1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
3NQJB 5AY8A 1TZYD 4NFTA 1M19D 5AVCC 3RELB 4XZQA 3KWQD 1P3MB 3VH5T 3UTAA 4J8XA 3UTBB 2IO5B 4WNNB 5GSUA 5AV6C 5AV5D 1P3KC 3WKJD 4KUDC 1P3PC 1KX4D 1BH8A 1F1EA 3WA9C 3X1SA 5CPKC 3B6GA 1P3GA 3MVDB 1P3BA 3MNNC 5B40A 4H9PB 5B32A 5B24A 3REJC 3AZNB 4YM6B 4AWLB 3LJAB 5B24B 3AZGA 4XUJB 3AFAC 3AV1A 3C1CB 3X1SB 5GT0A 3AYWD 4XZQD 5AV6B 5B1LA 5B2JC 5B0YA 3X1VA 5GXQB 3C1BD 3WKJB 4G92B 4J8VC 5CP6C 3C1CD 5B31G 3UTBD 5G49B 3VH5A 5B24D 4YS3C 3VH6T 5CPJD 5B0ZD 2F8NK 5F99D 4E45A 3AZKB 4ZUXD 3R45A 5GSUC 1KX3A 5B0YC 5AV9A 1KX5B 1HQ3B 5DNMA 3AZHB 5AV9B 2AROB 3LELB 1P3OC 5C3IC 3W97C 2FJ7C 3AFAA 3AV1C 1ID3A 5B2IC 3WTPE 3REHB 5JA4B 3UT9B 4HGAC 5B1MB 5B40D 1P3BD 1P3OD 3KXBD 3KSYA 5CPIC 3AZIA 1R4VA 1P3ID 3AZGC 3MGQB 4E44A 2YFWB 4J8UC 4Z66A 4Z5TB 3MGSA 1M1AC 5B1LC 2NQBB 3NQUB 3LZ1C 2HIOD 3X1VC 3AV2A 3AZIB 2NQBA 3KUYC 1M19A 5B33A 1M1AD 1TZYA 5AY8B 3MGSD 4LD9B 1S32C 1F66D 1N1JB 3MGPD 2IO5C 1P3AC 3A6NA 2JSSA 3B0BA 5B31D 3REIA 1P3OA 5JRGD 4UUZA 5AY8C 5DNMB 3AZHA 3C1BC 1P3GB 1S32B 2PYOB 2RVQD 4G91B 4Z5TD 5GXQD 5DNNC 3UT9C 5F99A 4HGAB 4CAYB 2NQBC 3LZ1B 2NZDD 4R8PB 4WU9B 1P3PD 1KX4C 1B67A 5FUGB 5BNXB 5GSUB 4WU8D 1ZLAB 3W98B 3MGQA 1KX5C 1JFIA 5B1LB 3REKB 5CPKD 4H9NB 1ZLAA 3W98A 2YFVA 5B40C 3REKC 2YFVB 1KX5D 3TU4D 5FUGA 4YM6A 1P3KD 3WKJC 4J8UD 3LZ0C 4X23B 4G92C 5BT1D 5F99B 3A6NC 3AZFB 3REKD 4H9SC 5B1LD 5CPKB 3V9RA 4WU8B 4CAYA 3C1BA 3AZGB 2CV5B 1ZLAD 3B6GC 3AZNA 1HQ3D 3X1VD 3KUYA 5JA4A 3MNND 5AV8A 4QLCA 3RELD 2NZDB 2BYMB 1WWSA 5GT0D 5CP6A 2BYMA 1P3FD 4J8VB 4XZQB 3MVDC 3X1SD 4Z5TA 4ZUXC 4J8XB 5B2IB 5B2JD 5AY8D 1M1AB 1AOIC 3B6FD 4YM6D 4G91C 4KGCA 1H3OA 3AZLB 5AVBC 3UTBC 3WKJA 2F8NA 3W97A 4AWLC 2NQBD 5GT0B 3AZJA 3AZEB 4XUJC 3AFAB 5AVCB 3MGQD 4Z66D 1KX3C 1P3IB 3WA9B 4J8WA 3REID 5AV8B 2HUEC 3X1TC 1P3OB 2F8NH 3R45B 3W99C 4JJNA 3VH6A 1HQ3A 4Z66C 4X23D 3MGRB 3W96D 1M18A 3UTAD 2HIOC 5AVBB 5KDMA 3AN2B 3WA9A 1U35A 5CPIA 5BT1C 3NQUA 1AOIB 3AZEC 3W98D 4NE6A 5G49A 1F66C 3MGPC 2FJ7B 3WAAA 4H9NA 5AVCA 3RELC 5B0ZB 5CPJB 3AZHC 3WAAB 5GT3B 1Q9CA 5GT0C 5DNNA 5B0ZA 5CPJA 3LZ1D 1U35D 3REJA 1HTAA 4YS3D 1M19C 5BS7C 4LD9C 4H9OB 5AVCD 3W96A 3NQJA 5JRGA 3B0DC 4KHAA 2HUEB 1JFIB 1S32D 4NE3A 1P3LA 3W99B 5DNMD 1F66A 3LJAA 5KDMB 5B0YD 1KU5A 1F66B 4CSRB 4Z2MG 5F99C 5BO0B 4XUJD 5GT3D 3A6NB 3AN2C 4EO5B 3AZMB 3AV1D 5B2JB 4H9PA 5B2ID 1P3LB 4KGCD 3X1TD 2NZDC 1KX3D 4QLCD 3RELA 4H9SA 3B6GD 2FJ7A 3UTAB 3VH5W 3AZNC 4DRBA 3MGRD 3REKA 3AZEA 2CWEA 1EQZB 5DNNB 3MNNB 1H3OB 3AZLA 2F8ND 3AZGD 3C1CA 2F8NB 3TU4C 1P3MD 3WTPB 3X1UD 3AZFD 3KUYD 1P3KB 5AV9D 3AZED 5BNVB 1M18B 4ZUXA 5E5AA 1P34A 5JRGC 5CP6B 4ZUXB 4J8XC 2BYKB 3AYWC 4ZBJB 4JJNB 1P3FA 3KUYB 1BH8B 3B6FB 2NZDA 3X1UB 3WTPD 1P3KA 1ID3C 5GSUD 3LELA 1P3AA 4J8XD 2RVQC 4Z5TC 5DNND 3X1SC 5CPKA 2PYOC 3KWQC 5GT3A 1BH9A 4WU8C 5B24C 1TZYC 5E5AC 3AV2B 1P34C 4KUDA 4KGCC 4J8UA 3W97B 5AV5C 3AZFA 3X1TA 4WU9C 3TU4A 1M1AA 3O62B 5CPID 4WZSB 5B31B 4DRAA 2YFWA 4KGCB 3MGPB 1U35B 2LY8A 3O62A 4XUJA 3MGSB 3AV1B 2HIOA 3LZ0B 3AZMD 3MGRA 3LZ0D 4KUDB 2PYOA 3A6ND 4R8PA 2FJ7D 5CPIB 4J8WD 4J8VA 1KX4A 3X1UC 1ID3B 4EO5C 4NE5A 5AV5A 3AZFC 1KX4B 3REJD 3KXBC 3UT9A 3LELC 3AV2D 3LZ0A 4WV4B 5AV5B 1ZLAC 3W98C 3AZMA 3W96B 3O62C 3KWQA 5B33B 3KXBB 1P3FC 2AROA 5B1MD 5B40B 1P3PB 3WAAD 5AV9C 3UT9D 1P3IA 3MGPA 3REIB 5DNMC 1A7WA 5CHLB 2AROD 5BNXA 3REJB 3MGSC 2PYOD 3WTPC 1M18D 1ID3D 5AVBD 3LZ1A 1P3AD 3REHA 3AZIC 3AZKD 4WU9A 4YM6C 2AROC 1EQZC 4KUDD 5B33C 1ULYA 5AV8D 3B6FA 5E5AD 3KXBA 5B32B 3AZID 3REIC 1P34D 5B32G 3AZMC 3V9RB 3C1BB 1P3GC 1P3FB 3W97D 3B0CT 5B32C 3WTPA 1WWIA 3X1UA 4UUZB 5AV6D 4M6BA 3AYWB 4KHAB 4WNNA 3AZLD 2CV5A 3MVDA 1P3BB 5B32D 5E5AB 3AV2C 1P34B 3X1VB 3MNNA 1BH9B 3AZND 1TAFB 3AZJD 3AZLC 4J8UB 1P3MA 3LELD 3MVDD 5B0YB 2L5AA 3TU4B 5CP6D 3C1CC 1B6WA 3UTBA 1P3AB 5C3IB 5B1MC 3AZJC 3B6FC 3WAAC 4YS3B 5GXQC 3REHC 5B2JA 1U35C 2CV5D 3B0CW 3AYWA 5BNVA 3KWQB 3B0DB 1EQZD 5B33D 1TZYB 3MGQC 1KX5A 3VH6W 2BYKA 4YS3A 1P3LC 2CV5C 3AZKC 3B6GB 4QLCB 3LJAC 5B0ZC 5CPJC 1KX3B 5GT3C 1P3GD 3AN2D 5JRGB 4J8WB 3AZJB 4WU8A 1BFMA 5AV8C 5BS7A 3X1TB 4H9RB 4QLCC 3W96C 1P3LD 4LD9A 3UTAC 5B31A 1TAFA 3LJAD 1AOIA 4WU9D 4R8PD 4H9OA 5AV6A 5B2IA 4H9QB 5AVBA 5B1MA 3WA9D 4Z66B 4H9QA 3O62D 5GXQA 3MGRC 1P3MC 4H9RA 3W99D 3AFAD 4R8PC 1P3BC 2F8NG 4X23C 5BO0A 1P3IC 1S32A 4J8WC 1P3PA 5B31C 4ZBJC 4JJNC 3W99A 4LD9D 1N1JA 4XZQC 3AZKA 3AN2A 1HQ3C 3REHD 4Z2MH 1M18C 1M19B 4CSRA 2HIOB 4JJND 1AOID 3AZHD 4J8VD 4X23A 1EQZA
