1ZLAA

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaA00
5AV6C 5CPJC 4YS3C 3AZHA 3MNNA 1TZYB 4H9SA 3UTBA 3AZFD 5B1MD 5DNNA 5DNMB 4XUJD 1M19A 1S32B 2HIOD 5B32B 1KX5C 4ZUXB 2IO5C 2BYMB 5JRGA 3O62A 3A6NA 3MGQD 3B0BA 4JJNA 3X1VD 3B0CT 3B6FA 3WKJA 3AZKA 4NE6A 3AN2B 3UTAD 4WU9C 3MGSD 3MGPB 4J8VA 2YFVA 3LJAD 3X1TC 1KU5A 5BT1D 2F8NG 1KX3D 4J8WC 3REHB 3AZEA 4J8XD 3AZIA 1P34D 4YM6B 1ZLAA 3REJC 3KUYB 4UUZA 1EQZB 3AZLD 1KX5A 5BO0B 4Z5TD 5GSUB 5B0YA 1P3AB 3REKD 1U35B 3C1BB 3MVDD 5B31B 3TU4D 4DRAA 3AN2D 4Z2MG 4QLCC 3VH6T 1BH9A 3MGPD 3MGRC 5B33B 1KX4B 1AOID 5C3IB 1TAFB 5CPKB 4YM6D 3LZ0B 4WU8C 3W97A 1P3BC 3KUYD 5CPID 3X1TA 1P3AD 5B0ZA 3C1CC 5AV5B 3C1BD 3REJA 5JA4A 1P3GC 3B6GB 3VH6A 1F1EA 1P3PB 5B1LB 4G91C 3WTPC 3WAAB 5B2IB 3AV2C 5F99C 5AY8B 4H9RA 5CPKD 4XZQC 3W96D 4QLCA 1P3LC 1TZYA 5B24D 3MGRA 5AV9B 3AZMD 5DNMA 3AFAB 4H9OB 1S32A 1P3IB 2FJ7B 1M1AB 2RVQC 5B32A 3WA9C 5AVCB 5AV5D 3AV1B 2NQBC 4WNNB 2PYOB 4AWLB 3LZ1B 2CV5B 2BYMA 5AV8C 1M18C 3B0CW 5B2ID 3C1CA 4KGCA 3X1UC 5AY8D 3AZND 3KWQC 4KHAA 5FUGB 5B40D 4H9PB 5E5AC 5AV9D 3LELC 5F99A 2CWEA 4Z66A 1P3ID 4J8UC 3AZGB 5AVCD 4R8PA 3X1SD 3AV1D 3REHA 4LD9D 2AROD 5CP6D 1P3MA 1ULYA 5B2JD 5GT3D 3AZJC 1ID3D 3WA9A 5G49B 3AYWD 3AZHD 5GSUA 1U35A 4CAYB 1HQ3A 3VH6W 3MNNC 4H9SC 3UTBC 5AVBB 5AV8A 5DNND 3KXBB 1P3KB 1M19D 5B31A 3X1UA 5GXQA 3AZGD 4H9QA 5B33A 5B32G 1KX4A 4HGAC 1R4VA 5JRGC 3O62C 5E5AA 2F8NH 3LZ0A 4X23A 2HIOB 2IO5B 4JJNC 1HTAA 4WV4B 3B6FC 3WKJD 3REIC 2NZDD 3AZKC 5AVBD 3B6GA 1F66D 4J8VD 3MGQB 3AZJA 3X1VB 5CPJD 5AV6D 4YS3D 3WAAA 3AZEC 4H9NB 3AZIC 4WU9B 3UTAB 1ZLAC 3MGSB 3LJAB 4KUDC 1KX3B 1BH8B 3V9RA 5B0YC 3B0DB 5BNXA 4J8XB 1H3OB 1P34B 2FJ7A 3AZLB 5BNVB 3LZ1A 4Z5TB 5B31G 2CV5A 3REKB 3W99C 3REIA 4NE3A 3MVDB 3TU4B 4WU9D 3W97C 3AZFC 5B1MC 3X1TD 5GT0C 4XUJC 4H9PA 4J8WD 1AOIB 1P3OC 5B0ZC 1P3BB 3REJD 3UT9B 1P3FC 5CPIB 4KUDA 3R45A 4QLCD 2YFWB 1TZYC 3MGRD 1P3KA 3AV2B 1N1JB 5DNMC 3W99A 1S32C 3RELA 5B32C 4WU8D 4ZUXC 1P3BD 3W96B 3UT9D 2HUEB 5B24B 3AZFA 5B1MA 3NQUB 5KDMB 3AZMB 5GT0A 4XUJA 1P3OA 3C1CD 4KGCC 1P3GD 1P3FA 1M18B 3WTPD 3KSYA 3AV2D 4CSRA 4Z66C 3MGPC 3MGQA 3X1VA 4XZQD 3AZNB 4R8PC 2BYKB 3REHC 1P3LD 1JFIB 3W98B 5B40B 3LELB 3UTAA 1P3MC 3LJAA 1EQZC 2RVQD 4J8UB 4ZUXA 3NQJB 3X1SB 2NQBD 4LD9B 5GSUC 2AROB 5CP6B 1U35C 1HQ3C 4J8XA 1P34A 5AV8D 4J8VC 1M18D 5B2JB 4WZSB 5B31C 3VH5T 5GT3B 3AZLA 1ID3B 3X1UD 5BNVA 3AYWB 3AZHB 5GXQC 3REKA 3UTBB 5B33C 1KX4C 3KWQD 5DNNB 1M19B 5E5AD 4G92C 3TU4A 3W98D 3AN2A 3LZ0C 3LELD 4X23C 2F8ND 1WWIA 3MGPA 4J8UD 5CHLB 5JRGB 3O62B 4YM6A 5AV5C 4ZBJC 3A6NB 3B6GC 4DRBA 3KUYA 1EQZA 1P3PC 5BO0A 5B1LC 3WAAC 3WKJB 1P3AA 2NZDB 3MNND 3UTBD 3C1BA 1F66B 4J8VB 4EO5B 5AV6B 5CPJB 4YS3B 1WWSA 1N1JA 3AZIB 3AFAC 2FJ7C 1M1AC 5JRGD 1ZLAB 1TAFA 3O62D 5CPKA 3A6ND 1KX5B 2PYOC 4AWLC 3LZ1C 4JJND 2CV5C 3NQUA 3AZMA 4NE5A 3B6FD 3REID 3AZKD 5AV5A 1BH9B 1P3PA 5B1LA 3AZED 4Z2MH 5B2IA 3AZID 5AY8A 3W97B 1ZLAD 3AZNA 2BYKA 1B67A 1KX5D 3X1TB 5B40A 4J8WB 5B0YD 5AV9A 