3AYWB 4H9QA 5B31A 3MVDD 3X1VC 2G5IC 3VH6T 3AZED 1M18C 4DQYB 4H9PB 4J8UB 5GSUA 5B24D 4J8WC 5AVBC 3AZHA 2IO5C 5AV8D 4JJNB 1P3GB 1Q9CA 1M1AD 3AV1A 1P34C 3B0DB 5E5AD 5DNMD 3V9RA 4R8PD 4KGCC 4KHAA 2NQBD 4CSRB 4J8XD 1S32C 3B0CW 3X1TB 4UUZB 3AZMD 4LD9C 3LZ0D 4J8UD 3AZNA 5B1MB 3LELA 1S32A 2F2AC 5CPIC 4ZUXB 4H9RB 3W98B 5AV8C 2Y2PA 3X1SB 1KX5A 4KUDA 1HQ3B 3AN2D 1ZLAC 5AVCB 3VH5A 5CP6A 3LJAC 5CPIA 2JE5A 5B1LD 5DNMC 4EO5C 3AZKA 2PYOD 4WU9C 4WNNA 5B0ZC 3UTBA 5FUGB 4YS3B 1ZLAA 2NQBC 3AYWC 4Z66C 5B0ZA 3W99D 2ZM5A 3WKJA 4J8UC 3C1BA 1F1EA 3KUYB 3W97A 4QLCB 4Z66A 1P3GC 3W98D 4JJNC 2F8NB 5B2IB 3UT9B 2HIOB 3AZJB 4XUJB 1HQ3D 2YFWB 5B40D 4E45A 3B0DC 5F99A 1P3LB 1T3UA 5JA4A 1P3KD 5GXQC 3WTPB 5B2JA 1KX4B 4WU8B 1HTAA 3KWQB 2NZDB 4CAYA 5B33D 5DNND 2Y2QA 3WAAA 5GXQA 1TZYA 5B0YB 1AOIB 3X1TC 2FJ7B 1P3PD 2CV5B 3MGPB 2ZY4A 2ZY2A 5AV5A 5GT3A 5AV6D 1BH9A 4J8VA 2BYKA 5B1MC 2DF4C 5G49A 3AZIA 1P3MA 3AV2D 4ZUXC 3W98C 3X1SC 4YM6D 5B2ID 4E44A 1F66D 1EQZA 5GT0B 3NQJA 3H0RC 4XUJD 1KX3D 3LZ1B 3KXBB 5AVCC 3W96B 3UTAD 3AZLB 1TAFA 3C1CD 5C3IB 2JCHA 3MGQD 4YS3C 3KWQD 1M19D 2NZDD 2Y2NA 3REJA 3WA9A 5BS7A 5JRGD 3MVDB 5BO0A 1JFIB 2XD1A 4WV4B 4XZQA 1P3FD 2JSSA 3KUYC 4QLCC 5B24B 3A6ND 5B2IC 3REKD 2HIOC 2RVQC 3UT9C 3AZJC 3X1UB 1M1AB 3LZ1D 3AL0C 5CPKD 1P3LC 3MGSA 5B31D 1P3BB 2W8SA 3W96D 3NQUA 5E5AB 3WTPC 1R4VA 3AZLD 1KX4C 4H9NA 3AFAC 3MGRB 3B6FB 4WU8C 5BNVA 4R8PB 3B6GB 2NZDC 2BYMA 3AZHD 3RELD 5AV9A 3VH6W 3AZGA 4G91B 5B0YC 4J8XB 1AOIC 2FJ7C 3AV1D 3AFAA 2CV5C 3MGPC 3AZMB 3LZ0B 3KSYA 5B0YA 3R45A 2FJ7A 3X1VA 5KDMB 5GT0C 5CPJB 5B32B 3X1UD 3AZFB 3LZ1C 3AN2B 1M18A 3KXBC 2Y2OA 4H9SC 1P3OB 3W96C 1P3BD 4J8WA 5AVBA 5B1LB 2PYOB 3TU4C 5GT0A 3MGRD 3B6FD 5C3IC 1P34A 3B6GD 3LELD 4H9SA 1KX5D 4NFTA 3REID 1U35C 4X23B 4KUDD 2UWXA 3TU4A 3A1KA 3MVDC 3AZEC 3W99B 5CP6D 4KGCA 3IP4C 1U35A 5B24C 1BH8B 3MVDA 1P3AB 3UTBD 3AZEA 5CPJD 3EPKA 1M1AC 5B32D 1WWIA 5B40B 3AZFD 4LD9A 1P3BC 5B24A 1P3OD 1P3KB 2AROB 4Z5TB 5E5AC 5AV8A 4H9OB 3H0MC 5CHLB 3MGRC 1M1AA 4R8PC 3O62B 3B6GC 1N1JA 4ZBJB 5DNNB 5B33B 4G91C 3LJAA 4X23D 4J8XC 5DNMA 4WU9A
chains in the Genus database with same CATH topology
1P3PB 3AZMC 5F99D 3LZ0C 5AV6B 2NQBA 5B2JD 3AYWA 3AV2B 3B0BA 1P3AD 3MNNB 1ID3B 4YM6B 2L5AA 1F66B 5B32C 3AN2C 1KX3B 4H9PA 3WAAD 4J8UA 1TZYD 1P3OC 1P3IB 3UTAB 2AROD 4Z5TD 5B1LC 3REHB 5GT3D 4JJNA 1P3GA 2PYOC 4J8VD 4WJ3C 3C1CB 3O62D 3F6TA 3MGQB 1P3MD 1M19B 4Z2MG 4X23C 2Y2GA 1EQZD 2PYOA 4NE6A 5JRGB 2G5HC 3W99C 1P3FB 5AY8B 4CSRA 3A6NB 3MNND 3X1TA 4UUZA 3REKB 1ID3D 1HQ3C 5B40C 5CPKB 5B1MA 2YFVB 4H9QB 5B31B 1P3KC 2AROC 4Z5TC 4H9RA 4ZUXA 1P3ID 3W98A 3X1SA 4XZQD 3REHD 4WZSB 1B67A 1HQ3A 3O62C 5GSUB 4G92B 5AVCA 4ZBJC 5DNNC 3RELB 5B33C 3AZHB 3AV1B 1P3PC 5BT1D 4M6BA 5FUGA 3MGSD 5AV6C 4YS3A 5AY8D 2RIQA 1BFMA 3AV2C 3V9RB 2J8PA 1ID3C 4YM6C 1F66C 4XUJC 2F8NG 5AV6A 1KX3C 5AV9D 3AZGD 2Y2MA 3KUYA 4QLCA 3UTAC 3P5JB 4YM6A 5B2IA 2ZY5A 3UT9A 2HIOA 3AZJA 2F8NA 4XUJA 2YFWA 3C1CC 3AZNB 5GSUD 3MGQC 3KWQC 1M19C 3LELB 1S32B 1KU5A 1P3LA 2ZY3A 1KX5B 3X1VD 3REIB 4KUDB 3WTPA 5JRGC 1KX4A 1M18D 4WU8A 3MGQA 1P3FC 3KWQA 2NZDA 4J8WD 5CP6B 3VH5W 5CPIB 5AVBD 3AZKB 3EG5B 4WNNB 1AOIA 3A6NC 3REKC 3VH5T 3UTBB 3MGPA 2CV5A 1P34D 5CPKC 4EO5B 5B31C 5B0ZB 1PZRA 3REKA 3AZLC 1A7WA 3WKJB 3WTPE 4KGCD 1ULYA 3LZ1A 3C1BB 3AZND 3KXBA 5CPKA 2YFVA 4G92C 1B6WA 1S32D 4Z66B 3AZHC 4NE5A 3RELC 3W97B 3W96A 3AZLA 3AV1C 4LD9D 5F99B 3KFUG 5JA4B 5CPID 1W2EA 3RELA 3AZKD 5B2JB 1JFIA 1ZLAD 4CAYB 3X1UC 3LJAD 3H0LC 5GXQB 5BNXB 1TZYB 