chains in the Genus database with same CATH superfamily
3NQJB 5AY8A 1TZYD 2FFFB 4NFTA 1M19D 5AVCC 3IP4C 3A1KA 3RELB 4XZQA 3KWQD 1P3MB 3VH5T 3UTAA 4J8XA 3UTBB 2IO5B 4WNNB 5GSUA 2ZY5A 5AV6C 5AV5D 1P3KC 3WKJD 4KUDC 1P3PC 1KX4D 1BH8A 1PZRA 1F1EA 3WA9C 3X1SA 5CPKC 3B6GA 1P3GA 3MVDB 1P3BA 3MNNC 5B40A 4H9PB 5B32A 5B24A 3REJC 3AZNB 4YM6B 4AWLB 3LJAB 5B24B 3AZGA 4XUJB 3AFAC 3AV1A 3C1CB 3X1SB 5GT0A 3AYWD 4XZQD 3EG5B 5AV6B 2VQRA 5B1LA 2Y2LA 5B2JC 5B0YA 3X1VA 5GXQB 3C1BD 3WKJB 4G92B 4J8VC 5CP6C 3C1CD 5B31G 3UTBD 5G49B 3VH5A 5B24D 4YS3C 3VH6T 5CPJD 5B0ZD 2F8NK 5F99D 4E45A 3AZKB 4ZUXD 3AL0C 3R45A 5GSUC 1KX3A 5B0YC 5AV9A 1KX5B 1HQ3B 5DNMA 3AZHB 5AV9B 2AROB 3LELB 1P3OC 5C3IC 3W97C 2FJ7C 3AFAA 3AV1C 1ID3A 5B2IC 3WTPE 3REHB 5JA4B 3UT9B 4HGAC 5B1MB 5B40D 1P3BD 1P3OD 3KXBD 3KSYA 5CPIC 2ZM5A 3AZIA 1R4VA 1P3ID 3A1IA 2ZY2A 3AZGC 3MGQB 4E44A 2YFWB 4J8UC 4Z66A 4Z5TB 3MGSA 1M1AC 5B1LC 1T3UA 2NQBB 3NQUB 3LZ1C 2Y2KA 2HIOD 3X1VC 3AV2A 3AZIB 2NQBA 4UPKA 3KUYC 1M19A 5B33A 3EPKA 1TZYA 5AY8B 1M1AD 3MGSD 4LD9B 1S32C 1F66D 1N1JB 3MGPD 2IO5C 1P3AC 3A6NA 2JSSA 3B0BA 5B31D 3REIA 1P3OA 5JRGD 4UUZA 5AY8C 5DNMB 3AZHA 3C1BC 1P3GB 1S32B 2PYOB 2RVQD 4G91B 4Z5TD 5GXQD 5DNNC 3UT9C 5F99A 4HGAB 2Y2JA 4CAYB 2NQBC 3LZ1B 3KFUG 2NZDD 4R8PB 4WU9B 1P3PD 1KX4C 1B67A 5FUGB 5BNXB 5GSUB 4WU8D 1ZLAB 3W98B 3MGQA 1KX5C 1JFIA 5B1LB 2ZY3A 3REKB 5CPKD 4H9NB 1ZLAA 3W98A 2YFVA 5B40C 4X23A 3REKC 2YFVB 1KX5D 3TU4D 5FUGA 4YM6A 1P3KD 3WKJC 4J8UD 3LZ0C 4X23B 4G92C 5BT1D 5F99B 3A6NC 3AZFB 3REKD 4H9SC 5B1LD 5CPKB 3V9RA 4WU8B 4CAYA 3C1BA 3AZGB 2CV5B 1ZLAD 3B6GC 3AZNA 3X1VD 3W98D 3KUYA 5JA4A 3MNND 5AV8A 4QLCA 3RELD 2NZDB 2BYMB 2UWXA 1WWSA 4WJ3C 5GT0D 5CP6A 2BYMA 2DF4C 1P3FD 4J8VB 4XZQB 3MVDC 3X1SD 3EPHA 4Z5TA 4ZUXC 4J8XB 5B2IB 2ZY4A 5B2JD 5AY8D 1M1AB 1AOIC 3B6FD 4YM6D 4G91C 1Z2CB 4KGCA 1H3OA 3AZLB 5AVBC 3UTBC 3WKJA 2F8NA 3W97A 4AWLC 2NQBD 5GT0B 3AZJA 2G5IC 4XUJC 3AFAB 5AVCB 3AZEB 3MGQD 4Z66D 1KX3C 1P3IB 3WA9B 3H0RC 2Y2PA 4J8WA 3REID 2XD1A 5AV8B 2HUEC 3X1TC 1P3OB 2F8NH 3R45B 3W99C 4JJNA 3VH6A 1HQ3A 4Z66C 4X23D 3MGRB 3W96D 1M18A 3UTAD 2HIOC 5AVBB 5KDMA 3AN2B 3WA9A 1U35A 5CPIA 5BT1C 3NQUA 1AOIB 3AZEC 4NE6A 5G49A 1F66C 3MGPC 2FJ7B 3WAAA 4H9NA 5AVCA 3RELC 5B0ZB 5CPJB 3AZHC 3WAAB 5GT3B 1Q9CA 5GT0C 5DNNA 5B0ZA 5CPJA 3LZ1D 1U35D 2F2AC 3REJA 1HTAA 4YS3D 1M19C 5BS7C 4LD9C 4H9OB 5AVCD 3W96A 3NQJA 5JRGA 3B0DC 4KHAA 2HUEB 1JFIB 1S32D 4NE3A 1P3LA 3W99B 5DNMD 1F66A 3LJAA 5KDMB 5B0YD 1KU5A 1F66B 4CSRB 4Z2MG 5F99C 5BO0B 4XUJD 5GT3D 3A6NB 3AN2C 4EO5B 3AZMB 2Y2MA 2W8SA 3AV1D 5B2JB 4H9PA 5B2ID 1P3LB 4KGCD 1W2EA 3X1TD 2NZDC 1KX3D 4QLCD 3RELA 4H9SA 3B6GD 2FJ7A 3UTAB 2BG1A 3VH5W 3AZNC 4DRBA 3MGRD 3EPJA 3REKA 3AZEA 2CWEA 1EQZB 5DNNB 3MNNB 1H3OB 3AZLA 2F8ND 3AZGD 3C1CA 2F8NB 3TU4C 1P3MD 3WTPB 3X1UD 3AZFD 2JCHA 3KUYD 1P3KB 2JE5A 5AV9D 3AZED 5BNVB 1M18B 4ZUXA 5E5AA 1P34A 5JRGC 5CP6B 4ZUXB 4J8XC 2BYKB 3AYWC 4ZBJB 4JJNB 1P3FA 3KUYB 1BH8B 3F6TA 3B6FB 2NZDA 3X1UB 3WTPD 1P3KA 1ID3C 5GSUD 3LELA 1P3AA 4J8XD 2RVQC 4Z5TC 5DNND 3X1SC 5CPKA 2PYOC 3KWQC 5GT3A 3H0MC 1BH9A 4WU8C 5B24C 1TZYC 5E5AC 3AV2B 1P34C 4KUDA 4KGCC 4J8UA 3W97B 5AV5C 3AZFA 3X1TA 4WU9C 3TU4A 1M1AA 3O62B 5CPID 4WZSB 5B31B 2DQNC 4DRAA 2YFWA 4KGCB 3MGPB 1U35B 2LY8A 3O62A 4XUJA 3MGSB 3AV1B 2HIOA 3LZ0B 3AZMD 3MGRA 3P5JB 3LZ0D 4KUDB 2PYOA 3A6ND 4R8PA 2FJ7D 5CPIB 4J8WD 4J8VA 1KX4A 2Y2QA 3X1UC 4EO5C 1ID3B 4NE5A 5AV5A 3AZFC 1KX4B 3REJD 3KXBC 3UT9A 3LELC 3AV2D 3LZ0A 4WV4B 5AV5B 1ZLAC 3W98C 3AZMA 3W96B 3O62C 3KWQA 5B33B 3KXBB 2G5HC 1P3FC 2AROA 5B1MD 5B40B 1P3PB 3WAAD 5AV9C 3UT9D 1P3IA 3MGPA 2RIQA 3REIB 5DNMC 1A7WA 5CHLB 2AROD 5BNXA 3REJB 3MGSC 2PYOD 3WTPC 1M18D 1ID3D 5AVBD 3LZ1A 1P3AD 3REHA 3AZIC 3AZKD 4WU9A 4YM6C 2AROC 1EQZC 4KUDD 5B33C 3EPLA 1ULYA 5AV8D 3B6FA 5E5AD 3KXBA 5B32B 4DQYB 3REIC 3AZID 1P34D 5B32G 3AZMC 3V9RB 3C1BB 1P3GC 1P3FB 3W97D 3B0CT 5B32C 3WTPA 1WWIA 3X1UA 4UUZB 5AV6D 4M6BA 3AYWB 4KHAB 4WNNA 3AZLD 2CV5A 3MVDA 1P3BB 5B32D 5E5AB 3AV2C 1P34B 3X1VB 3FDDA 3MNNA 1BH9B 2Y2NA 3AZND 1TAFB 2Y2IA 2Y2HA 3AZJD 3AZLC 4J8UB 1P3MA 3LELD 3MVDD 5B0YB 2L5AA 3TU4B 5CP6D 3C1CC 1B6WA 3UTBA 1P3AB 5C3IB 5B1MC 2Y2OA 3AZJC 3B6FC 3WAAC 4YS3B 5GXQC 3REHC 5B2JA 1U35C 2J8PA 2CV5D 3B0CW 3AYWA 5BNVA 3KWQB 3B0DB 1EQZD 5B33D 1TZYB 3MGQC 1KX5A 3VH6W 2BYKA 4YS3A 1P3LC 2CV5C 3AZKC 3B6GB 4QLCB 3LJAC 5B0ZC 5CPJC 1KX3B 5GT3C 1P3GD 3AN2D 5JRGB 4J8WB 3AZJB 4WU8A 1BFMA 5AV8C 5BS7A 3X1TB 4H9RB 4QLCC 3W96C 1P3LD 4LD9A 3UTAC 5B31A 1TAFA 3LJAD 1AOIA 4WU9D 4R8PD 4H9OA 5AV6A 5B2IA 4H9QB 5AVBA 5B1MA 3WA9D 4Z66B 4H9QA 3O62D 5GXQA 3MGRC 1P3MC 4H9RA 3W99D 3AFAD 4R8PC 1P3BC 2F8NG 4X23C 5BO0A 1P3IC 1S32A 4J8WC 1P3PA 5B31C 4ZBJC 4JJNC 3W99A 4LD9D 1N1JA 2XD5A 4XZQC 3AZKA 3AN2A 1HQ3C 3REHD 4Z2MH 1M18C 1M19B 4CSRA 2HIOB 3H0LC 2Y2GA 4JJND 1AOID 3AZHD 4J8VD 1HQ3D 1EQZA