3AFAA 4H9OA 1P3IA 1M1AA 3REJB 5JA4B 5AVCA 3AV1A 4LD9A 5CP6A 4WNNA 2L5AA 2PYOA 5AVBC 1P3KC 3KXBC 3W99D 5GT3A 4H9RB 3RELC 3AYWA 4QLCB 3W97D 3MGRB 5FUGA 5GT0D 1P3OD 5B0ZD 2HIOC 4WU8B 1P3FD 3AZGA 3C1CB 4KGCB 1A7WA 3MGQC 3X1VC 1P3GB 5G49A 2NZDA 1TZYD 4KHAB 4CAYA 4G91B 3WTPB 5AVBA 3UTAC 3KXBA 5DNMD 1Q9CA 5F99B 4Z66B 1F66A 3MGSC 1S32D 3LJAC 5AV6A 5CPJA 5B32D 4XZQB 4R8PB 5BT1C 4ZUXD 4YS3A 1KX3C 2LY8A 1P3LB 3B0DC 4J8XC 1P34C 4M6BA 1P3MB 3AZLC 2HIOA 3WA9B 4KGCD 4Z5TC 2NQBB 1HQ3B 3REKC 5AV8B 3MVDC 3TU4C 3AN2C 5F99D 3X1UB 4Z66D 5GXQB 4R8PD 4H9QB 3REHD 2F8NK 3KWQB 1AOIC 4H9NA 4G92B 5E5AB 4YM6C 4WU9A 4X23B 1P3MD 2F8NB 3UT9C 3MGSA 3KUYC 1EQZD 5CPIC 3WA9D 4J8WA 1KX3A 5GSUD 1BH8A 1P3AC 1U35D 1HQ3D 1H3OA 4ZBJB 3C1BC 5B31D 3AZJB 4Z5TA 5GXQD 3MNNB 5B33D 1KX4D 5C3IC 3MVDA 5CPKC 3W96C 3LZ0D 4E44A 4X23D 2HUEC 5B24C 3V9RB 5BNXB 3AZMC 1AOIA 4HGAB 4WU8A 1P3BA 3VH5A 3B6GD 3UT9A 3AZJD 4JJNB 5CPIA 1P3PD 5B1LD 3B6FB 3WAAD 3REIB 5B2IC 3AZKB 5AY8C 1P3GA 3AZNC 2YFVB 2YFWA 3W98C 3WTPA 5B40C 3AZEB 5AV9C 3AV2A 3AFAD 2FJ7D 1P3IC 1M1AD 4XZQA 4UUZB 3W96A 5AVCC 3X1SC 3AV1C 4LD9C 1P3LA 2AROC 5CP6C 5B24A 2PYOD 4KUDB 3LZ1D 1B6WA 2CV5D 5B0YB 4NFTA 3R45B 5BS7C 5KDMA 5B2JC 4E45A 5GT3C 1ID3C 3AYWC 3AZHC 2NQBA 1BFMA 2JSSA 1M18A 5DNNC 1M19C 3W99B 3RELB 3WTPE 3AZGC 3AZFB 5B1MB 3KWQA 1JFIA 4KUDD 5GT0B 4XUJB 3W98A 2F8NA 3LELA 3A6NC 1P3OB 5B0ZB 4J8UA 1P3FB 3NQJA 3VH5W 3X1SA 3WKJC 2AROA 2NZDC 1P3KD 3KXBD 5BS7A 5B2JA 1F66C 4CSRB 4EO5C 3RELD 1ID3A
chains in the Genus database with same CATH superfamily
5AV6C 5CPJC 4YS3C 3AZHA 3MNNA 1TZYB 4H9SA 3UTBA 3AZFD 5B1MD 2J8PA 5DNNA 5DNMB 4XUJD 1M19A 1S32B 2HIOD 5B32B 1KX5C 4ZUXB 2IO5C 2ZY2A 2BYMB 5JRGA 3O62A 3A6NA 3MGQD 3B0BA 4JJNA 3X1VD 3B0CT 3B6FA 3WKJA 3AZKA 2DQNC 4NE6A 3UTAD 3AN2B 4WU9C 3MGSD 3MGPB 4J8VA 2YFVA 3LJAD 3X1TC 1KU5A 5BT1D 2F8NG 1KX3D 4J8WC 3REHB 3AZEA 4J8XD 3AZIA 1P34D 4YM6B 2Y2OA 1ZLAA 3REJC 3KUYB 4UUZA 1EQZB 3AZLD 4UPKA 1KX5A 5BO0B 4Z5TD 5GSUB 5B0YA 1P3AB 3REKD 1U35B 3C1BB 2F2AC 3MVDD 5B31B 3TU4D 4DRAA 3AN2D 4Z2MG 4QLCC 3VH6T 1BH9A 3MGPD 3MGRC 5B33B 1KX4B 1AOID 5C3IB 1TAFB 5CPKB 4YM6D 3LZ0B 4WU8C 3W97A 1P3BC 3KUYD 5CPID 3X1TA 2JCHA 1P3AD 5B0ZA 3C1CC 5AV5B 3C1BD 3REJA 5JA4A 1P3GC 3B6GB 3VH6A 1F1EA 1PZRA 1P3PB 5B1LB 4G91C 3WTPC 3WAAB 5B2IB 3AV2C 5F99C 5AY8B 4H9RA 5CPKD 4XZQC 3W96D 4QLCA 1P3LC 1TZYA 5B24D 3MGRA 5AV9B 3AZMD 5DNMA 3AFAB 4H9OB 1S32A 1P3IB 2FJ7B 1M1AB 2RVQC 5B32A 3WA9C 3AL0C 5AVCB 4DQYB 5AV5D 3AV1B 2NQBC 4WNNB 2DF4C 2PYOB 4AWLB 3FDDA 3LZ1B 2CV5B 2BYMA 5AV8C 1M18C 3B0CW 2RIQA 5B2ID 3C1CA 4KGCA 3X1UC 5AY8D 3AZND 3KWQC 4KHAA 5FUGB 5B40D 4H9PB 5E5AC 5AV9D 3LELC 3H0MC 5F99A 2CWEA 4Z66A 1P3ID 4J8UC 3AZGB 5AVCD 4R8PA 2Y2QA 3X1SD 3REHA 3AV1D 4LD9D 5CP6D 2AROD 2Y2MA 1P3MA 1ULYA 5B2JD 5GT3D 3AZJC 1ID3D 3WA9A 5G49B 3AYWD 3AZHD 5GSUA 2W8SA 4CAYB 1HQ3A 3VH6W 3MNNC 4H9SC 3EPKA 3UTBC 5AVBB 1U35A 5AV8A 5DNND 3KXBB 1P3KB 1M19D 5B31A 3X1UA 5GXQA 3AZGD 4H9QA 5B33A 5B32G 