3WAAB 4WU9D 1H3OB 2Y2KA 2HUEB 5B0ZD 5AV5B 5GT3B 3WKJD 3B6FC 1BH9B 3X1UA 2BYKB 4J8VB 3AZNC 3C1BD 5G49B 3LELC 3AZIB 3AYWD 1P3MB 3W97D 2Y2HA 4Z66D 1KX5C 1P3BA 3REIC 4KUDC 5E5AA 1EQZB 3NQJB 4DRAA 3MGRA 3B0CT 3B6FA 2Y2IA 4Z2MH 4R8PA 3B6GA 5CP6C 1P3GD 3AZKC 3VH6A 4JJND 3REIA 4J8XA 1TAFB 3UTBC 3AZMA 3FDDA 5CPJC 2CWEA 3AZFC 3REJB 3LZ0A 3WA9B 5GXQD 5B32G 5BO0B 5AV5D 4XZQB 3WKJC 4DRBA 5KDMA 5CPJA 5B32A 3AZFA 3AN2A 3C1BC 3AZID 3W97C 1P3OA 3X1TD 5B1LA 3EPJA 3EPLA 5F99C 5B1MD 3MGSB 4ZUXD 3NQUB 2LY8A 3X1SD 5B2JC 4AWLB 4X23A 4H9NB 4HGAB 1P3AC 5BNVB 4NE3A 3W99A 2BYMB 5AVCD 3REJD 5AV9B 3WAAC 3AZGB 3WA9D 1TZYC 3AFAB 2HUEC 1BH8A 5AV5C 1P3AA 5GT3C 2F8NH 4YS3D 4J8VC 5B40A 5BNXA 3AZIC 1P3MC 3R45B 1H3OA 1P3KA 3X1VB 2AROA 4Z5TA 1EQZC 4H9OA 1M18B 3O62A 3KUYD 4QLCD 2FFFB 4J8WB 2F8ND 5AVBB 5B33A 2IO5B 2HIOD 2RVQD 5DNNA 4UPKA 3UT9D 3AZJD 2F8NK 3MNNC 1P3PA 1P34B 1P3LD 3REJC 4KHAB 3WA9C 5BS7C 1Z2CB 3WTPD 3TU4B 1KX4D 3AFAD 3AV2A 1WWSA 1P3IC 4WU8D 3MNNA 4XZQC 3REHC 1ID3A 1F66A 2BG1A 4KGCB 2Y2LA 1KX3A 1U35B 5B0YD 1AOID 2FJ7D 2CV5D 3MGPD 3UTAA 1P3IA 3REHA 3AZEB 4LD9B 5BT1C 3C1CA 3MGSC 1M19A 4AWLC 5AY8C 5AV8B 4HGAC 5GT0D 5JRGA 3KXBD 3A1IA 2VQRA 1P3FA 1ZLAB 2Y2JA 5AV9C 1N1JB 3AZGC 3LJAB 5AY8A 5DNMB 3EPHA 3TU4D 4WU9B 3A6NA 5B31G 2XD5A 2DQNC 2NQBB 5GSUC 1U35D 3AYWB 4H9QA 5B31A 3MVDD 3X1VC 2G5IC 3VH6T 3AZED 1M18C 4DQYB 4H9PB 4J8UB 5GSUA 5B24D 4J8WC 5AVBC 3AZHA 2IO5C 5AV8D 4JJNB 1P3GB 1Q9CA 1M1AD 3AV1A 1P34C 3B0DB 5E5AD 5DNMD 3V9RA 4R8PD 4KGCC 4KHAA 2NQBD 4CSRB 4J8XD 1S32C 3B0CW 3X1TB 4UUZB 3AZMD 4LD9C 3LZ0D 4J8UD 3AZNA 5B1MB 3LELA 1S32A 2F2AC 5CPIC 4ZUXB 4H9RB 3W98B 5AV8C 2Y2PA 3X1SB 1KX5A 4KUDA 1HQ3B 3AN2D 1ZLAC 5AVCB 3VH5A 5CP6A 3LJAC 5CPIA 2JE5A 5B1LD 5DNMC 4EO5C 3AZKA 2PYOD 4WU9C 4WNNA 5B0ZC 3UTBA 5FUGB 4YS3B 1ZLAA 2NQBC 3AYWC 4Z66C 5B0ZA 3W99D 2ZM5A 3WKJA 4J8UC 3C1BA 1F1EA 3KUYB 3W97A 4QLCB 4Z66A 1P3GC 3W98D 4JJNC 2F8NB 5B2IB 3UT9B 2HIOB 3AZJB 4XUJB 1HQ3D 2YFWB 5B40D 4E45A 3B0DC 5F99A 1P3LB 1T3UA 5JA4A 1P3KD 5GXQC 3WTPB 5B2JA 1KX4B 4WU8B 1HTAA 3KWQB 2NZDB 4CAYA 5B33D 5DNND 2Y2QA 3WAAA 5GXQA 1TZYA 5B0YB 1AOIB 3X1TC 2FJ7B 1P3PD 2CV5B 3MGPB 2ZY4A 2ZY2A 5AV5A 5GT3A 5AV6D 1BH9A 4J8VA 2BYKA 5B1MC 2DF4C 5G49A 3AZIA 1P3MA 3AV2D 4ZUXC 3W98C 3X1SC 4YM6D 5B2ID 4E44A 1F66D 1EQZA 5GT0B 3NQJA 3H0RC 4XUJD 1KX3D 3LZ1B 3KXBB 5AVCC 3W96B 3UTAD 3AZLB 1TAFA 3C1CD 5C3IB 2JCHA 3MGQD 4YS3C 3KWQD 1M19D 2NZDD 2Y2NA 3REJA 3WA9A 5BS7A 5JRGD 3MVDB 5BO0A 1JFIB 2XD1A 4WV4B 4XZQA 1P3FD 2JSSA 3KUYC 4QLCC 5B24B 3A6ND 5B2IC 3REKD 2HIOC 2RVQC 3UT9C 3AZJC 3X1UB 1M1AB 3LZ1D 3AL0C 5CPKD 1P3LC 3MGSA 5B31D 1P3BB 2W8SA 3W96D 3NQUA 5E5AB 3WTPC 1R4VA 3AZLD 1KX4C 4H9NA 3AFAC 3MGRB 3B6FB 4WU8C 5BNVA 4R8PB 3B6GB 2NZDC 2BYMA 3AZHD 3RELD 5AV9A 3VH6W 3AZGA 4G91B 5B0YC 4J8XB 1AOIC 2FJ7C 3AV1D 3AFAA 2CV5C 3MGPC 3AZMB 3LZ0B 3KSYA 5B0YA 3R45A 2FJ7A 3X1VA 5KDMB 5GT0C 5CPJB 5B32B 3X1UD 3AZFB 3LZ1C 3AN2B 1M18A 3KXBC 2Y2OA 4H9SC 1P3OB 3W96C 1P3BD 4J8WA 5AVBA 5B1LB 2PYOB 3TU4C 5GT0A 3MGRD 3B6FD 5C3IC 1P34A 3B6GD 3LELD 4H9SA 1KX5D 4NFTA 3REID 1U35C 4X23B 4KUDD 2UWXA 3TU4A 3A1KA 3MVDC 3AZEC 3W99B 5CP6D 4KGCA 3IP4C 1U35A 5B24C 1BH8B 3MVDA 1P3AB 3UTBD 3AZEA 5CPJD 3EPKA 1M1AC 5B32D 1WWIA 5B40B 3AZFD 4LD9A 1P3BC 5B24A 1P3OD 1P3KB 2AROB 4Z5TB 5E5AC 5AV8A 4H9OB 3H0MC 5CHLB 3MGRC 1M1AA 4R8PC 3O62B 3B6GC 1N1JA 4ZBJB 5DNNB 5B33B 4G91C 3LJAA 4X23D 4J8XC 5DNMA 4WU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P B;  3AZM C;  5F99 D;  3LZ0 C;  5AV6 B;  