chains in the Genus database with same CATH topology
3NQJB 5AY8A 1TZYD 2FFFB 4NFTA 1M19D 5AVCC 3IP4C 3A1KA 3RELB 4XZQA 3KWQD 1P3MB 3VH5T 3UTAA 4J8XA 3UTBB 2IO5B 4WNNB 5GSUA 2ZY5A 5AV6C 5AV5D 1P3KC 3WKJD 4KUDC 1P3PC 1KX4D 1BH8A 1PZRA 1F1EA 3WA9C 3X1SA 5CPKC 3B6GA 1P3GA 3MVDB 1P3BA 3MNNC 5B40A 4H9PB 5B32A 5B24A 3REJC 3AZNB 4YM6B 4AWLB 3LJAB 5B24B 3AZGA 4XUJB 3AFAC 3AV1A 3C1CB 3X1SB 5GT0A 3AYWD 4XZQD 3EG5B 5AV6B 2VQRA 5B1LA 2Y2LA 5B2JC 5B0YA 3X1VA 5GXQB 3C1BD 3WKJB 4G92B 4J8VC 5CP6C 3C1CD 5B31G 3UTBD 5G49B 3VH5A 5B24D 4YS3C 3VH6T 5CPJD 5B0ZD 2F8NK 5F99D 4E45A 3AZKB 4ZUXD 3AL0C 3R45A 5GSUC 1KX3A 5B0YC 5AV9A 1KX5B 1HQ3B 5DNMA 3AZHB 5AV9B 2AROB 3LELB 1P3OC 5C3IC 3W97C 2FJ7C 3AFAA 3AV1C 1ID3A 5B2IC 3WTPE 3REHB 5JA4B 3UT9B 4HGAC 5B1MB 5B40D 1P3BD 1P3OD 3KXBD 3KSYA 5CPIC 2ZM5A 3AZIA 1R4VA 1P3ID 3A1IA 2ZY2A 3AZGC 3MGQB 4E44A 2YFWB 4J8UC 4Z66A 4Z5TB 3MGSA 1M1AC 5B1LC 1T3UA 2NQBB 3NQUB 3LZ1C 2Y2KA 2HIOD 3X1VC 3AV2A 3AZIB 2NQBA 4UPKA 3KUYC 1M19A 5B33A 3EPKA 1TZYA 5AY8B 1M1AD 3MGSD 4LD9B 1S32C 1F66D 1N1JB 3MGPD 2IO5C 1P3AC 3A6NA 2JSSA 3B0BA 5B31D 3REIA 1P3OA 5JRGD 4UUZA 5AY8C 5DNMB 3AZHA 3C1BC 1P3GB 1S32B 2PYOB 2RVQD 4G91B 4Z5TD 5GXQD 5DNNC 3UT9C 5F99A 4HGAB 2Y2JA 4CAYB 2NQBC 3LZ1B 3KFUG 2NZDD 4R8PB 4WU9B 1P3PD 1KX4C 1B67A 5FUGB 5BNXB 5GSUB 4WU8D 1ZLAB 3W98B 3MGQA 1KX5C 1JFIA 5B1LB 2ZY3A 3REKB 5CPKD 4H9NB 1ZLAA 3W98A 2YFVA 5B40C 4X23A 3REKC 2YFVB 1KX5D 3TU4D 5FUGA 4YM6A 1P3KD 3WKJC 4J8UD 3LZ0C 4X23B 4G92C 5BT1D 5F99B 3A6NC 3AZFB 3REKD 4H9SC 5B1LD 5CPKB 3V9RA 4WU8B 4CAYA 3C1BA 3AZGB 2CV5B 1ZLAD 3B6GC 3AZNA 3X1VD 3W98D 3KUYA 5JA4A 3MNND 5AV8A 4QLCA 3RELD 2NZDB 2BYMB 2UWXA 1WWSA 4WJ3C 5GT0D 5CP6A 2BYMA 2DF4C 1P3FD 4J8VB 4XZQB 3MVDC 3X1SD 3EPHA 4Z5TA 4ZUXC 4J8XB 5B2IB 2ZY4A 5B2JD 5AY8D 1M1AB 1AOIC 3B6FD 4YM6D 4G91C 1Z2CB 4KGCA 1H3OA 3AZLB 5AVBC 3UTBC 3WKJA 2F8NA 3W97A 4AWLC 2NQBD 5GT0B 3AZJA 2G5IC 4XUJC 3AFAB 5AVCB 3AZEB 3MGQD 4Z66D 1KX3C 1P3IB 3WA9B 3H0RC 2Y2PA 4J8WA 3REID 2XD1A 5AV8B 2HUEC 3X1TC 1P3OB 2F8NH 3R45B 3W99C 4JJNA 3VH6A 1HQ3A 4Z66C 4X23D 3MGRB 3W96D 1M18A 3UTAD 2HIOC 5AVBB 5KDMA 3AN2B 3WA9A 1U35A 5CPIA 5BT1C 3NQUA 1AOIB 3AZEC 4NE6A 5G49A 1F66C 3MGPC 2FJ7B 3WAAA 4H9NA 5AVCA 3RELC 5B0ZB 5CPJB 3AZHC 3WAAB 5GT3B 1Q9CA 5GT0C 5DNNA 5B0ZA 5CPJA 3LZ1D 1U35D 2F2AC 3REJA 1HTAA 4YS3D 1M19C 5BS7C 4LD9C 4H9OB 5AVCD 3W96A 3NQJA 5JRGA 3B0DC 4KHAA 2HUEB 1JFIB 1S32D 4NE3A 1P3LA 3W99B 5DNMD 1F66A 3LJAA 5KDMB 5B0YD 1KU5A 1F66B 4CSRB 4Z2MG 5F99C 5BO0B 4XUJD 5GT3D 3A6NB 3AN2C 4EO5B 3AZMB 2Y2MA 2W8SA 3AV1D 5B2JB 4H9PA 5B2ID 1P3LB 4KGCD 1W2EA 3X1TD 2NZDC 1KX3D 4QLCD 3RELA 4H9SA 3B6GD 2FJ7A 3UTAB 2BG1A 3VH5W 3AZNC 4DRBA 3MGRD 3EPJA 3REKA 3AZEA 2CWEA 1EQZB 5DNNB 3MNNB 1H3OB 3AZLA 2F8ND 3AZGD 3C1CA 2F8NB 3TU4C 1P3MD 3WTPB 3X1UD 3AZFD 2JCHA 3KUYD 1P3KB 2JE5A 5AV9D 3AZED 5BNVB 1M18B 4ZUXA 5E5AA 1P34A 5JRGC 5CP6B 4ZUXB 4J8XC 2BYKB 3AYWC 4ZBJB 4JJNB 1P3FA 3KUYB 1BH8B 3F6TA 3B6FB 2NZDA 3X1UB 3WTPD 1P3KA 1ID3C 5GSUD 3LELA 1P3AA 4J8XD 2RVQC 4Z5TC 5DNND 3X1SC 5CPKA 2PYOC 3KWQC 5GT3A 3H0MC 1BH9A 4WU8C 5B24C 1TZYC 5E5AC 3AV2B 1P34C 4KUDA 4KGCC 4J8UA 3W97B 5AV5C 3AZFA 3X1TA 4WU9C 3TU4A 1M1AA 3O62B 5CPID 4WZSB 5B31B 2DQNC 4DRAA 2YFWA 4KGCB 3MGPB 1U35B 2LY8A 3O62A 4XUJA 3MGSB 3AV1B 2HIOA 3LZ0B 3AZMD 3MGRA 3P5JB 3LZ0D 4KUDB 2PYOA 3A6ND 4R8PA 2FJ7D 5CPIB 4J8WD 4J8VA 1KX4A 2Y2QA 3X1UC 4EO5C 1ID3B 4NE5A 5AV5A 3AZFC 1KX4B 3REJD 3KXBC 3UT9A 3LELC 3AV2D 3LZ0A 4WV4B 5AV5B 1ZLAC 3W98C 3AZMA 3W96B 3O62C 3KWQA 5B33B 3KXBB 2G5HC 1P3FC 2AROA 5B1MD 5B40B 1P3PB 3WAAD 5AV9C 3UT9D 1P3IA 3MGPA 2RIQA 3REIB 5DNMC 1A7WA 5CHLB 2AROD 5BNXA 3REJB 3MGSC 2PYOD 3WTPC 1M18D 1ID3D 5AVBD 3LZ1A 1P3AD 3REHA 3AZIC 3AZKD 4WU9A 4YM6C 2AROC 1EQZC 4KUDD 5B33C 3EPLA 1ULYA 5AV8D 3B6FA 5E5AD 3KXBA 5B32B 4DQYB 3REIC 3AZID 1P34D 5B32G 3AZMC 3V9RB 3C1BB 1P3GC 1P3FB 3W97D 3B0CT 5B32C 3WTPA 1WWIA 3X1UA 4UUZB 5AV6D 4M6BA 3AYWB 