1KX4A 4HGAC 1R4VA 5JRGC 3O62C 5E5AA 2F8NH 3LZ0A 4X23A 2VQRA 2HIOB 2IO5B 4JJNC 1HTAA 4WV4B 3B6FC 3WKJD 2JE5A 3REIC 2NZDD 3AZKC 5AVBD 3B6GA 1F66D 4J8VD 3MGQB 3AZJA 3X1VB 5CPJD 5AV6D 2ZY4A 4YS3D 3WAAA 3AZEC 4H9NB 3AZIC 4WU9B 3UTAB 1ZLAC 3H0RC 3MGSB 3LJAB 4KUDC 1KX3B 1BH8B 3V9RA 5B0YC 3B0DB 5BNXA 4J8XB 1H3OB 1P34B 2FJ7A 4WJ3C 3AZLB 5BNVB 3LZ1A 4Z5TB 5B31G 2CV5A 3REKB 3F6TA 3W99C 3REIA 4NE3A 3MVDB 3TU4B 4WU9D 3W97C 2ZY5A 3AZFC 1W2EA 5B1MC 2ZY3A 3X1TD 5GT0C 4XUJC 4H9PA 4J8WD 1AOIB 1P3OC 5B0ZC 1P3BB 3REJD 3UT9B 2Y2NA 1P3FC 3KFUG 5CPIB 4KUDA 3R45A 2Y2GA 4QLCD 2YFWB 1TZYC 3MGRD 1P3KA 3AV2B 1N1JB 5DNMC 3W99A 1S32C 3H0LC 3RELA 5B32C 4WU8D 4ZUXC 1P3BD 3W96B 3UT9D 2HUEB 5B24B 3AZFA 5B1MA 3NQUB 5KDMB 3AZMB 5GT0A 4XUJA 3A1KA 3EPHA 1P3OA 3C1CD 4KGCC 1P3GD 1P3FA 1M18B 2Y2KA 3WTPD 3KSYA 3AV2D 4CSRA 4Z66C 3MGPC 3MGQA 3X1VA 4XZQD 3AZNB 4R8PC 2BYKB 3REHC 1P3LD 1JFIB 3W98B 5B40B 3LELB 3UTAA 1P3MC 3LJAA 1EQZC 2RVQD 4J8UB 3EPLA 4ZUXA 3NQJB 3X1SB 2NQBD 4LD9B 5GSUC 2AROB 5CP6B 1U35C 1HQ3C 4J8XA 1P34A 5AV8D 4J8VC 1M18D 5B2JB 4WZSB 5B31C 3VH5T 5GT3B 3AZLA 1ID3B 3X1UD 5BNVA 3AYWB 3AZHB 2Y2HA 5GXQC 3REKA 2BG1A 3UTBB 5B33C 1KX4C 3KWQD 5DNNB 1M19B 5E5AD 4G92C 3TU4A 3W98D 3AN2A 3LZ0C 3LELD 4X23C 2F8ND 1WWIA 3IP4C 3MGPA 2Y2LA 4J8UD 5CHLB 5JRGB 3O62B 4YM6A 3A1IA 5AV5C 4ZBJC 3A6NB 3B6GC 4DRBA 3KUYA 1EQZA 1P3PC 5BO0A 5B1LC 3WAAC 3WKJB 1P3AA 2Y2JA 2NZDB 3MNND 3UTBD 3C1BA 1F66B 4J8VB 4EO5B 5AV6B 5CPJB 4YS3B 1WWSA 1N1JA 3AZIB 3AFAC 2FJ7C 1M1AC 5JRGD 1ZLAB 2Y2PA 1TAFA 3O62D 5CPKA 3A6ND 1KX5B 2PYOC 4AWLC 3LZ1C 4JJND 2CV5C 3NQUA 3AZMA 4NE5A 3B6FD 3REID 3AZKD 5AV5A 1BH9B 1P3PA 5B1LA 3AZED 4Z2MH 5B2IA 3AZID 5AY8A 3W97B 1ZLAD 3AZNA 2BYKA 1B67A 1KX5D 3X1TB 2G5HC 5B40A 4J8WB 5B0YD 5AV9A 3AFAA 4H9OA 1P3IA 2XD1A 1M1AA 3REJB 5JA4B 5AVCA 3AV1A 4LD9A 5CP6A 4WNNA 2L5AA 2PYOA 5AVBC 1P3KC 3KXBC 3W99D 5GT3A 4H9RB 3RELC 3AYWA 4QLCB 3W97D 3MGRB 5FUGA 5GT0D 1P3OD 5B0ZD 2HIOC 4WU8B 1P3FD 3AZGA 2UWXA 3C1CB 4KGCB 1A7WA 3MGQC 1T3UA 3X1VC 1P3GB 5G49A 2NZDA 1TZYD 4KHAB 4CAYA 4G91B 3WTPB 5AVBA 3UTAC 3KXBA 5DNMD 1Q9CA 5F99B 4Z66B 1F66A 3MGSC 1S32D 3LJAC 5AV6A 5CPJA 5B32D 4XZQB 4R8PB 5BT1C 4ZUXD 4YS3A 1KX3C 2LY8A 1P3LB 3B0DC 4J8XC 1P34C 4M6BA 1P3MB 3AZLC 2HIOA 3WA9B 4KGCD 4Z5TC 2NQBB 1HQ3B 3REKC 5AV8B 3MVDC 3TU4C 3AN2C 5F99D 3X1UB 4Z66D 5GXQB 4R8PD 4H9QB 3REHD 2F8NK 3KWQB 1AOIC 4H9NA 4G92B 5E5AB 4YM6C 4WU9A 4X23B 1P3MD 2F8NB 3UT9C 3MGSA 3KUYC 2FFFB 1EQZD 5CPIC 1Z2CB 3WA9D 4J8WA 1KX3A 5GSUD 1BH8A 1P3AC 1U35D 1HQ3D 1H3OA 2ZM5A 4ZBJB 3C1BC 5B31D 2G5IC 3AZJB 4Z5TA 5GXQD 3EG5B 3MNNB 5B33D 1KX4D 5C3IC 3MVDA 5CPKC 3W96C 3LZ0D 4E44A 4X23D 2HUEC 5B24C 3V9RB 5BNXB 3AZMC 1AOIA 4HGAB 4WU8A 1P3BA 3VH5A 3B6GD 3UT9A 3AZJD 4JJNB 5CPIA 1P3PD 5B1LD 3B6FB 3WAAD 3REIB 5B2IC 3P5JB 3AZKB 5AY8C 1P3GA 3AZNC 2YFVB 2YFWA 3EPJA 3W98C 3WTPA 5B40C 3AZEB 5AV9C 3AV2A 3AFAD 2FJ7D 1P3IC 1M1AD 4XZQA 4UUZB 3W96A 5AVCC 3X1SC 3AV1C 4LD9C 1P3LA 2AROC 5CP6C 5B24A 2PYOD 4KUDB 3LZ1D 1B6WA 2CV5D 5B0YB 4NFTA 3R45B 5BS7C 5KDMA 5B2JC 4E45A 5GT3C 1ID3C 3AYWC 3AZHC 2NQBA 1BFMA 2JSSA 1M18A 5DNNC 2XD5A 1M19C 3W99B 3RELB 3WTPE 3AZGC 3AZFB 5B1MB 3KWQA 1JFIA 4KUDD 5GT0B 4XUJB 3W98A 2F8NA 3LELA 3A6NC 1P3OB 5B0ZB 4J8UA 1P3FB 3NQJA 3VH5W 3X1SA 3WKJC 2AROA 2NZDC 2Y2IA 1P3KD 3KXBD 5BS7A 5B2JA 1F66C 4CSRB 4EO5C 3RELD 1ID3A