2NQB A;  5B2J D;  3AYW A;  3AV2 B;  3B0B A;  1P3A D;  3MNN B;  1ID3 B;  4YM6 B;  2L5A A;  1F66 B;  5B32 C;  3AN2 C;  1KX3 B;  4H9P A;  3WAA D;  4J8U A;  1TZY D;  1P3O C;  1P3I B;  3UTA B;  2ARO D;  4Z5T D;  5B1L C;  3REH B;  5GT3 D;  4JJN A;  1P3G A;  2PYO C;  4J8V D;  3C1C B;  3O62 D;  3MGQ B;  1P3M D;  1M19 B;  4Z2M G;  4X23 C;  1EQZ D;  2PYO A;  4NE6 A;  5JRG B;  3W99 C;  1P3F B;  5AY8 B;  4CSR A;  3A6N B;  3MNN D;  3X1T A;  4UUZ A;  3REK B;  1ID3 D;  1HQ3 C;  5B40 C;  5CPK B;  5B1M A;  2YFV B;  4H9Q B;  5B31 B;  1P3K C;  2ARO C;  4Z5T C;  4H9R A;  4ZUX A;  1P3I D;  3W98 A;  3X1S A;  4XZQ D;  3REH D;  4WZS B;  1B67 A;  1HQ3 A;  3O62 C;  5GSU B;  4G92 B;  5AVC A;  4ZBJ C;  5DNN C;  3REL B;  5B33 C;  3AZH B;  3AV1 B;  1P3P C;  5BT1 D;  4M6B A;  5FUG A;  3MGS D;  5AV6 C;  4YS3 A;  5AY8 D;  1BFM A;  3AV2 C;  3V9R B;  1ID3 C;  4YM6 C;  1F66 C;  4XUJ C;  2F8N G;  5AV6 A;  1KX3 C;  5AV9 D;  3AZG D;  3KUY A;  4QLC A;  3UTA C;  4YM6 A;  5B2I A;  2F8N A;  3UT9 A;  2HIO A;  3AZJ A;  4XUJ A;  2YFW A;  3C1C C;  3AZN B;  5GSU D;  3MGQ C;  3KWQ C;  1M19 C;  3LEL B;  1S32 B;  1KU5 A;  1P3L A;  1KX5 B;  3X1V D;  3REI B;  4KUD B;  3WTP A;  5JRG C;  1KX4 A;  1M18 D;  4WU8 A;  3MGQ A;  1P3F C;  3KWQ A;  2NZD A;  4J8W D;  5CP6 B;  3VH5 W;  5CPI B;  5AVB D;  3AZK B;  4WNN B;  1AOI A;  3A6N C;  3REK C;  3VH5 T;  3UTB B;  3MGP A;  2CV5 A;  1P34 D;  5CPK C;  4EO5 B;  5B31 C;  5B0Z B;  3REK A;  3AZL C;  1A7W A;  3WKJ B;  3WTP E;  4KGC D;  1ULY A;  3LZ1 A;  3C1B B;  3AZN D;  3KXB A;  5CPK A;  2YFV A;  4G92 C;  1B6W A;  1S32 D;  4Z66 B;  3AZH C;  4NE5 A;  3REL C;  3W97 B;  3W96 A;  3AZL A;  3AV1 C;  4LD9 D;  5F99 B;  5JA4 B;  5CPI D;  3REL A;  3AZK D;  5B2J B;  1JFI A;  1ZLA D;  4CAY B;  3X1U C;  3LJA D;  3WAA B;  5GXQ B;  5BNX B;  1TZY B;  4WU9 D;  1H3O B;  5B0Z D;  2HUE B;  5AV5 B;  5GT3 B;  3WKJ D;  3B6F C;  1BH9 B;  3X1U A;  2BYK B;  4J8V B;  3AZN C;  3C1B D;  5G49 B;  3LEL C;  3AZI B;  3AYW D;  1P3M B;  3W97 D;  4Z66 D;  1KX5 C;  1P3B A;  3REI C;  4KUD C;  5E5A A;  1EQZ B;  3NQJ B;  4DRA A;  3MGR A;  3B0C T;  3B6F A;  4Z2M H;  4R8P A;  3B6G A;  5CP6 C;  1P3G D;  3AZK C;  3VH6 A;  4JJN D;  3REI A;  4J8X A;  1TAF B;  3UTB C;  3AZM A;  5CPJ C;  2CWE A;  3AZF C;  3REJ B;  3LZ0 A;  3WA9 B;  5GXQ D;  5B32 G;  5BO0 B;  5AV5 D;  4XZQ B;  3WKJ C;  4DRB A;  5KDM A;  5CPJ A;  5B32 A;  3AZF A;  3AN2 A;  3C1B C;  3AZI D;  3W97 C;  1P3O A;  3X1T D;  5B1L A;  5F99 C;  5B1M D;  3MGS B;  4ZUX D;  3NQU B;  2LY8 A;  3X1S D;  5B2J C;  4AWL B;  4X23 A;  4H9N B;  4HGA B;  1P3A C;  5BNV B;  4NE3 A;  3W99 A;  2BYM B;  5AVC D;  3REJ D;  5AV9 B;  3WAA C;  3AZG B;  3WA9 D;  1TZY C;  3AFA B;  2HUE C;  1BH8 A;  5AV5 C;  1P3A A;  5GT3 C;  2F8N H;  4YS3 D;  4J8V C;  5B40 A;  5BNX A;  3AZI C;  1P3M C;  3R45 B;  1H3O A;  1P3K A;  3X1V B;  2ARO A;  4Z5T A;  1EQZ C;  4H9O A;  1M18 B;  3O62 A;  3KUY D;  4QLC D;  4J8W B;  2F8N D;  5AVB B;  5B33 A;  2IO5 B;  2HIO D;  2RVQ D;  5DNN A;  3UT9 D;  3AZJ D;  2F8N K;  3MNN C;  1P3P A;  1P34 B;  1P3L D;  3REJ C;  4KHA B;  3WA9 C;  5BS7 C;  3WTP D;  3TU4 B;  1KX4 D;  3AFA D;  3AV2 A;  1WWS A;  1P3I C;  4WU8 D;  3MNN A;  4XZQ C;  3REH C;  1ID3 A;  1F66 A;  4KGC B;  1KX3 A;  1U35 B;  5B0Y D;  1AOI D;  2FJ7 D;  2CV5 D;  3MGP D;  3UTA A;  1P3I A;  3REH A;  3AZE B;  4LD9 B;  5BT1 C;  3C1C A;  3MGS C;  1M19 A;  4AWL C;  5AY8 C;  5AV8 B;  4HGA C;  5GT0 D;  5JRG A;  3KXB D;  