4KHAB 4WNNA 3AZLD 2CV5A 3MVDA 1P3BB 5B32D 5E5AB 3AV2C 1P34B 3X1VB 3FDDA 3MNNA 1BH9B 2Y2NA 3AZND 1TAFB 2Y2IA 2Y2HA 3AZJD 3AZLC 4J8UB 1P3MA 3LELD 3MVDD 5B0YB 2L5AA 3TU4B 5CP6D 3C1CC 1B6WA 3UTBA 1P3AB 5C3IB 5B1MC 2Y2OA 3AZJC 3B6FC 3WAAC 4YS3B 5GXQC 3REHC 5B2JA 1U35C 2J8PA 2CV5D 3B0CW 3AYWA 5BNVA 3KWQB 3B0DB 1EQZD 5B33D 1TZYB 3MGQC 1KX5A 3VH6W 2BYKA 4YS3A 1P3LC 2CV5C 3AZKC 3B6GB 4QLCB 3LJAC 5B0ZC 5CPJC 1KX3B 5GT3C 1P3GD 3AN2D 5JRGB 4J8WB 3AZJB 4WU8A 1BFMA 5AV8C 5BS7A 3X1TB 4H9RB 4QLCC 3W96C 1P3LD 4LD9A 3UTAC 5B31A 1TAFA 3LJAD 1AOIA 4WU9D 4R8PD 4H9OA 5AV6A 5B2IA 4H9QB 5AVBA 5B1MA 3WA9D 4Z66B 4H9QA 3O62D 5GXQA 3MGRC 1P3MC 4H9RA 3W99D 3AFAD 4R8PC 1P3BC 2F8NG 4X23C 5BO0A 1P3IC 1S32A 4J8WC 1P3PA 5B31C 4ZBJC 4JJNC 3W99A 4LD9D 1N1JA 2XD5A 4XZQC 3AZKA 3AN2A 1HQ3C 3REHD 4Z2MH 1M18C 1M19B 4CSRA 2HIOB 3H0LC 2Y2GA 4JJND 1AOID 3AZHD 4J8VD 1HQ3D 1EQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQJ B;  5AY8 A;  1TZY D;  4NFT A;  1M19 D;  5AVC C;  3REL B;  4XZQ A;  3KWQ D;  1P3M B;  3VH5 T;  3UTA A;  4J8X A;  3UTB B;  2IO5 B;  4WNN B;  5GSU A;  5AV6 C;  5AV5 D;  1P3K C;  3WKJ D;  4KUD C;  1P3P C;  1KX4 D;  1BH8 A;  1F1E A;  3WA9 C;  3X1S A;  5CPK C;  3B6G A;  1P3G A;  3MVD B;  1P3B A;  3MNN C;  5B40 A;  4H9P B;  5B32 A;  5B24 A;  3REJ C;  3AZN B;  4YM6 B;  4AWL B;  3LJA B;  5B24 B;  3AZG A;  4XUJ B;  3AFA C;  3AV1 A;  3C1C B;  3X1S B;  5GT0 A;  3AYW D;  4XZQ D;  5AV6 B;  5B1L A;  5B2J C;  5B0Y A;  3X1V A;  5GXQ B;  3C1B D;  3WKJ B;  4G92 B;  4J8V C;  5CP6 C;  3C1C D;  5B31 G;  3UTB D;  5G49 B;  3VH5 A;  5B24 D;  4YS3 C;  3VH6 T;  5CPJ D;  5B0Z D;  2F8N K;  5F99 D;  4E45 A;  3AZK B;  4ZUX D;  3R45 A;  5GSU C;  1KX3 A;  5B0Y C;  5AV9 A;  1KX5 B;  1HQ3 B;  5DNM A;  3AZH B;  5AV9 B;  2ARO B;  3LEL B;  1P3O C;  5C3I C;  3W97 C;  2FJ7 C;  3AFA A;  3AV1 C;  1ID3 A;  5B2I C;  3WTP E;  3REH B;  5JA4 B;  3UT9 B;  4HGA C;  5B1M B;  5B40 D;  1P3B D;  1P3O D;  3KXB D;  3KSY A;  5CPI C;  3AZI A;  1R4V A;  1P3I D;  3AZG C;  3MGQ B;  4E44 A;  2YFW B;  4J8U C;  4Z66 A;  4Z5T B;  3MGS A;  1M1A C;  5B1L C;  2NQB B;  3NQU B;  3LZ1 C;  2HIO D;  3X1V C;  3AV2 A;  3AZI B;  2NQB A;  3KUY C;  1M19 A;  5B33 A;  1M1A D;  1TZY A;  5AY8 B;  3MGS D;  4LD9 B;  1S32 C;  1F66 D;  1N1J B;  3MGP D;  2IO5 C;  1P3A C;  3A6N A;  2JSS A;  3B0B A;  5B31 D;  3REI A;  1P3O A;  5JRG D;  4UUZ A;  5AY8 C;  5DNM B;  3AZH A;  3C1B C;  1P3G B;  1S32 B;  2PYO B;  2RVQ D;  4G91 B;  4Z5T D;  5GXQ D;  5DNN C;  3UT9 C;  5F99 A;  4HGA B;  4CAY B;  2NQB C;  3LZ1 B;  2NZD D;  4R8P B;  4WU9 B;  1P3P D;  1KX4 C;  1B67 A;  5FUG B;  5BNX B;  5GSU B;  4WU8 D;  1ZLA B;  3W98 B;  3MGQ A;  1KX5 C;  1JFI A;  5B1L B;  3REK B;  5CPK D;  4H9N B;  1ZLA A;  3W98 A;  2YFV A;  5B40 C;  3REK C;  2YFV B;  1KX5 D;  3TU4 D;  5FUG A;  4YM6 A;  1P3K D;  3WKJ C;  4J8U D;  3LZ0 C;  4X23 B;  4G92 C;  5BT1 D;  5F99 B;  3A6N C;  3AZF B;  3REK D;  4H9S C;  5B1L D;  5CPK B;  3V9R A;  4WU8 B;  4CAY A;  3C1B A;  3AZG B;  2CV5 B;  1ZLA D;  3B6G C;  3AZN A;  1HQ3 D;  3X1V D;  3KUY A;  5JA4 A;  3MNN D;  5AV8 A;  4QLC A;  3REL D;  2NZD B;  2BYM B;  1WWS A;  5GT0 D;  5CP6 A;  2BYM A;  1P3F D;  4J8V B;  4XZQ B;  3MVD C;  3X1S D;  4Z5T A;  4ZUX C;  4J8X B;  5B2I B;  5B2J D;  5AY8 D;  1M1A B;  1AOI C;  3B6F D;  4YM6 D;  4G91 C;  4KGC A;  1H3O A;  3AZL B;  5AVB C;  3UTB C;  3WKJ A;  2F8N A;  3W97 A;  4AWL C;  2NQB D;  5GT0 B;  3AZJ A;  3AZE B;  4XUJ C;  3AFA B;  5AVC B;  3MGQ D;  4Z66 D;  1KX3 C;  1P3I B;  3WA9 B;  4J8W A;  3REI D;  5AV8 B;  2HUE C;  3X1T C;  1P3O B;  2F8N H;  3R45 B;  3W99 C;  4JJN A;  3VH6 A;  1HQ3 A;  4Z66 C;  4X23 D;  3MGR B;  3W96 D;  1M18 A;  3UTA D;  2HIO C;  5AVB B;  5KDM A;  3AN2 B;  3WA9 A;  1U35 A;  5CPI A;  5BT1 C;  3NQU A;  1AOI B;  3AZE C;  3W98 D;  4NE6 A;  5G49 A;  1F66 C;  3MGP C;  2FJ7 B;  3WAA A;  4H9N A;  5AVC A;  3REL C;  5B0Z B;  5CPJ B;  3AZH C;  3WAA B;  5GT3 B;  1Q9C A;  5GT0 C;  5DNN A;  5B0Z A;  5CPJ A;  3LZ1 D;  1U35 D;  3REJ A;  1HTA A;  4YS3 D;  1M19 C;  5BS7 C;  4LD9 C;  4H9O B;  5AVC D;  3W96 A;  3NQJ A;  5JRG A;  3B0D C;  4KHA A;  2HUE B;  1JFI B;  1S32 D;  4NE3 A;  1P3L A;  3W99 B;  5DNM D;  1F66 A;  3LJA A;  5KDM B;  5B0Y D;  1KU5 A;  1F66 B;  4CSR B;  4Z2M G;  5F99 C;  5BO0 B;  4XUJ D;  5GT3 D;  3A6N B;  3AN2 C;  4EO5 B;  3AZM B;  3AV1 D;  