chains in the Genus database with same CATH topology
5AV6C 5CPJC 4YS3C 3AZHA 3MNNA 1TZYB 4H9SA 3UTBA 3AZFD 5B1MD 2J8PA 5DNNA 5DNMB 4XUJD 1M19A 1S32B 2HIOD 5B32B 1KX5C 4ZUXB 2IO5C 2ZY2A 2BYMB 5JRGA 3O62A 3A6NA 3MGQD 3B0BA 4JJNA 3X1VD 3B0CT 3B6FA 3WKJA 3AZKA 2DQNC 4NE6A 3UTAD 3AN2B 4WU9C 3MGSD 3MGPB 4J8VA 2YFVA 3LJAD 3X1TC 1KU5A 5BT1D 2F8NG 1KX3D 4J8WC 3REHB 3AZEA 4J8XD 3AZIA 1P34D 4YM6B 2Y2OA 1ZLAA 3REJC 3KUYB 4UUZA 1EQZB 3AZLD 4UPKA 1KX5A 5BO0B 4Z5TD 5GSUB 5B0YA 1P3AB 3REKD 1U35B 3C1BB 2F2AC 3MVDD 5B31B 3TU4D 4DRAA 3AN2D 4Z2MG 4QLCC 3VH6T 1BH9A 3MGPD 3MGRC 5B33B 1KX4B 1AOID 5C3IB 1TAFB 5CPKB 4YM6D 3LZ0B 4WU8C 3W97A 1P3BC 3KUYD 5CPID 3X1TA 2JCHA 1P3AD 5B0ZA 3C1CC 5AV5B 3C1BD 3REJA 5JA4A 1P3GC 3B6GB 3VH6A 1F1EA 1PZRA 1P3PB 5B1LB 4G91C 3WTPC 3WAAB 5B2IB 3AV2C 5F99C 5AY8B 4H9RA 5CPKD 4XZQC 3W96D 4QLCA 1P3LC 1TZYA 5B24D 3MGRA 5AV9B 3AZMD 5DNMA 3AFAB 4H9OB 1S32A 1P3IB 2FJ7B 1M1AB 2RVQC 5B32A 3WA9C 3AL0C 5AVCB 4DQYB 5AV5D 3AV1B 2NQBC 4WNNB 2DF4C 2PYOB 4AWLB 3FDDA 3LZ1B 2CV5B 2BYMA 5AV8C 1M18C 3B0CW 2RIQA 5B2ID 3C1CA 4KGCA 3X1UC 5AY8D 3AZND 3KWQC 4KHAA 5FUGB 5B40D 4H9PB 5E5AC 5AV9D 3LELC 3H0MC 5F99A 2CWEA 4Z66A 1P3ID 4J8UC 3AZGB 5AVCD 4R8PA 2Y2QA 3X1SD 3REHA 3AV1D 4LD9D 5CP6D 2AROD 2Y2MA 1P3MA 1ULYA 5B2JD 5GT3D 3AZJC 1ID3D 3WA9A 5G49B 3AYWD 3AZHD 5GSUA 2W8SA 4CAYB 1HQ3A 3VH6W 3MNNC 4H9SC 3EPKA 3UTBC 5AVBB 1U35A 5AV8A 5DNND 3KXBB 1P3KB 1M19D 5B31A 3X1UA 5GXQA 3AZGD 4H9QA 5B33A 5B32G 1KX4A 4HGAC 1R4VA 5JRGC 3O62C 5E5AA 2F8NH 3LZ0A 4X23A 2VQRA 2HIOB 2IO5B 4JJNC 1HTAA 4WV4B 3B6FC 3WKJD 2JE5A 3REIC 2NZDD 3AZKC 5AVBD 3B6GA 1F66D 4J8VD 3MGQB 3AZJA 3X1VB 5CPJD 5AV6D 2ZY4A 4YS3D 3WAAA 3AZEC 4H9NB 3AZIC 4WU9B 3UTAB 1ZLAC 3H0RC 3MGSB 3LJAB 4KUDC 1KX3B 1BH8B 3V9RA 5B0YC 3B0DB 5BNXA 4J8XB 1H3OB 1P34B 2FJ7A 4WJ3C 3AZLB 5BNVB 3LZ1A 4Z5TB 5B31G 2CV5A 3REKB 3F6TA 3W99C 3REIA 4NE3A 3MVDB 3TU4B 4WU9D 3W97C 2ZY5A 3AZFC 1W2EA 5B1MC 2ZY3A 3X1TD 5GT0C 4XUJC 4H9PA 4J8WD 1AOIB 1P3OC 5B0ZC 1P3BB 3REJD 3UT9B 2Y2NA 1P3FC 3KFUG 5CPIB 4KUDA 3R45A 2Y2GA 4QLCD 2YFWB 1TZYC 3MGRD 1P3KA 3AV2B 1N1JB 5DNMC 3W99A 1S32C 3H0LC 3RELA 5B32C 4WU8D 4ZUXC 1P3BD 3W96B 3UT9D 2HUEB 5B24B 3AZFA 5B1MA 3NQUB 5KDMB 3AZMB 5GT0A 4XUJA 3A1KA 3EPHA 1P3OA 3C1CD 4KGCC 1P3GD 1P3FA 1M18B 2Y2KA 3WTPD 3KSYA 3AV2D 4CSRA 4Z66C 3MGPC 3MGQA 3X1VA 4XZQD 3AZNB 4R8PC 2BYKB 3REHC 1P3LD 1JFIB 3W98B 5B40B 3LELB 3UTAA 1P3MC 3LJAA 1EQZC 2RVQD 4J8UB 3EPLA 4ZUXA 3NQJB 3X1SB 2NQBD 4LD9B 5GSUC 2AROB 5CP6B 1U35C 1HQ3C 4J8XA 1P34A 5AV8D 4J8VC 1M18D 5B2JB 4WZSB 5B31C 3VH5T 5GT3B 3AZLA 1ID3B 3X1UD 5BNVA 3AYWB 3AZHB 2Y2HA 5GXQC 