1P3F A;  1ZLA B;  5AV9 C;  1N1J B;  3AZG C;  3LJA B;  5AY8 A;  5DNM B;  3TU4 D;  4WU9 B;  3A6N A;  5B31 G;  2NQB B;  5GSU C;  1U35 D;  3AYW B;  4H9Q A;  5B31 A;  3MVD D;  3X1V C;  3VH6 T;  3AZE D;  1M18 C;  4H9P B;  4J8U B;  5GSU A;  5B24 D;  4J8W C;  5AVB C;  3AZH A;  2IO5 C;  5AV8 D;  4JJN B;  1P3G B;  1Q9C A;  1M1A D;  3AV1 A;  1P34 C;  3B0D B;  5E5A D;  5DNM D;  3V9R A;  4R8P D;  4KGC C;  4KHA A;  2NQB D;  4CSR B;  4J8X D;  1S32 C;  3B0C W;  3X1T B;  4UUZ B;  3AZM D;  4LD9 C;  3LZ0 D;  4J8U D;  3AZN A;  5B1M B;  3LEL A;  1S32 A;  5CPI C;  4ZUX B;  4H9R B;  3W98 B;  5AV8 C;  1KX5 A;  3X1S B;  4KUD A;  1HQ3 B;  3AN2 D;  1ZLA C;  5AVC B;  3VH5 A;  5CP6 A;  3LJA C;  5CPI A;  5B1L D;  5DNM C;  4EO5 C;  3AZK A;  2PYO D;  4WU9 C;  4WNN A;  5B0Z C;  3UTB A;  5FUG B;  4YS3 B;  1ZLA A;  2NQB C;  3AYW C;  4Z66 C;  5B0Z A;  3W99 D;  3WKJ A;  4J8U C;  3C1B A;  1F1E A;  3KUY B;  3W97 A;  4QLC B;  4Z66 A;  1P3G C;  3W98 D;  4JJN C;  2F8N B;  5B2I B;  3UT9 B;  2HIO B;  3AZJ B;  4XUJ B;  1HQ3 D;  2YFW B;  5B40 D;  4E45 A;  3B0D C;  5F99 A;  1P3L B;  5JA4 A;  1P3K D;  5GXQ C;  3WTP B;  5B2J A;  1KX4 B;  4WU8 B;  1HTA A;  3KWQ B;  2NZD B;  4CAY A;  5B33 D;  5DNN D;  3WAA A;  5GXQ A;  1TZY A;  5B0Y B;  1AOI B;  3X1T C;  2FJ7 B;  1P3P D;  2CV5 B;  3MGP B;  5AV5 A;  5GT3 A;  5AV6 D;  1BH9 A;  4J8V A;  2BYK A;  5B1M C;  5G49 A;  3AZI A;  1P3M A;  3AV2 D;  4ZUX C;  3W98 C;  3X1S C;  4YM6 D;  5B2I D;  4E44 A;  1F66 D;  1EQZ A;  5GT0 B;  3NQJ A;  4XUJ D;  1KX3 D;  3LZ1 B;  3KXB B;  5AVC C;  3W96 B;  3UTA D;  3AZL B;  1TAF A;  3C1C D;  5C3I B;  3MGQ D;  4YS3 C;  3KWQ D;  1M19 D;  2NZD D;  3REJ A;  3WA9 A;  5BS7 A;  5JRG D;  3MVD B;  5BO0 A;  1JFI B;  4WV4 B;  4XZQ A;  1P3F D;  2JSS A;  3KUY C;  4QLC C;  5B24 B;  3A6N D;  5B2I C;  3REK D;  2HIO C;  2RVQ C;  3UT9 C;  3AZJ C;  3X1U B;  1M1A B;  3LZ1 D;  5CPK D;  1P3L C;  3MGS A;  5B31 D;  1P3B B;  3W96 D;  3NQU A;  5E5A B;  3WTP C;  1R4V A;  3AZL D;  1KX4 C;  4H9N A;  3AFA C;  3MGR B;  3B6F B;  4WU8 C;  5BNV A;  4R8P B;  3B6G B;  2NZD C;  2BYM A;  3AZH D;  3REL D;  5AV9 A;  3VH6 W;  3AZG A;  4G91 B;  5B0Y C;  4J8X B;  1AOI C;  2FJ7 C;  3AV1 D;  3AFA A;  2CV5 C;  3MGP C;  3AZM B;  3LZ0 B;  3KSY A;  5B0Y A;  3R45 A;  2FJ7 A;  3X1V A;  5KDM B;  5GT0 C;  5CPJ B;  5B32 B;  3X1U D;  3AZF B;  3LZ1 C;  3AN2 B;  1M18 A;  3KXB C;  4H9S C;  1P3O B;  3W96 C;  1P3B D;  4J8W A;  5AVB A;  5B1L B;  2PYO B;  3TU4 C;  5GT0 A;  3MGR D;  3B6F D;  5C3I C;  1P34 A;  3B6G D;  3LEL D;  4H9S A;  1KX5 D;  4NFT A;  3REI D;  1U35 C;  4X23 B;  4KUD D;  3TU4 A;  3MVD C;  3AZE C;  3W99 B;  5CP6 D;  4KGC A;  1U35 A;  5B24 C;  1BH8 B;  3MVD A;  1P3A B;  3UTB D;  3AZE A;  5CPJ D;  1M1A C;  5B32 D;  1WWI A;  5B40 B;  3AZF D;  4LD9 A;  1P3B C;  5B24 A;  1P3O D;  1P3K B;  2ARO B;  4Z5T B;  5E5A C;  5AV8 A;  4H9O B;  5CHL B;  3MGR C;  1M1A A;  4R8P C;  3O62 B;  3B6G C;  1N1J A;  4ZBJ B;  5DNN B;  5B33 B;  4G91 C;  3LJA A;  4X23 D;  4J8X C;  5DNM A;  4WU9 A; 
#chains in the Genus database with same CATH topology