5B2J B;  4H9P A;  5B2I D;  1P3L B;  4KGC D;  3X1T D;  2NZD C;  1KX3 D;  4QLC D;  3REL A;  4H9S A;  3B6G D;  2FJ7 A;  3UTA B;  3VH5 W;  3AZN C;  4DRB A;  3MGR D;  3REK A;  3AZE A;  2CWE A;  1EQZ B;  5DNN B;  3MNN B;  1H3O B;  3AZL A;  2F8N D;  3AZG D;  3C1C A;  2F8N B;  3TU4 C;  1P3M D;  3WTP B;  3X1U D;  3AZF D;  3KUY D;  1P3K B;  5AV9 D;  3AZE D;  5BNV B;  1M18 B;  4ZUX A;  5E5A A;  1P34 A;  5JRG C;  5CP6 B;  4ZUX B;  4J8X C;  2BYK B;  3AYW C;  4ZBJ B;  4JJN B;  1P3F A;  3KUY B;  1BH8 B;  3B6F B;  2NZD A;  3X1U B;  3WTP D;  1P3K A;  1ID3 C;  5GSU D;  3LEL A;  1P3A A;  4J8X D;  2RVQ C;  4Z5T C;  5DNN D;  3X1S C;  5CPK A;  2PYO C;  3KWQ C;  5GT3 A;  1BH9 A;  4WU8 C;  5B24 C;  1TZY C;  5E5A C;  3AV2 B;  1P34 C;  4KUD A;  4KGC C;  4J8U A;  3W97 B;  5AV5 C;  3AZF A;  3X1T A;  4WU9 C;  3TU4 A;  1M1A A;  3O62 B;  5CPI D;  4WZS B;  5B31 B;  4DRA A;  2YFW A;  4KGC B;  3MGP B;  1U35 B;  2LY8 A;  3O62 A;  4XUJ A;  3MGS B;  3AV1 B;  2HIO A;  3LZ0 B;  3AZM D;  3MGR A;  3LZ0 D;  4KUD B;  2PYO A;  3A6N D;  4R8P A;  2FJ7 D;  5CPI B;  4J8W D;  4J8V A;  1KX4 A;  3X1U C;  1ID3 B;  4EO5 C;  4NE5 A;  5AV5 A;  3AZF C;  1KX4 B;  3REJ D;  3KXB C;  3UT9 A;  3LEL C;  3AV2 D;  3LZ0 A;  4WV4 B;  5AV5 B;  1ZLA C;  3W98 C;  3AZM A;  3W96 B;  3O62 C;  3KWQ A;  5B33 B;  3KXB B;  1P3F C;  2ARO A;  5B1M D;  5B40 B;  1P3P B;  3WAA D;  5AV9 C;  3UT9 D;  1P3I A;  3MGP A;  3REI B;  5DNM C;  1A7W A;  5CHL B;  2ARO D;  5BNX A;  3REJ B;  3MGS C;  2PYO D;  3WTP C;  1M18 D;  1ID3 D;  5AVB D;  3LZ1 A;  1P3A D;  3REH A;  3AZI C;  3AZK D;  4WU9 A;  4YM6 C;  2ARO C;  1EQZ C;  4KUD D;  5B33 C;  1ULY A;  5AV8 D;  3B6F A;  5E5A D;  3KXB A;  5B32 B;  3AZI D;  3REI C;  1P34 D;  5B32 G;  3AZM C;  3V9R B;  3C1B B;  1P3G C;  1P3F B;  3W97 D;  3B0C T;  5B32 C;  3WTP A;  1WWI A;  3X1U A;  4UUZ B;  5AV6 D;  4M6B A;  3AYW B;  4KHA B;  4WNN A;  3AZL D;  2CV5 A;  3MVD A;  1P3B B;  5B32 D;  5E5A B;  3AV2 C;  1P34 B;  3X1V B;  3MNN A;  1BH9 B;  3AZN D;  1TAF B;  3AZJ D;  3AZL C;  4J8U B;  1P3M A;  3LEL D;  3MVD D;  5B0Y B;  2L5A A;  3TU4 B;  5CP6 D;  3C1C C;  1B6W A;  3UTB A;  1P3A B;  5C3I B;  5B1M C;  3AZJ C;  3B6F C;  3WAA C;  4YS3 B;  5GXQ C;  3REH C;  5B2J A;  1U35 C;  2CV5 D;  3B0C W;  3AYW A;  5BNV A;  3KWQ B;  3B0D B;  1EQZ D;  5B33 D;  1TZY B;  3MGQ C;  1KX5 A;  3VH6 W;  2BYK A;  4YS3 A;  1P3L C;  2CV5 C;  3AZK C;  3B6G B;  4QLC B;  3LJA C;  5B0Z C;  5CPJ C;  1KX3 B;  5GT3 C;  1P3G D;  3AN2 D;  5JRG B;  4J8W B;  3AZJ B;  4WU8 A;  1BFM A;  5AV8 C;  5BS7 A;  3X1T B;  4H9R B;  4QLC C;  3W96 C;  1P3L D;  4LD9 A;  3UTA C;  5B31 A;  1TAF A;  3LJA D;  1AOI A;  4WU9 D;  4R8P D;  4H9O A;  5AV6 A;  5B2I A;  4H9Q B;  5AVB A;  5B1M A;  3WA9 D;  4Z66 B;  4H9Q A;  3O62 D;  5GXQ A;  3MGR C;  1P3M C;  4H9R A;  3W99 D;  3AFA D;  4R8P C;  1P3B C;  2F8N G;  4X23 C;  5BO0 A;  1P3I C;  1S32 A;  4J8W C;  1P3P A;  5B31 C;  4ZBJ C;  4JJN C;  3W99 A;  4LD9 D;  1N1J A;  4XZQ C;  3AZK A;  3AN2 A;  1HQ3 C;  3REH D;  4Z2M H;  1M18 C;  1M19 B;  4CSR A;  2HIO B;  4JJN D;  1AOI D;  3AZH D;  4J8V D;  4X23 A;  1EQZ A; 
#chains in the Genus database with same CATH topology
 3NQJ B;  5AY8 A;  1TZY D;  2FFF B;  4NFT A;  1M19 D;  5AVC C;  3IP4 C;  3A1K A;  3REL B;  4XZQ A;  3KWQ D;  1P3M B;  3VH5 T;  3UTA A;  4J8X A;  3UTB B;  2IO5 B;  4WNN B;  5GSU A;  2ZY5 A;  5AV6 C;  5AV5 D;  1P3K C;  3WKJ D;  4KUD C;  1P3P C;  1KX4 D;  1BH8 A;  1PZR A;  1F1E A;  3WA9 C;  3X1S A;  5CPK C;  3B6G A;  1P3G A;  3MVD B;  1P3B A;  3MNN C;  5B40 A;  4H9P B;  5B32 A;  5B24 A;  3REJ C;  3AZN B;  4YM6 B;  4AWL B;  3LJA B;  5B24 B;  3AZG A;  4XUJ B;  3AFA C;  3AV1 A;  3C1C B;  3X1S B;  5GT0 A;  3AYW D;  4XZQ D;  3EG5 B;  5AV6 B;  2VQR A;  5B1L A;  2Y2L A;  5B2J C;  5B0Y A;  3X1V A;  5GXQ B;  3C1B D;  3WKJ B;  4G92 B;  4J8V C;  5CP6 C;  3C1C D;  5B31 G;  3UTB D;  5G49 B;  3VH5 A;  5B24 D;  4YS3 C;  3VH6 T;  5CPJ D;  5B0Z D;  2F8N K;  5F99 D;  4E45 A;  3AZK B;  4ZUX D;  3AL0 C;  3R45 A;  5GSU C;  1KX3 A;  5B0Y C;  5AV9 A;  1KX5 B;  1HQ3 B;  5DNM A;  3AZH B;  5AV9 B;  2ARO B;  3LEL B;  1P3O C;  5C3I C;  3W97 C;  2FJ7 C;  3AFA A;  3AV1 C;  1ID3 A;  5B2I C;  3WTP E;  3REH B;  5JA4 B;  3UT9 B;  4HGA C;  5B1M B;  5B40 D;  1P3B D;  1P3O D;  3KXB D;  3KSY A;  5CPI C;  2ZM5 A;  3AZI A;  1R4V A;  1P3I D;  3A1I