3REKA 2BG1A 3UTBB 5B33C 1KX4C 3KWQD 5DNNB 1M19B 5E5AD 4G92C 3TU4A 3W98D 3AN2A 3LZ0C 3LELD 4X23C 2F8ND 1WWIA 3IP4C 3MGPA 2Y2LA 4J8UD 5CHLB 5JRGB 3O62B 4YM6A 3A1IA 5AV5C 4ZBJC 3A6NB 3B6GC 4DRBA 3KUYA 1EQZA 1P3PC 5BO0A 5B1LC 3WAAC 3WKJB 1P3AA 2Y2JA 2NZDB 3MNND 3UTBD 3C1BA 1F66B 4J8VB 4EO5B 5AV6B 5CPJB 4YS3B 1WWSA 1N1JA 3AZIB 3AFAC 2FJ7C 1M1AC 5JRGD 1ZLAB 2Y2PA 1TAFA 3O62D 5CPKA 3A6ND 1KX5B 2PYOC 4AWLC 3LZ1C 4JJND 2CV5C 3NQUA 3AZMA 4NE5A 3B6FD 3REID 3AZKD 5AV5A 1BH9B 1P3PA 5B1LA 3AZED 4Z2MH 5B2IA 3AZID 5AY8A 3W97B 1ZLAD 3AZNA 2BYKA 1B67A 1KX5D 3X1TB 2G5HC 5B40A 4J8WB 5B0YD 5AV9A 3AFAA 4H9OA 1P3IA 2XD1A 1M1AA 3REJB 5JA4B 5AVCA 3AV1A 4LD9A 5CP6A 4WNNA 2L5AA 2PYOA 5AVBC 1P3KC 3KXBC 3W99D 5GT3A 4H9RB 3RELC 3AYWA 4QLCB 3W97D 3MGRB 5FUGA 5GT0D 1P3OD 5B0ZD 2HIOC 4WU8B 1P3FD 3AZGA 2UWXA 3C1CB 4KGCB 1A7WA 3MGQC 1T3UA 3X1VC 1P3GB 5G49A 2NZDA 1TZYD 4KHAB 4CAYA 4G91B 3WTPB 5AVBA 3UTAC 3KXBA 5DNMD 1Q9CA 5F99B 4Z66B 1F66A 3MGSC 1S32D 3LJAC 5AV6A 5CPJA 5B32D 4XZQB 4R8PB 5BT1C 4ZUXD 4YS3A 1KX3C 2LY8A 1P3LB 3B0DC 4J8XC 1P34C 4M6BA 1P3MB 3AZLC 2HIOA 3WA9B 4KGCD 4Z5TC 2NQBB 1HQ3B 3REKC 5AV8B 3MVDC 3TU4C 3AN2C 5F99D 3X1UB 4Z66D 5GXQB 4R8PD 4H9QB 3REHD 2F8NK 3KWQB 1AOIC 4H9NA 4G92B 5E5AB 4YM6C 4WU9A 4X23B 1P3MD 2F8NB 3UT9C 3MGSA 3KUYC 2FFFB 1EQZD 5CPIC 1Z2CB 3WA9D 4J8WA 1KX3A 5GSUD 1BH8A 1P3AC 1U35D 1HQ3D 1H3OA 2ZM5A 4ZBJB 3C1BC 5B31D 2G5IC 3AZJB 4Z5TA 5GXQD 3EG5B 3MNNB 5B33D 1KX4D 5C3IC 3MVDA 5CPKC 3W96C 3LZ0D 4E44A 4X23D 2HUEC 5B24C 3V9RB 5BNXB 3AZMC 1AOIA 4HGAB 4WU8A 1P3BA 3VH5A 3B6GD 3UT9A 3AZJD 4JJNB 5CPIA 1P3PD 5B1LD 3B6FB 3WAAD 3REIB 5B2IC 3P5JB 3AZKB 5AY8C 1P3GA 3AZNC 2YFVB 2YFWA 3EPJA 3W98C 3WTPA 5B40C 3AZEB 5AV9C 3AV2A 3AFAD 2FJ7D 1P3IC 1M1AD 4XZQA 4UUZB 3W96A 5AVCC 3X1SC 3AV1C 4LD9C 1P3LA 2AROC 5CP6C 5B24A 2PYOD 4KUDB 3LZ1D 1B6WA 2CV5D 5B0YB 4NFTA 3R45B 5BS7C 5KDMA 5B2JC 4E45A 5GT3C 1ID3C 3AYWC 3AZHC 2NQBA 1BFMA 2JSSA 1M18A 5DNNC 2XD5A 1M19C 3W99B 3RELB 3WTPE 3AZGC 3AZFB 5B1MB 3KWQA 1JFIA 4KUDD 5GT0B 4XUJB 3W98A 2F8NA 3LELA 3A6NC 1P3OB 5B0ZB 4J8UA 1P3FB 3NQJA 3VH5W 3X1SA 3WKJC 2AROA 2NZDC 2Y2IA 1P3KD 3KXBD 5BS7A 5B2JA 1F66C 4CSRB 4EO5C 3RELD 1ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 C;  5CPJ C;  4YS3 C;  3AZH A;  3MNN A;  1TZY B;  4H9S A;  3UTB A;  3AZF D;  5B1M D;  5DNN A;  5DNM B;  4XUJ D;  1M19 A;  1S32 B;  2HIO D;  5B32 B;  1KX5 C;  4ZUX B;  2IO5 C;  2BYM B;  5JRG A;  3O62 A;  3A6N A;  3MGQ D;  3B0B A;  4JJN A;  3X1V D;  3B0C T;  3B6F A;  3WKJ A;  3AZK A;  4NE6 A;  3AN2 B;  3UTA D;  4WU9 C;  3MGS D;  3MGP B;  4J8V A;  2YFV A;  3LJA D;  3X1T C;  1KU5 A;  5BT1 D;  2F8N G;  1KX3 D;  4J8W C;  3REH B;  3AZE A;  4J8X D;  3AZI A;  1P34 D;  4YM6 B;  1ZLA A;  3REJ C;  3KUY B;  4UUZ A;  1EQZ B;  3AZL D;  1KX5 A;  5BO0 B;  4Z5T D;  5GSU B;  5B0Y A;  1P3A B;  3REK D;  1U35 B;  3C1B B;  3MVD D;  5B31 B;  3TU4 D;  4DRA A;  3AN2 D;  4Z2M G;  4QLC C;  3VH6 T;  1BH9 A;  3MGP D;  