 1P3P B;  3AZM C;  5F99 D;  3LZ0 C;  5AV6 B;  2NQB A;  5B2J D;  3AYW A;  3AV2 B;  3B0B A;  1P3A D;  3MNN B;  1ID3 B;  4YM6 B;  2L5A A;  1F66 B;  5B32 C;  3AN2 C;  1KX3 B;  4H9P A;  3WAA D;  4J8U A;  1TZY D;  1P3O C;  1P3I B;  3UTA B;  2ARO D;  4Z5T D;  5B1L C;  3REH B;  5GT3 D;  4JJN A;  1P3G A;  2PYO C;  4J8V D;  4WJ3 C;  3C1C B;  3O62 D;  3F6T A;  3MGQ B;  1P3M D;  1M19 B;  4Z2M G;  4X23 C;  2Y2G A;  1EQZ D;  2PYO A;  4NE6 A;  5JRG B;  2G5H C;  3W99 C;  1P3F B;  5AY8 B;  4CSR A;  3A6N B;  3MNN D;  3X1T A;  4UUZ A;  3REK B;  1ID3 D;  1HQ3 C;  5B40 C;  5CPK B;  5B1M A;  2YFV B;  4H9Q B;  5B31 B;  1P3K C;  2ARO C;  4Z5T C;  4H9R A;  4ZUX A;  1P3I D;  3W98 A;  3X1S A;  4XZQ D;  3REH D;  4WZS B;  1B67 A;  1HQ3 A;  3O62 C;  5GSU B;  4G92 B;  5AVC A;  4ZBJ C;  5DNN C;  3REL B;  5B33 C;  3AZH B;  3AV1 B;  1P3P C;  5BT1 D;  4M6B A;  5FUG A;  3MGS D;  5AV6 C;  4YS3 A;  5AY8 D;  2RIQ A;  1BFM A;  3AV2 C;  3V9R B;  2J8P A;  1ID3 C;  4YM6 C;  1F66 C;  4XUJ C;  2F8N G;  5AV6 A;  1KX3 C;  5AV9 D;  3AZG D;  2Y2M A;  3KUY A;  4QLC A;  3UTA C;  3P5J B;  4YM6 A;  5B2I A;  2ZY5 A;  3UT9 A;  2HIO A;  3AZJ A;  2F8N A;  4XUJ A;  2YFW A;  3C1C C;  3AZN B;  5GSU D;  3MGQ C;  3KWQ C;  1M19 C;  3LEL B;  1S32 B;  1KU5 A;  1P3L A;  2ZY3 A;  1KX5 B;  3X1V D;  3REI B;  4KUD B;  3WTP A;  5JRG C;  1KX4 A;  1M18 D;  4WU8 A;  3MGQ A;  1P3F C;  3KWQ A;  2NZD A;  4J8W D;  5CP6 B;  3VH5 W;  5CPI B;  5AVB D;  3AZK B;  3EG5 B;  4WNN B;  1AOI A;  3A6N C;  3REK C;  3VH5 T;  3UTB B;  3MGP A;  2CV5 A;  1P34 D;  5CPK C;  4EO5 B;  5B31 C;  5B0Z B;  1PZR A;  3REK A;  3AZL C;  1A7W A;  3WKJ B;  3WTP E;  4KGC D;  1ULY A;  3LZ1 A;  3C1B B;  3AZN D;  3KXB A;  5CPK A;  2YFV A;  4G92 C;  1B6W A;  1S32 D;  4Z66 B;  3AZH C;  4NE5 A;  3REL C;  3W97 B;  3W96 A;  3AZL A;  3AV1 C;  4LD9 D;  5F99 B;  3KFU G;  5JA4 B;  5CPI D;  1W2E A;  3REL A;  3AZK D;  5B2J B;  1JFI A;  1ZLA D;  4CAY B;  3X1U C;  3LJA D;  3H0L C;  5GXQ B;  5BNX B;  1TZY B;  3WAA B;  4WU9 D;  1H3O B;  2Y2K A;  2HUE B;  5B0Z D;  5AV5 B;  5GT3 B;  3WKJ D;  3B6F C;  1BH9 B;  3X1U A;  2BYK B;  4J8V B;  3AZN C;  3C1B D;  5G49 B;  3LEL C;  3AZI B;  3AYW D;  1P3M B;  3W97 D;  2Y2H A;  4Z66 D;  1KX5 C;  1P3B A;  3REI C;  4KUD C;  5E5A A;  1EQZ B;  3NQJ B;  4DRA A;  3MGR A;  3B0C T;  3B6F A;  2Y2I A;  4Z2M H;  4R8P A;  3B6G A;  5CP6 C;  1P3G D;  3AZK C;  3VH6 A;  4JJN D;  3REI A;  4J8X A;  1TAF B;  3UTB C;  3AZM A;  3FDD A;  5CPJ C;  2CWE A;  3AZF C;  3REJ B;  3LZ0 A;  3WA9 B;  5GXQ D;  5B32 G;  5BO0 B;  5AV5 D;  4XZQ B;  3WKJ C;  4DRB A;  5KDM A;  5CPJ A;  5B32 A;  3AZF A;  3AN2 A;  3C1B C;  3AZI D;  3W97 C;  1P3O A;  3X1T D;  5B1L A;  3EPJ A;  3EPL A;  5F99 C;  5B1M D;  3MGS B;  4ZUX D;  3NQU B;  2LY8 A;  3X1S D;  5B2J C;  4AWL B;  4X23 A;  4H9N B;  4HGA B;  1P3A C;  5BNV B;  4NE3 A;  3W99 A;  2BYM B;  5AVC D;  3REJ D;  5AV9 B;  3WAA C;  3AZG B;  3WA9 D;  1TZY C;  3AFA B;  2HUE C;  1BH8 A;  5AV5 C;  1P3A A;  5GT3 C;  2F8N H;  4YS3 D;  4J8V C;  5B40 A;  5BNX A;  3AZI C;  1P3M C;  3R45 B;  1H3O A;  1P3K A;  3X1V B;  2ARO A;  4Z5T A;  1EQZ C;  4H9O A;  1M18 B;  3O62 A;  3KUY D;  4QLC D;  2FFF B;  4J8W B;  2F8N D;  5AVB B;  5B33 A;  2IO5 B;  2HIO D;  2RVQ D;  5DNN A;  4UPK A;  3UT9 D;  3AZJ D;  2F8N K;  3MNN C;  1P3P A;  1P34 B;  1P3L D;  3REJ C;  4KHA B;  3WA9 C;  5BS7 C;  1Z2C B;  3WTP D;  3TU4 B;  1KX4 D;  3AFA D;  3AV2 A;  1WWS A;  1P3I C;  4WU8 D;  3MNN A;  4XZQ C;  3REH C;  1ID3 A;  1F66 A;  2BG1 A;  4KGC B;  2Y2L A;  1KX3 A;  1U35 B;  5B0Y D;  1AOI D;  2FJ7 D;  2CV5 D;  3MGP D;  3UTA A;  1P3I A;  3REH A;  3AZE B;  4LD9 B;  5BT1 C;  3C1C A;  3MGS C;  1M19 A;  4AWL C;  5AY8 C;  5AV8 B;  4HGA C;  5GT0 D;  5JRG A;  3KXB D;  3A1I A;  2VQR A;  1P3F A;  1ZLA B;  2Y2J A;  5AV9 C;  1N1J B;  3AZG C;  3LJA