A;  2ZY2 A;  3AZG C;  3MGQ B;  4E44 A;  2YFW B;  4J8U C;  4Z66 A;  4Z5T B;  3MGS A;  1M1A C;  5B1L C;  1T3U A;  2NQB B;  3NQU B;  3LZ1 C;  2Y2K A;  2HIO D;  3X1V C;  3AV2 A;  3AZI B;  2NQB A;  4UPK A;  3KUY C;  1M19 A;  5B33 A;  3EPK A;  1TZY A;  5AY8 B;  1M1A D;  3MGS D;  4LD9 B;  1S32 C;  1F66 D;  1N1J B;  3MGP D;  2IO5 C;  1P3A C;  3A6N A;  2JSS A;  3B0B A;  5B31 D;  3REI A;  1P3O A;  5JRG D;  4UUZ A;  5AY8 C;  5DNM B;  3AZH A;  3C1B C;  1P3G B;  1S32 B;  2PYO B;  2RVQ D;  4G91 B;  4Z5T D;  5GXQ D;  5DNN C;  3UT9 C;  5F99 A;  4HGA B;  2Y2J A;  4CAY B;  2NQB C;  3LZ1 B;  3KFU G;  2NZD D;  4R8P B;  4WU9 B;  1P3P D;  1KX4 C;  1B67 A;  5FUG B;  5BNX B;  5GSU B;  4WU8 D;  1ZLA B;  3W98 B;  3MGQ A;  1KX5 C;  1JFI A;  5B1L B;  2ZY3 A;  3REK B;  5CPK D;  4H9N B;  1ZLA A;  3W98 A;  2YFV A;  5B40 C;  4X23 A;  3REK C;  2YFV B;  1KX5 D;  3TU4 D;  5FUG A;  4YM6 A;  1P3K D;  3WKJ C;  4J8U D;  3LZ0 C;  4X23 B;  4G92 C;  5BT1 D;  5F99 B;  3A6N C;  3AZF B;  3REK D;  4H9S C;  5B1L D;  5CPK B;  3V9R A;  4WU8 B;  4CAY A;  3C1B A;  3AZG B;  2CV5 B;  1ZLA D;  3B6G C;  3AZN A;  3X1V D;  3W98 D;  3KUY A;  5JA4 A;  3MNN D;  5AV8 A;  4QLC A;  3REL D;  2NZD B;  2BYM B;  2UWX A;  1WWS A;  4WJ3 C;  5GT0 D;  5CP6 A;  2BYM A;  2DF4 C;  1P3F D;  4J8V B;  4XZQ B;  3MVD C;  3X1S D;  3EPH A;  4Z5T A;  4ZUX C;  4J8X B;  5B2I B;  2ZY4 A;  5B2J D;  5AY8 D;  1M1A B;  1AOI C;  3B6F D;  4YM6 D;  4G91 C;  1Z2C B;  4KGC A;  1H3O A;  3AZL B;  5AVB C;  3UTB C;  3WKJ A;  2F8N A;  3W97 A;  4AWL C;  2NQB D;  5GT0 B;  3AZJ A;  2G5I C;  4XUJ C;  3AFA B;  5AVC B;  3AZE B;  3MGQ D;  4Z66 D;  1KX3 C;  1P3I B;  3WA9 B;  3H0R C;  2Y2P A;  4J8W A;  3REI D;  2XD1 A;  5AV8 B;  2HUE C;  3X1T C;  1P3O B;  2F8N H;  3R45 B;  3W99 C;  4JJN A;  3VH6 A;  1HQ3 A;  4Z66 C;  4X23 D;  3MGR B;  3W96 D;  1M18 A;  3UTA D;  2HIO C;  5AVB B;  5KDM A;  3AN2 B;  3WA9 A;  1U35 A;  5CPI A;  5BT1 C;  3NQU A;  1AOI B;  3AZE C;  4NE6 A;  5G49 A;  1F66 C;  3MGP C;  2FJ7 B;  3WAA A;  4H9N A;  5AVC A;  3REL C;  5B0Z B;  5CPJ B;  3AZH C;  3WAA B;  5GT3 B;  1Q9C A;  5GT0 C;  5DNN A;  5B0Z A;  5CPJ A;  3LZ1 D;  1U35 D;  2F2A C;  3REJ A;  1HTA A;  4YS3 D;  1M19 C;  5BS7 C;  4LD9 C;  4H9O B;  5AVC D;  3W96 A;  3NQJ A;  5JRG A;  3B0D C;  4KHA A;  2HUE B;  1JFI B;  1S32 D;  4NE3 A;  1P3L A;  3W99 B;  5DNM D;  1F66 A;  3LJA A;  5KDM B;  5B0Y D;  1KU5 A;  1F66 B;  4CSR B;  4Z2M G;  5F99 C;  5BO0 B;  4XUJ D;  5GT3 D;  3A6N B;  3AN2 C;  4EO5 B;  3AZM B;  2Y2M A;  2W8S A;  3AV1 D;  5B2J B;  4H9P A;  5B2I D;  1P3L B;  4KGC D;  1W2E A;  3X1T D;  2NZD C;  1KX3 D;  4QLC D;  3REL A;  4H9S A;  3B6G D;  2FJ7 A;  3UTA B;  2BG1 A;  3VH5 W;  3AZN C;  4DRB A;  3MGR D;  3EPJ A;  3REK A;  3AZE A;  2CWE A;  1EQZ B;  5DNN B;  3MNN B;  1H3O B;  3AZL A;  2F8N D;  3AZG D;  3C1C A;  2F8N B;  3TU4 C;  1P3M D;  3WTP B;  3X1U D;  3AZF D;  2JCH A;  3KUY D;  1P3K B;  2JE5 A;  5AV9 D;  3AZE D;  5BNV B;  1M18 B;  4ZUX A;  5E5A A;  1P34 A;  5JRG C;  5CP6 B;  4ZUX B;  4J8X C;  2BYK B;  3AYW C;  4ZBJ B;  4JJN B;  1P3F A;  3KUY B;  1BH8 B;  3F6T A;  3B6F B;  2NZD A;  3X1U B;  3WTP D;  1P3K A;  1ID3 C;  5GSU D;  3LEL A;  1P3A A;  4J8X D;  2RVQ C;  4Z5T C;  5DNN D;  3X1S C;  5CPK A;  2PYO C;  3KWQ C;  5GT3 A;  3H0M C;  1BH9 A;  4WU8 C;  5B24 C;  1TZY C;  5E5A C;  3AV2 B;  1P34 C;  4KUD A;  4KGC C;  4J8U A;  3W97 B;  5AV5 C;  3AZF A;  3X1T A;  4WU9 C;  3TU4 A;  1M1A A;  3O62 B;  5CPI D;  4WZS B;  5B31 B;  2DQN C;  4DRA A;  2YFW A;  4KGC B;  3MGP B;  1U35 B;  2LY8 A;  3O62 A;  4XUJ A;  3MGS B;  3AV1 B;  2HIO A;  3LZ0 B;  3AZM D;  3MGR A;  3P5J B;  3LZ0 D;  4KUD B;  2PYO A;  3A6N D;  4R8P A;  2FJ7 D;  5CPI B;  4J8W D;  4J8V A;  1KX4 A;  2Y2Q A;  3X1U C;  4EO5 C;  1ID3 B;  4NE5 A;  5AV5 A;  3AZF C;  1KX4 B;  3REJ D;  3KXB C;  3UT9 A;  3LEL C;  3AV2 D;  3LZ0 A;  4WV4 B;  5AV5 B;  1ZLA C;  3W98 C;  3AZM A;  3W96 B;  3O62 C;  3KWQ A;  5B33 B;  3KXB B;  2G5H C;  1P3F C;  2ARO A;  5B1M D;  5B40 B;  1P3P B;  3WAA D;  5AV9 C;  3UT9 D;  1P3I A;  3MGP A;  2RIQ A;  3REI B;  5DNM C;  1A7W A;  5CHL B;  2ARO D;  5BNX A;  3REJ B;  3MGS C;  2PYO D;  3WTP C;  1M18 D;  1ID3 D;  5AVB D;  3LZ1 A;  1P3A D;  3REH A;  3AZI C;  3AZK D;  4WU9 A;  4YM6 C;  2ARO C;  1EQZ C;  4KUD D;  5B33 C;  3EPL A;  1ULY A;  5AV8 D;  3B6F A;  5E5A