3MGR C;  5B33 B;  1KX4 B;  1AOI D;  5C3I B;  1TAF B;  5CPK B;  4YM6 D;  3LZ0 B;  4WU8 C;  3W97 A;  1P3B C;  3KUY D;  5CPI D;  3X1T A;  1P3A D;  5B0Z A;  3C1C C;  5AV5 B;  3C1B D;  3REJ A;  5JA4 A;  1P3G C;  3B6G B;  3VH6 A;  1F1E A;  1P3P B;  5B1L B;  4G91 C;  3WTP C;  3WAA B;  5B2I B;  3AV2 C;  5F99 C;  5AY8 B;  4H9R A;  5CPK D;  4XZQ C;  3W96 D;  4QLC A;  1P3L C;  1TZY A;  5B24 D;  3MGR A;  5AV9 B;  3AZM D;  5DNM A;  3AFA B;  4H9O B;  1S32 A;  1P3I B;  2FJ7 B;  1M1A B;  2RVQ C;  5B32 A;  3WA9 C;  5AVC B;  5AV5 D;  3AV1 B;  2NQB C;  4WNN B;  2PYO B;  4AWL B;  3LZ1 B;  2CV5 B;  2BYM A;  5AV8 C;  1M18 C;  3B0C W;  5B2I D;  3C1C A;  4KGC A;  3X1U C;  5AY8 D;  3AZN D;  3KWQ C;  4KHA A;  5FUG B;  5B40 D;  4H9P B;  5E5A C;  5AV9 D;  3LEL C;  5F99 A;  2CWE A;  4Z66 A;  1P3I D;  4J8U C;  3AZG B;  5AVC D;  4R8P A;  3X1S D;  3AV1 D;  3REH A;  4LD9 D;  2ARO D;  5CP6 D;  1P3M A;  1ULY A;  5B2J D;  5GT3 D;  3AZJ C;  1ID3 D;  3WA9 A;  5G49 B;  3AYW D;  3AZH D;  5GSU A;  1U35 A;  4CAY B;  1HQ3 A;  3VH6 W;  3MNN C;  4H9S C;  3UTB C;  5AVB B;  5AV8 A;  5DNN D;  3KXB B;  1P3K B;  1M19 D;  5B31 A;  3X1U A;  5GXQ A;  3AZG D;  4H9Q A;  5B33 A;  5B32 G;  1KX4 A;  4HGA C;  1R4V A;  5JRG C;  3O62 C;  5E5A A;  2F8N H;  3LZ0 A;  4X23 A;  2HIO B;  2IO5 B;  4JJN C;  1HTA A;  4WV4 B;  3B6F C;  3WKJ D;  3REI C;  2NZD D;  3AZK C;  5AVB D;  3B6G A;  1F66 D;  4J8V D;  3MGQ B;  3AZJ A;  3X1V B;  5CPJ D;  5AV6 D;  4YS3 D;  3WAA A;  3AZE C;  4H9N B;  3AZI C;  4WU9 B;  3UTA B;  1ZLA C;  3MGS B;  3LJA B;  4KUD C;  1KX3 B;  1BH8 B;  3V9R A;  5B0Y C;  3B0D B;  5BNX A;  4J8X B;  1H3O B;  1P34 B;  2FJ7 A;  3AZL B;  5BNV B;  3LZ1 A;  4Z5T B;  5B31 G;  2CV5 A;  3REK B;  3W99 C;  3REI A;  4NE3 A;  3MVD B;  3TU4 B;  4WU9 D;  3W97 C;  3AZF C;  5B1M C;  3X1T D;  5GT0 C;  4XUJ C;  4H9P A;  4J8W D;  1AOI B;  1P3O C;  5B0Z C;  1P3B B;  3REJ D;  3UT9 B;  1P3F C;  5CPI B;  4KUD A;  3R45 A;  4QLC D;  2YFW B;  1TZY C;  3MGR D;  1P3K A;  3AV2 B;  1N1J B;  5DNM C;  3W99 A;  1S32 C;  3REL A;  5B32 C;  4WU8 D;  4ZUX C;  1P3B D;  3W96 B;  3UT9 D;  2HUE B;  5B24 B;  3AZF A;  5B1M A;  3NQU B;  5KDM B;  3AZM B;  5GT0 A;  4XUJ A;  1P3O A;  3C1C D;  4KGC C;  1P3G D;  1P3F A;  1M18 B;  3WTP D;  3KSY A;  3AV2 D;  4CSR A;  4Z66 C;  3MGP C;  3MGQ A;  3X1V A;  4XZQ D;  3AZN B;  4R8P C;  2BYK B;  3REH C;  1P3L D;  1JFI B;  3W98 B;  5B40 B;  3LEL B;  3UTA A;  1P3M C;  3LJA A;  1EQZ C;  2RVQ D;  4J8U B;  4ZUX A;  3NQJ B;  3X1S B;  2NQB D;  4LD9 B;  5GSU C;  2ARO B;  5CP6 B;  1U35 C;  1HQ3 C;  4J8X A;  1P34 A;  5AV8 D;  4J8V C;  1M18 D;  5B2J B;  4WZS B;  5B31 C;  3VH5 T;  5GT3 B;  3AZL A;  1ID3 B;  3X1U D;  5BNV A;  3AYW B;  3AZH B;  5GXQ C;  3REK A;  3UTB B;  5B33 C;  1KX4 C;  3KWQ D;  5DNN B;  1M19 B;  5E5A D;  4G92 C;  3TU4 A;  3W98 D;  3AN2 A;  3LZ0 C;  3LEL D;  4X23 C;  2F8N D;  1WWI A;  3MGP A;  4J8U D;  5CHL B;  5JRG B;  3O62 B;  