B;  5AY8 A;  5DNM B;  3EPH A;  3TU4 D;  4WU9 B;  3A6N A;  5B31 G;  2XD5 A;  2DQN C;  2NQB B;  5GSU C;  1U35 D;  3AYW B;  4H9Q A;  5B31 A;  3MVD D;  3X1V C;  2G5I C;  3VH6 T;  3AZE D;  1M18 C;  4DQY B;  4H9P B;  4J8U B;  5GSU A;  5B24 D;  4J8W C;  5AVB C;  3AZH A;  2IO5 C;  5AV8 D;  4JJN B;  1P3G B;  1Q9C A;  1M1A D;  3AV1 A;  1P34 C;  3B0D B;  5E5A D;  5DNM D;  3V9R A;  4R8P D;  4KGC C;  4KHA A;  2NQB D;  4CSR B;  4J8X D;  1S32 C;  3B0C W;  3X1T B;  4UUZ B;  3AZM D;  4LD9 C;  3LZ0 D;  4J8U D;  3AZN A;  5B1M B;  3LEL A;  1S32 A;  2F2A C;  5CPI C;  4ZUX B;  4H9R B;  3W98 B;  5AV8 C;  2Y2P A;  3X1S B;  1KX5 A;  4KUD A;  1HQ3 B;  3AN2 D;  1ZLA C;  5AVC B;  3VH5 A;  5CP6 A;  3LJA C;  5CPI A;  2JE5 A;  5B1L D;  5DNM C;  4EO5 C;  3AZK A;  2PYO D;  4WU9 C;  4WNN A;  5B0Z C;  3UTB A;  5FUG B;  4YS3 B;  1ZLA A;  2NQB C;  3AYW C;  4Z66 C;  5B0Z A;  3W99 D;  2ZM5 A;  3WKJ A;  4J8U C;  3C1B A;  1F1E A;  3KUY B;  3W97 A;  4QLC B;  4Z66 A;  1P3G C;  3W98 D;  4JJN C;  2F8N B;  5B2I B;  3UT9 B;  2HIO B;  3AZJ B;  4XUJ B;  1HQ3 D;  2YFW B;  5B40 D;  4E45 A;  3B0D C;  5F99 A;  1P3L B;  1T3U A;  5JA4 A;  1P3K D;  5GXQ C;  3WTP B;  5B2J A;  1KX4 B;  4WU8 B;  1HTA A;  3KWQ B;  2NZD B;  4CAY A;  5B33 D;  5DNN D;  2Y2Q A;  3WAA A;  5GXQ A;  1TZY A;  5B0Y B;  1AOI B;  3X1T C;  2FJ7 B;  1P3P D;  2CV5 B;  3MGP B;  2ZY4 A;  2ZY2 A;  5AV5 A;  5GT3 A;  5AV6 D;  1BH9 A;  4J8V A;  2BYK A;  5B1M C;  2DF4 C;  5G49 A;  3AZI A;  1P3M A;  3AV2 D;  4ZUX C;  3W98 C;  3X1S C;  4YM6 D;  5B2I D;  4E44 A;  1F66 D;  1EQZ A;  5GT0 B;  3NQJ A;  3H0R C;  4XUJ D;  1KX3 D;  3LZ1 B;  3KXB B;  5AVC C;  3W96 B;  3UTA D;  3AZL B;  1TAF A;  3C1C D;  5C3I B;  2JCH A;  3MGQ D;  4YS3 C;  3KWQ D;  1M19 D;  2NZD D;  2Y2N A;  3REJ A;  3WA9 A;  5BS7 A;  5JRG D;  3MVD B;  5BO0 A;  1JFI B;  2XD1 A;  4WV4 B;  4XZQ A;  1P3F D;  2JSS A;  3KUY C;  4QLC C;  5B24 B;  3A6N D;  5B2I C;  3REK D;  2HIO C;  2RVQ C;  3UT9 C;  3AZJ C;  3X1U B;  1M1A B;  3LZ1 D;  3AL0 C;  5CPK D;  1P3L C;  3MGS A;  5B31 D;  1P3B B;  2W8S A;  3W96 D;  3NQU A;  5E5A B;  3WTP C;  1R4V A;  3AZL D;  1KX4 C;  4H9N A;  3AFA C;  3MGR B;  3B6F B;  4WU8 C;  5BNV A;  4R8P B;  3B6G B;  2NZD C;  2BYM A;  3AZH D;  3REL D;  5AV9 A;  3VH6 W;  3AZG A;  4G91 B;  5B0Y C;  4J8X B;  1AOI C;  2FJ7 C;  3AV1 D;  3AFA A;  2CV5 C;  3MGP C;  3AZM B;  3LZ0 B;  3KSY A;  5B0Y A;  3R45 A;  2FJ7 A;  3X1V A;  5KDM B;  5GT0 C;  5CPJ B;  5B32 B;  3X1U D;  3AZF B;  3LZ1 C;  3AN2 B;  1M18 A;  3KXB C;  2Y2O A;  4H9S C;  1P3O B;  3W96 C;  1P3B D;  4J8W A;  5AVB A;  5B1L B;  2PYO B;  3TU4 C;  5GT0 A;  3MGR D;  3B6F D;  5C3I C;  1P34 A;  3B6G D;  3LEL D;  4H9S A;  1KX5 D;  4NFT A;  3REI D;  1U35 C;  4X23 B;  4KUD D;  2UWX A;  3TU4 A;  3A1K A;  3MVD C;  3AZE C;  3W99 B;  5CP6 D;  4KGC A;  3IP4 C;  1U35 A;  5B24 C;  1BH8 B;  3MVD A;  1P3A B;  3UTB D;  3AZE A;  5CPJ D;  3EPK A;  1M1A C;  5B32 D;  1WWI A;  5B40 B;  3AZF D;  4LD9 A;  1P3B C;  5B24 A;  1P3O D;  1P3K B;  2ARO B;  4Z5T B;  5E5A C;  5AV8 A;  4H9O B;  3H0M C;  5CHL B;  3MGR C;  1M1A A;  4R8P C;  3O62 B;  3B6G C;  1N1J A;  4ZBJ B;  5DNN B;  5B33 B;  4G91 C;  3LJA A;  4X23 D;  4J8X C;  5DNM A;  4WU9 A; 
#chains in the Genus database with same CATH homology