D;  3KXB A;  5B32 B;  4DQY B;  3REI C;  3AZI D;  1P34 D;  5B32 G;  3AZM C;  3V9R B;  3C1B B;  1P3G C;  1P3F B;  3W97 D;  3B0C T;  5B32 C;  3WTP A;  1WWI A;  3X1U A;  4UUZ B;  5AV6 D;  4M6B A;  3AYW B;  4KHA B;  4WNN A;  3AZL D;  2CV5 A;  3MVD A;  1P3B B;  5B32 D;  5E5A B;  3AV2 C;  1P34 B;  3X1V B;  3FDD A;  3MNN A;  1BH9 B;  2Y2N A;  3AZN D;  1TAF B;  2Y2I A;  2Y2H A;  3AZJ D;  3AZL C;  4J8U B;  1P3M A;  3LEL D;  3MVD D;  5B0Y B;  2L5A A;  3TU4 B;  5CP6 D;  3C1C C;  1B6W A;  3UTB A;  1P3A B;  5C3I B;  5B1M C;  2Y2O A;  3AZJ C;  3B6F C;  3WAA C;  4YS3 B;  5GXQ C;  3REH C;  5B2J A;  1U35 C;  2J8P A;  2CV5 D;  3B0C W;  3AYW A;  5BNV A;  3KWQ B;  3B0D B;  1EQZ D;  5B33 D;  1TZY B;  3MGQ C;  1KX5 A;  3VH6 W;  2BYK A;  4YS3 A;  1P3L C;  2CV5 C;  3AZK C;  3B6G B;  4QLC B;  3LJA C;  5B0Z C;  5CPJ C;  1KX3 B;  5GT3 C;  1P3G D;  3AN2 D;  5JRG B;  4J8W B;  3AZJ B;  4WU8 A;  1BFM A;  5AV8 C;  5BS7 A;  3X1T B;  4H9R B;  4QLC C;  3W96 C;  1P3L D;  4LD9 A;  3UTA C;  5B31 A;  1TAF A;  3LJA D;  1AOI A;  4WU9 D;  4R8P D;  4H9O A;  5AV6 A;  5B2I A;  4H9Q B;  5AVB A;  5B1M A;  3WA9 D;  4Z66 B;  4H9Q A;  3O62 D;  5GXQ A;  3MGR C;  1P3M C;  4H9R A;  3W99 D;  3AFA D;  4R8P C;  1P3B C;  2F8N G;  4X23 C;  5BO0 A;  1P3I C;  1S32 A;  4J8W C;  1P3P A;  5B31 C;  4ZBJ C;  4JJN C;  3W99 A;  4LD9 D;  1N1J A;  2XD5 A;  4XZQ C;  3AZK A;  3AN2 A;  1HQ3 C;  3REH D;  4Z2M H;  1M18 C;  1M19 B;  4CSR A;  2HIO B;  3H0L C;  2Y2G A;  4JJN D;  1AOI D;  3AZH D;  4J8V D;  1HQ3 D;  1EQZ A; 
#chains in the Genus database with same CATH homology
 3NQJ B;  5AY8 A;  1TZY D;  2FFF B;  4NFT A;  1M19 D;  5AVC C;  3IP4 C;  3A1K A;  3REL B;  4XZQ A;  3KWQ D;  1P3M B;  3VH5 T;  3UTA A;  4J8X A;  3UTB B;  2IO5 B;  4WNN B;  5GSU A;  2ZY5 A;  5AV6 C;  5AV5 D;  1P3K C;  3WKJ D;  4KUD C;  1P3P C;  1KX4 D;  1BH8 A;  1PZR A;  1F1E A;  3WA9 C;  3X1S A;  5CPK C;  3B6G A;  1P3G A;  3MVD B;  1P3B A;  3MNN C;  5B40 A;  4H9P B;  5B32 A;  5B24 A;  3REJ C;  3AZN B;  4YM6 B;  4AWL B;  3LJA B;  5B24 B;  3AZG A;  4XUJ B;  3AFA C;  3AV1 A;  3C1C B;  3X1S B;  5GT0 A;  3AYW D;  4XZQ D;  3EG5 B;  5AV6 B;  2VQR A;  5B1L A;  2Y2L A;  5B2J C;  5B0Y A;  3X1V A;  5GXQ B;  3C1B D;  3WKJ B;  4G92 B;  4J8V C;  5CP6 C;  3C1C D;  5B31 G;  3UTB D;  5G49 B;  3VH5 A;  5B24 D;  4YS3 C;  3VH6 T;  5CPJ D;  5B0Z D;  2F8N K;  5F99 D;  4E45 A;  3AZK B;  4ZUX D;  3AL0 C;  3R45 A;  5GSU C;  1KX3 A;  5B0Y C;  5AV9 A;  1KX5 B;  1HQ3 B;  5DNM A;  3AZH B;  5AV9 B;  2ARO B;  3LEL B;  1P3O C;  5C3I C;  3W97 C;  2FJ7 C;  3AFA A;  3AV1 C;  1ID3 A;  5B2I C;  3WTP E;  3REH B;  5JA4 B;  3UT9 B;  4HGA C;  5B1M B;  5B40 D;  1P3B D;  1P3O D;  3KXB D;  3KSY A;  5CPI C;  2ZM5 A;  3AZI A;  1R4V A;  1P3I D;  3A1I A;  2ZY2 A;  3AZG C;  3MGQ B;  4E44 A;  2YFW B;  4J8U C;  4Z66 A;  4Z5T B;  3MGS A;  1M1A C;  5B1L C;  1T3U A;  2NQB B;  3NQU B;  3LZ1 C;  2Y2K A;  2HIO D;  3X1V C;  3AV2 A;  3AZI B;  2NQB A;  4UPK A;  3KUY C;  1M19 A;  5B33 A;  3EPK A;  1TZY A;  5AY8 B;  1M1A D;  3MGS D;  4LD9 B;  1S32 C;  1F66 D;  1N1J B;  3MGP D;  2IO5 C;  1P3A C;  3A6N A;  2JSS A;  3B0B A;  5B31 D;  3REI A;  1P3O A;  5JRG D;  4UUZ A;  5AY8 C;  5DNM B;  3AZH A;  3C1B C;  1P3G B;  1S32 B;  2PYO B;  2RVQ D;  4G91 B;  4Z5T D;  5GXQ D;  5DNN C;  3UT9 C;  5F99 A;  4HGA B;  2Y2J A;  4CAY B;  2NQB C;  3LZ1 B;  3KFU G;  2NZD D;  4R8P B;  4WU9 B;  1P3P D;  1KX4 C;  1B67 A;  5FUG B;  5BNX B;  5GSU B;  4WU8 D;  1ZLA B;  3W98 B;  3MGQ A;  1KX5 C;  1JFI A;  5B1L B;  2ZY3 A;  3REK B;  5CPK D;  4H9N B;  1ZLA A;  3W98 A;  2YFV A;  5B40 C;  4X23 A;  3REK C;  2YFV B;  1KX5 D;  3TU4 D;  5FUG A;  4YM6 A;  1P3K D;  3WKJ C;  4J8U D;  3LZ0 C;  4X23 B;  4G92 C;  5BT1 D;  5F99 B;  3A6N C;  3AZF B;  3REK D;  4H9S C;  5B1L D;  5CPK B;  3V9R A;  4WU8 B;  4CAY A;  3C1B A;  3AZG B;  2CV5 B;  1ZLA D;  3B6G C;  3AZN A;  3X1V D;  3W98 D;  3KUY A;  5JA4 A;  3MNN D;  5AV8 A;  4QLC A;  3REL D;  2NZD B;  2BYM B;  2UWX A;  1WWS A;  4WJ3 C;  5GT0 D;  5CP6 A;  2BYM A;  2DF4 C;  1P3F D;  4J8V B;  4XZQ B;  3MVD C;  3X1S D;  3EPH A;  4Z5T A;  4ZUX C;  4J8X B;  5B2I B;  2ZY4 A;  5B2J D;  5AY8 D;  1M1A B;  1AOI C;  3B6F D;  4YM6 D;  4G91 C;  1Z2C B;  4KGC A;  1H3O A;  3AZL B;  5AVB C;  3UTB C;  3WKJ A;  2F8N A;  3W97 A;  4AWL C;  2NQB D;  5GT0 B;  3AZJ A;  2G5I C;  