4YM6 A;  5AV5 C;  4ZBJ C;  3A6N B;  3B6G C;  4DRB A;  3KUY A;  1EQZ A;  1P3P C;  5BO0 A;  5B1L C;  3WAA C;  3WKJ B;  1P3A A;  2NZD B;  3MNN D;  3UTB D;  3C1B A;  1F66 B;  4J8V B;  4EO5 B;  5AV6 B;  5CPJ B;  4YS3 B;  1WWS A;  1N1J A;  3AZI B;  3AFA C;  2FJ7 C;  1M1A C;  5JRG D;  1ZLA B;  1TAF A;  3O62 D;  5CPK A;  3A6N D;  1KX5 B;  2PYO C;  4AWL C;  3LZ1 C;  4JJN D;  2CV5 C;  3NQU A;  3AZM A;  4NE5 A;  3B6F D;  3REI D;  3AZK D;  5AV5 A;  1BH9 B;  1P3P A;  5B1L A;  3AZE D;  4Z2M H;  5B2I A;  3AZI D;  5AY8 A;  3W97 B;  1ZLA D;  3AZN A;  2BYK A;  1B67 A;  1KX5 D;  3X1T B;  5B40 A;  4J8W B;  5B0Y D;  5AV9 A;  3AFA A;  4H9O A;  1P3I A;  1M1A A;  3REJ B;  5JA4 B;  5AVC A;  3AV1 A;  4LD9 A;  5CP6 A;  4WNN A;  2L5A A;  2PYO A;  5AVB C;  1P3K C;  3KXB C;  3W99 D;  5GT3 A;  4H9R B;  3REL C;  3AYW A;  4QLC B;  3W97 D;  3MGR B;  5FUG A;  5GT0 D;  1P3O D;  5B0Z D;  2HIO C;  4WU8 B;  1P3F D;  3AZG A;  3C1C B;  4KGC B;  1A7W A;  3MGQ C;  3X1V C;  1P3G B;  5G49 A;  2NZD A;  1TZY D;  4KHA B;  4CAY A;  4G91 B;  3WTP B;  5AVB A;  3UTA C;  3KXB A;  5DNM D;  1Q9C A;  5F99 B;  4Z66 B;  1F66 A;  3MGS C;  1S32 D;  3LJA C;  5AV6 A;  5CPJ A;  5B32 D;  4XZQ B;  4R8P B;  5BT1 C;  4ZUX D;  4YS3 A;  1KX3 C;  2LY8 A;  1P3L B;  3B0D C;  4J8X C;  1P34 C;  4M6B A;  1P3M B;  3AZL C;  2HIO A;  3WA9 B;  4KGC D;  4Z5T C;  2NQB B;  1HQ3 B;  3REK C;  5AV8 B;  3MVD C;  3TU4 C;  3AN2 C;  5F99 D;  3X1U B;  4Z66 D;  5GXQ B;  4R8P D;  4H9Q B;  3REH D;  2F8N K;  3KWQ B;  1AOI C;  4H9N A;  4G92 B;  5E5A B;  4YM6 C;  4WU9 A;  4X23 B;  1P3M D;  2F8N B;  3UT9 C;  3MGS A;  3KUY C;  1EQZ D;  5CPI C;  3WA9 D;  4J8W A;  1KX3 A;  5GSU D;  1BH8 A;  1P3A C;  1U35 D;  1HQ3 D;  1H3O A;  4ZBJ B;  3C1B C;  5B31 D;  3AZJ B;  4Z5T A;  5GXQ D;  3MNN B;  5B33 D;  1KX4 D;  5C3I C;  3MVD A;  5CPK C;  3W96 C;  3LZ0 D;  4E44 A;  4X23 D;  2HUE C;  5B24 C;  3V9R B;  5BNX B;  3AZM C;  1AOI A;  4HGA B;  4WU8 A;  1P3B A;  3VH5 A;  3B6G D;  3UT9 A;  3AZJ D;  4JJN B;  5CPI A;  1P3P D;  5B1L D;  3B6F B;  3WAA D;  3REI B;  5B2I C;  3AZK B;  5AY8 C;  1P3G A;  3AZN C;  2YFV B;  2YFW A;  3W98 C;  3WTP A;  5B40 C;  3AZE B;  5AV9 C;  3AV2 A;  3AFA D;  2FJ7 D;  1P3I C;  1M1A D;  4XZQ A;  4UUZ B;  3W96 A;  5AVC C;  3X1S C;  3AV1 C;  4LD9 C;  1P3L A;  2ARO C;  5CP6 C;  5B24 A;  2PYO D;  4KUD B;  3LZ1 D;  1B6W A;  2CV5 D;  5B0Y B;  4NFT A;  3R45 B;  5BS7 C;  5KDM A;  5B2J C;  4E45 A;  5GT3 C;  1ID3 C;  3AYW C;  3AZH C;  2NQB A;  1BFM A;  2JSS A;  1M18 A;  5DNN C;  1M19 C;  3W99 B;  3REL B;  3WTP E;  3AZG C;  3AZF B;  5B1M B;  3KWQ A;  1JFI A;  4KUD D;  5GT0 B;  4XUJ B;  3W98 A;  2F8N A;  3LEL A;  3A6N C;  1P3O B;  5B0Z B;  4J8U A;  1P3F B;  3NQJ A;  3VH5 W;  3X1S A;  3WKJ C;  2ARO A;  2NZD C;  1P3K D;  3KXB D;  5BS7 A;  5B2J A;  1F66 C;  4CSR B;  4EO5 C;  3REL D;  1ID3 A; 
#chains in the Genus database with same CATH topology