 1P3P B;  3AZM C;  5F99 D;  3LZ0 C;  5AV6 B;  2NQB A;  5B2J D;  3AYW A;  3AV2 B;  3B0B A;  1P3A D;  3MNN B;  1ID3 B;  4YM6 B;  2L5A A;  1F66 B;  5B32 C;  3AN2 C;  1KX3 B;  4H9P A;  3WAA D;  4J8U A;  1TZY D;  1P3O C;  1P3I B;  3UTA B;  2ARO D;  4Z5T D;  5B1L C;  3REH B;  5GT3 D;  4JJN A;  1P3G A;  2PYO C;  4J8V D;  4WJ3 C;  3C1C B;  3O62 D;  3F6T A;  3MGQ B;  1P3M D;  1M19 B;  4Z2M G;  4X23 C;  2Y2G A;  1EQZ D;  2PYO A;  4NE6 A;  5JRG B;  2G5H C;  3W99 C;  1P3F B;  5AY8 B;  4CSR A;  3A6N B;  3MNN D;  3X1T A;  4UUZ A;  3REK B;  1ID3 D;  1HQ3 C;  5B40 C;  5CPK B;  5B1M A;  2YFV B;  4H9Q B;  5B31 B;  1P3K C;  2ARO C;  4Z5T C;  4H9R A;  4ZUX A;  1P3I D;  3W98 A;  3X1S A;  4XZQ D;  3REH D;  4WZS B;  1B67 A;  1HQ3 A;  3O62 C;  5GSU B;  4G92 B;  5AVC A;  4ZBJ C;  5DNN C;  3REL B;  5B33 C;  3AZH B;  3AV1 B;  1P3P C;  5BT1 D;  4M6B A;  5FUG A;  3MGS D;  5AV6 C;  4YS3 A;  5AY8 D;  2RIQ A;  1BFM A;  3AV2 C;  3V9R B;  2J8P A;  1ID3 C;  4YM6 C;  1F66 C;  4XUJ C;  2F8N G;  5AV6 A;  1KX3 C;  5AV9 D;  3AZG D;  2Y2M A;  3KUY A;  4QLC A;  3UTA C;  3P5J B;  4YM6 A;  5B2I A;  2ZY5 A;  3UT9 A;  2HIO A;  3AZJ A;  2F8N A;  4XUJ A;  2YFW A;  3C1C C;  3AZN B;  5GSU D;  3MGQ C;  3KWQ C;  1M19 C;  3LEL B;  1S32 B;  1KU5 A;  1P3L A;  2ZY3 A;  1KX5 B;  3X1V D;  3REI B;  4KUD B;  3WTP A;  5JRG C;  1KX4 A;  1M18 D;  4WU8 A;  3MGQ A;  1P3F C;  3KWQ A;  2NZD A;  4J8W D;  5CP6 B;  3VH5 W;  5CPI B;  5AVB D;  3AZK B;  3EG5 B;  4WNN B;  1AOI A;  3A6N C;  3REK C;  3VH5 T;  3UTB B;  3MGP A;  2CV5 A;  1P34 D;  5CPK C;  4EO5 B;  5B31 C;  5B0Z B;  1PZR A;  3REK A;  3AZL C;  1A7W A;  3WKJ B;  3WTP E;  4KGC D;  1ULY A;  3LZ1 A;  3C1B B;  3AZN D;  3KXB A;  5CPK A;  2YFV A;  4G92 C;  1B6W A;  1S32 D;  4Z66 B;  3AZH C;  4NE5 A;  3REL C;  3W97 B;  3W96 A;  3AZL A;  3AV1 C;  4LD9 D;  5F99 B;  3KFU G;  5JA4 B;  5CPI D;  1W2E A;  3REL A;  3AZK D;  5B2J B;  1JFI A;  1ZLA D;  4CAY B;  3X1U C;  3LJA D;  3H0L C;  5GXQ B;  5BNX B;  1TZY B;  3WAA B;  4WU9 D;  1H3O B;  2Y2K A;  2HUE B;  5B0Z D;  5AV5 B;  5GT3 B;  3WKJ D;  3B6F C;  1BH9 B;  3X1U A;  2BYK B;  4J8V B;  3AZN C;  3C1B D;  5G49 B;  3LEL C;  3AZI B;  3AYW D;  1P3M B;  3W97 D;  2Y2H A;  4Z66 D;  1KX5 C;  1P3B A;  3REI C;  4KUD C;  5E5A A;  1EQZ B;  3NQJ B;  4DRA A;  3MGR A;  3B0C T;  3B6F A;  2Y2I A;  4Z2M H;  4R8P A;  3B6G A;  5CP6 C;  1P3G D;  3AZK C;  3VH6 A;  4JJN D;  3REI A;  4J8X A;  1TAF B;  3UTB C;  3AZM A;  3FDD A;  5CPJ C;  2CWE A;  3AZF C;  3REJ B;  3LZ0 A;  3WA9 B;  5GXQ D;  5B32 G;  5BO0 B;  5AV5 D;  4XZQ B;  3WKJ C;  4DRB A;  5KDM A;  5CPJ A;  5B32 A;  3AZF A;  3AN2 A;  3C1B C;  3AZI D;  3W97 C;  1P3O A;  3X1T D;  5B1L A;  3EPJ A;  3EPL A;  5F99 C;  5B1M D;  3MGS B;  4ZUX D;  3NQU B;  2LY8 A;  3X1S D;  5B2J C;  4AWL B;  4X23 A;  4H9N B;  4HGA B;  1P3A C;  5BNV B;  4NE3 A;  3W99 A;  2BYM B;  5AVC D;  3REJ D;  5AV9 B;  3WAA C;  3AZG B;  3WA9 D;  1TZY C;  3AFA B;  2HUE C;  1BH8 A;  5AV5 C;  1P3A A;  5GT3 C;  2F8N H;  4YS3 D;  4J8V C;  5B40 A;  5BNX A;  3AZI C;  1P3M C;  3R45 B;  1H3O A;  1P3K A;  3X1V B;  2ARO A;  4Z5T A;  1EQZ C;  4H9O A;  1M18 B;  3O62 A;  3KUY D;  4QLC D;  2FFF B;  4J8W B;  2F8N D;  5AVB B;  5B33 A;  2IO5 B;  2HIO D;  2RVQ D;  5DNN A;  4UPK A;  3UT9 D;  3AZJ D;  2F8N K;  3MNN C;  1P3P A;  1P34 B;  1P3L D;  3REJ C;  4KHA B;  3WA9 C;  5BS7 C;  1Z2C B;  3WTP D;  3TU4 B;  1KX4 D;  3AFA D;  3AV2 A;  1WWS A;  1P3I C;  4WU8 D;  3MNN A;  4XZQ C;  3REH C;  1ID3 A;  1F66 A;  2BG1 A;  4KGC B;  2Y2L A;  1KX3 A;  1U35 B;  5B0Y D;  1AOI D;  2FJ7 D;  2CV5 D;  3MGP D;  3UTA A;  1P3I A;  3REH A;  3AZE B;  4LD9 