4XUJ C;  3AFA B;  5AVC B;  3AZE B;  3MGQ D;  4Z66 D;  1KX3 C;  1P3I B;  3WA9 B;  3H0R C;  2Y2P A;  4J8W A;  3REI D;  2XD1 A;  5AV8 B;  2HUE C;  3X1T C;  1P3O B;  2F8N H;  3R45 B;  3W99 C;  4JJN A;  3VH6 A;  1HQ3 A;  4Z66 C;  4X23 D;  3MGR B;  3W96 D;  1M18 A;  3UTA D;  2HIO C;  5AVB B;  5KDM A;  3AN2 B;  3WA9 A;  1U35 A;  5CPI A;  5BT1 C;  3NQU A;  1AOI B;  3AZE C;  4NE6 A;  5G49 A;  1F66 C;  3MGP C;  2FJ7 B;  3WAA A;  4H9N A;  5AVC A;  3REL C;  5B0Z B;  5CPJ B;  3AZH C;  3WAA B;  5GT3 B;  1Q9C A;  5GT0 C;  5DNN A;  5B0Z A;  5CPJ A;  3LZ1 D;  1U35 D;  2F2A C;  3REJ A;  1HTA A;  4YS3 D;  1M19 C;  5BS7 C;  4LD9 C;  4H9O B;  5AVC D;  3W96 A;  3NQJ A;  5JRG A;  3B0D C;  4KHA A;  2HUE B;  1JFI B;  1S32 D;  4NE3 A;  1P3L A;  3W99 B;  5DNM D;  1F66 A;  3LJA A;  5KDM B;  5B0Y D;  1KU5 A;  1F66 B;  4CSR B;  4Z2M G;  5F99 C;  5BO0 B;  4XUJ D;  5GT3 D;  3A6N B;  3AN2 C;  4EO5 B;  3AZM B;  2Y2M A;  2W8S A;  3AV1 D;  5B2J B;  4H9P A;  5B2I D;  1P3L B;  4KGC D;  1W2E A;  3X1T D;  2NZD C;  1KX3 D;  4QLC D;  3REL A;  4H9S A;  3B6G D;  2FJ7 A;  3UTA B;  2BG1 A;  3VH5 W;  3AZN C;  4DRB A;  3MGR D;  3EPJ A;  3REK A;  3AZE A;  2CWE A;  1EQZ B;  5DNN B;  3MNN B;  1H3O B;  3AZL A;  2F8N D;  3AZG D;  3C1C A;  2F8N B;  3TU4 C;  1P3M D;  3WTP B;  3X1U D;  3AZF D;  2JCH A;  3KUY D;  1P3K B;  2JE5 A;  5AV9 D;  3AZE D;  5BNV B;  1M18 B;  4ZUX A;  5E5A A;  1P34 A;  5JRG C;  5CP6 B;  4ZUX B;  4J8X C;  2BYK B;  3AYW C;  4ZBJ B;  4JJN B;  1P3F A;  3KUY B;  1BH8 B;  3F6T A;  3B6F B;  2NZD A;  3X1U B;  3WTP D;  1P3K A;  1ID3 C;  5GSU D;  3LEL A;  1P3A A;  4J8X D;  2RVQ C;  4Z5T C;  5DNN D;  3X1S C;  5CPK A;  2PYO C;  3KWQ C;  5GT3 A;  3H0M C;  1BH9 A;  4WU8 C;  5B24 C;  1TZY C;  5E5A C;  3AV2 B;  1P34 C;  4KUD A;  4KGC C;  4J8U A;  3W97 B;  5AV5 C;  3AZF A;  3X1T A;  4WU9 C;  3TU4 A;  1M1A A;  3O62 B;  5CPI D;  4WZS B;  5B31 B;  2DQN C;  4DRA A;  2YFW A;  4KGC B;  3MGP B;  1U35 B;  2LY8 A;  3O62 A;  4XUJ A;  3MGS B;  3AV1 B;  2HIO A;  3LZ0 B;  3AZM D;  3MGR A;  3P5J B;  3LZ0 D;  4KUD B;  2PYO A;  3A6N D;  4R8P A;  2FJ7 D;  5CPI B;  4J8W D;  4J8V A;  1KX4 A;  2Y2Q A;  3X1U C;  4EO5 C;  1ID3 B;  4NE5 A;  5AV5 A;  3AZF C;  1KX4 B;  3REJ D;  3KXB C;  3UT9 A;  3LEL C;  3AV2 D;  3LZ0 A;  4WV4 B;  5AV5 B;  1ZLA C;  3W98 C;  3AZM A;  3W96 B;  3O62 C;  3KWQ A;  5B33 B;  3KXB B;  2G5H C;  1P3F C;  2ARO A;  5B1M D;  5B40 B;  1P3P B;  3WAA D;  5AV9 C;  3UT9 D;  1P3I A;  3MGP A;  2RIQ A;  3REI B;  5DNM C;  1A7W A;  5CHL B;  2ARO D;  5BNX A;  3REJ B;  3MGS C;  2PYO D;  3WTP C;  1M18 D;  1ID3 D;  5AVB D;  3LZ1 A;  1P3A D;  3REH A;  3AZI C;  3AZK D;  4WU9 A;  4YM6 C;  2ARO C;  1EQZ C;  4KUD D;  5B33 C;  3EPL A;  1ULY A;  5AV8 D;  3B6F A;  5E5A D;  3KXB A;  5B32 B;  4DQY B;  3REI C;  3AZI D;  1P34 D;  5B32 G;  3AZM C;  3V9R B;  3C1B B;  1P3G C;  1P3F B;  3W97 D;  3B0C T;  5B32 C;  3WTP A;  1WWI A;  3X1U A;  4UUZ B;  5AV6 D;  4M6B A;  3AYW B;  4KHA B;  4WNN A;  3AZL D;  2CV5 A;  3MVD A;  1P3B B;  5B32 D;  5E5A B;  3AV2 C;  1P34 B;  3X1V B;  3FDD A;  3MNN A;  1BH9 B;  2Y2N A;  3AZN D;  1TAF B;  2Y2I A;  2Y2H A;  3AZJ D;  3AZL C;  4J8U B;  1P3M A;  3LEL D;  3MVD D;  5B0Y B;  2L5A A;  3TU4 B;  5CP6 D;  3C1C C;  1B6W A;  3UTB A;  1P3A B;  5C3I B;  5B1M C;  2Y2O A;  3AZJ C;  3B6F C;  3WAA C;  4YS3 B;  5GXQ C;  3REH C;  5B2J A;  1U35 C;  2J8P A;  2CV5 D;  3B0C W;  3AYW A;  5BNV A;  3KWQ B;  3B0D B;  1EQZ D;  5B33 D;  1TZY B;  3MGQ C;  1KX5 A;  3VH6 W;  2BYK A;  4YS3 A;  1P3L C;  2CV5 C;  3AZK C;  3B6G B;  4QLC B;  3LJA C;  5B0Z C;  5CPJ C;  1KX3 B;  5GT3 C;  1P3G D;  3AN2 D;  5JRG B;  4J8W B;  3AZJ B;  4WU8 A;  1BFM A;  5AV8 C;  5BS7 A;  3X1T B;  4H9R B;  4QLC C;  3W96 C;  1P3L D;  4LD9 A;  3UTA C;  5B31 A;  1TAF A;  3LJA D;  1AOI A;  4WU9 D;  4R8P D;  4H9O A;  5AV6 A;  5B2I A;  4H9Q B;  5AVB A;  5B1M A;  3WA9 D;  4Z66 B;  4H9Q A;  3O62 D;  5GXQ A;  3MGR C;  1P3M C;  4H9R A;  3W99 D;  3AFA D;  4R8P C;  1P3B C;  2F8N G;  4X23 C;  5BO0 A;  1P3I C;  1S32 A;  4J8W C;  1P3P A;  5B31 C;  4ZBJ C;  4JJN C;  3W99 A;  4LD9 D;  1N1J A;  2XD5 A;  4XZQ C;  3AZK A;  3AN2 A;  1HQ3 C;  3REH D;  4Z2M H;  1M18 C;  1M19 B;  4CSR A;  2HIO B;  3H0L C;  2Y2G A;  4JJN D;  1AOI D;  3AZH D;  4J8V D;  1HQ3 D;  1EQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...