B;  5BT1 C;  3C1C A;  3MGS C;  1M19 A;  4AWL C;  5AY8 C;  5AV8 B;  4HGA C;  5GT0 D;  5JRG A;  3KXB D;  3A1I A;  2VQR A;  1P3F A;  1ZLA B;  2Y2J A;  5AV9 C;  1N1J B;  3AZG C;  3LJA B;  5AY8 A;  5DNM B;  3EPH A;  3TU4 D;  4WU9 B;  3A6N A;  5B31 G;  2XD5 A;  2DQN C;  2NQB B;  5GSU C;  1U35 D;  3AYW B;  4H9Q A;  5B31 A;  3MVD D;  3X1V C;  2G5I C;  3VH6 T;  3AZE D;  1M18 C;  4DQY B;  4H9P B;  4J8U B;  5GSU A;  5B24 D;  4J8W C;  5AVB C;  3AZH A;  2IO5 C;  5AV8 D;  4JJN B;  1P3G B;  1Q9C A;  1M1A D;  3AV1 A;  1P34 C;  3B0D B;  5E5A D;  5DNM D;  3V9R A;  4R8P D;  4KGC C;  4KHA A;  2NQB D;  4CSR B;  4J8X D;  1S32 C;  3B0C W;  3X1T B;  4UUZ B;  3AZM D;  4LD9 C;  3LZ0 D;  4J8U D;  3AZN A;  5B1M B;  3LEL A;  1S32 A;  2F2A C;  5CPI C;  4ZUX B;  4H9R B;  3W98 B;  5AV8 C;  2Y2P A;  3X1S B;  1KX5 A;  4KUD A;  1HQ3 B;  3AN2 D;  1ZLA C;  5AVC B;  3VH5 A;  5CP6 A;  3LJA C;  5CPI A;  2JE5 A;  5B1L D;  5DNM C;  4EO5 C;  3AZK A;  2PYO D;  4WU9 C;  4WNN A;  5B0Z C;  3UTB A;  5FUG B;  4YS3 B;  1ZLA A;  2NQB C;  3AYW C;  4Z66 C;  5B0Z A;  3W99 D;  2ZM5 A;  3WKJ A;  4J8U C;  3C1B A;  1F1E A;  3KUY B;  3W97 A;  4QLC B;  4Z66 A;  1P3G C;  3W98 D;  4JJN C;  2F8N B;  5B2I B;  3UT9 B;  2HIO B;  3AZJ B;  4XUJ B;  1HQ3 D;  2YFW B;  5B40 D;  4E45 A;  3B0D C;  5F99 A;  1P3L B;  1T3U A;  5JA4 A;  1P3K D;  5GXQ C;  3WTP B;  5B2J A;  1KX4 B;  4WU8 B;  1HTA A;  3KWQ B;  2NZD B;  4CAY A;  5B33 D;  5DNN D;  2Y2Q A;  3WAA A;  5GXQ A;  1TZY A;  5B0Y B;  1AOI B;  3X1T C;  2FJ7 B;  1P3P D;  2CV5 B;  3MGP B;  2ZY4 A;  2ZY2 A;  5AV5 A;  5GT3 A;  5AV6 D;  1BH9 A;  4J8V A;  2BYK A;  5B1M C;  2DF4 C;  5G49 A;  3AZI A;  1P3M A;  3AV2 D;  4ZUX C;  3W98 C;  3X1S C;  4YM6 D;  5B2I D;  4E44 A;  1F66 D;  1EQZ A;  5GT0 B;  3NQJ A;  3H0R C;  4XUJ D;  1KX3 D;  3LZ1 B;  3KXB B;  5AVC C;  3W96 B;  3UTA D;  3AZL B;  1TAF A;  3C1C D;  5C3I B;  2JCH A;  3MGQ D;  4YS3 C;  3KWQ D;  1M19 D;  2NZD D;  2Y2N A;  3REJ A;  3WA9 A;  5BS7 A;  5JRG D;  3MVD B;  5BO0 A;  1JFI B;  2XD1 A;  4WV4 B;  4XZQ A;  1P3F D;  2JSS A;  3KUY C;  4QLC C;  5B24 B;  3A6N D;  5B2I C;  3REK D;  2HIO C;  2RVQ C;  3UT9 C;  3AZJ C;  3X1U B;  1M1A B;  3LZ1 D;  3AL0 C;  5CPK D;  1P3L C;  3MGS A;  5B31 D;  1P3B B;  2W8S A;  3W96 D;  3NQU A;  5E5A B;  3WTP C;  1R4V A;  3AZL D;  1KX4 C;  4H9N A;  3AFA C;  3MGR B;  3B6F B;  4WU8 C;  5BNV A;  4R8P B;  3B6G B;  2NZD C;  2BYM A;  3AZH D;  3REL D;  5AV9 A;  3VH6 W;  3AZG A;  4G91 B;  5B0Y C;  4J8X B;  1AOI C;  2FJ7 C;  3AV1 D;  3AFA A;  2CV5 C;  3MGP C;  3AZM B;  3LZ0 B;  3KSY A;  5B0Y A;  3R45 A;  2FJ7 A;  3X1V A;  5KDM B;  5GT0 C;  5CPJ B;  5B32 B;  3X1U D;  3AZF B;  3LZ1 C;  3AN2 B;  1M18 A;  3KXB C;  2Y2O A;  4H9S C;  1P3O B;  3W96 C;  1P3B D;  4J8W A;  5AVB A;  5B1L B;  2PYO B;  3TU4 C;  5GT0 A;  3MGR D;  3B6F D;  5C3I C;  1P34 A;  3B6G D;  3LEL D;  4H9S A;  1KX5 D;  4NFT A;  3REI D;  1U35 C;  4X23 B;  4KUD D;  2UWX A;  3TU4 A;  3A1K A;  3MVD C;  3AZE C;  3W99 B;  5CP6 D;  4KGC A;  3IP4 C;  1U35 A;  5B24 C;  1BH8 B;  3MVD A;  1P3A B;  3UTB D;  3AZE A;  5CPJ D;  3EPK A;  1M1A C;  5B32 D;  1WWI A;  5B40 B;  3AZF D;  4LD9 A;  1P3B C;  5B24 A;  1P3O D;  1P3K B;  2ARO B;  4Z5T B;  5E5A C;  5AV8 A;  4H9O B;  3H0M C;  5CHL B;  3MGR C;  1M1A A;  4R8P C;  3O62 B;  3B6G C;  1N1J A;  4ZBJ B;  5DNN B;  5B33 B;  4G91 C;  3LJA A;  4X23 D;  4J8X C;  5DNM A;  4WU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...