 5AV6 C;  5CPJ C;  4YS3 C;  3AZH A;  3MNN A;  1TZY B;  4H9S A;  3UTB A;  3AZF D;  5B1M D;  2J8P A;  5DNN A;  5DNM B;  4XUJ D;  1M19 A;  1S32 B;  2HIO D;  5B32 B;  1KX5 C;  4ZUX B;  2IO5 C;  2ZY2 A;  2BYM B;  5JRG A;  3O62 A;  3A6N A;  3MGQ D;  3B0B A;  4JJN A;  3X1V D;  3B0C T;  3B6F A;  3WKJ A;  3AZK A;  2DQN C;  4NE6 A;  3UTA D;  3AN2 B;  4WU9 C;  3MGS D;  3MGP B;  4J8V A;  2YFV A;  3LJA D;  3X1T C;  1KU5 A;  5BT1 D;  2F8N G;  1KX3 D;  4J8W C;  3REH B;  3AZE A;  4J8X D;  3AZI A;  1P34 D;  4YM6 B;  2Y2O A;  1ZLA A;  3REJ C;  3KUY B;  4UUZ A;  1EQZ B;  3AZL D;  4UPK A;  1KX5 A;  5BO0 B;  4Z5T D;  5GSU B;  5B0Y A;  1P3A B;  3REK D;  1U35 B;  3C1B B;  2F2A C;  3MVD D;  5B31 B;  3TU4 D;  4DRA A;  3AN2 D;  4Z2M G;  4QLC C;  3VH6 T;  1BH9 A;  3MGP D;  3MGR C;  5B33 B;  1KX4 B;  1AOI D;  5C3I B;  1TAF B;  5CPK B;  4YM6 D;  3LZ0 B;  4WU8 C;  3W97 A;  1P3B C;  3KUY D;  5CPI D;  3X1T A;  2JCH A;  1P3A D;  5B0Z A;  3C1C C;  5AV5 B;  3C1B D;  3REJ A;  5JA4 A;  1P3G C;  3B6G B;  3VH6 A;  1F1E A;  1PZR A;  1P3P B;  5B1L B;  4G91 C;  3WTP C;  3WAA B;  5B2I B;  3AV2 C;  5F99 C;  5AY8 B;  4H9R A;  5CPK D;  4XZQ C;  3W96 D;  4QLC A;  1P3L C;  1TZY A;  5B24 D;  3MGR A;  5AV9 B;  3AZM D;  5DNM A;  3AFA B;  4H9O B;  1S32 A;  1P3I B;  2FJ7 B;  1M1A B;  2RVQ C;  5B32 A;  3WA9 C;  3AL0 C;  5AVC B;  4DQY B;  5AV5 D;  3AV1 B;  2NQB C;  4WNN B;  2DF4 C;  2PYO B;  4AWL B;  3FDD A;  3LZ1 B;  2CV5 B;  2BYM A;  5AV8 C;  1M18 C;  3B0C W;  2RIQ A;  5B2I D;  3C1C A;  4KGC A;  3X1U C;  5AY8 D;  3AZN D;  3KWQ C;  4KHA A;  5FUG B;  5B40 D;  4H9P B;  5E5A C;  5AV9 D;  3LEL C;  3H0M C;  5F99 A;  2CWE A;  4Z66 A;  1P3I D;  4J8U C;  3AZG B;  5AVC D;  4R8P A;  2Y2Q A;  3X1S D;  3REH A;  3AV1 D;  4LD9 D;  5CP6 D;  2ARO D;  2Y2M A;  1P3M A;  1ULY A;  5B2J D;  5GT3 D;  3AZJ C;  1ID3 D;  3WA9 A;  5G49 B;  3AYW D;  3AZH D;  5GSU A;  2W8S A;  4CAY B;  1HQ3 A;  3VH6 W;  3MNN C;  4H9S C;  3EPK A;  3UTB C;  5AVB B;  1U35 A;  5AV8 A;  5DNN D;  3KXB B;  1P3K B;  1M19 D;  5B31 A;  3X1U A;  5GXQ A;  3AZG D;  4H9Q A;  5B33 A;  5B32 G;  1KX4 A;  4HGA C;  1R4V A;  5JRG C;  3O62 C;  5E5A A;  2F8N H;  3LZ0 A;  4X23 A;  2VQR A;  2HIO B;  2IO5 B;  4JJN C;  1HTA A;  4WV4 B;  3B6F C;  3WKJ D;  2JE5 A;  3REI C;  2NZD D;  3AZK C;  5AVB D;  3B6G A;  1F66 D;  4J8V D;  3MGQ B;  3AZJ A;  3X1V B;  5CPJ D;  5AV6 D;  2ZY4 A;  4YS3 D;  3WAA A;  3AZE C;  4H9N B;  3AZI C;  4WU9 B;  3UTA B;  1ZLA C;  3H0R C;  3MGS B;  3LJA B;  4KUD C;  1KX3 B;  1BH8 B;  3V9R A;  5B0Y C;  3B0D B;  5BNX A;  4J8X B;  1H3O B;  1P34 B;  2FJ7 A;  4WJ3 C;  3AZL B;  5BNV B;  3LZ1 A;  4Z5T B;  5B31 G;  2CV5 A;  3REK B;  3F6T A;  3W99 C;  3REI A;  4NE3 A;  3MVD B;  3TU4 B;  4WU9 D;  3W97 C;  2ZY5 A;  3AZF C;  1W2E A;  5B1M C;  2ZY3 A;  3X1T D;  5GT0 C;  4XUJ C;  4H9P A;  4J8W D;  1AOI B;  1P3O C;  5B0Z C;  1P3B B;  3REJ D;  3UT9 B;  2Y2N A;  1P3F C;  3KFU G;  5CPI B;  4KUD A;  3R45 A;  2Y2G A;  4QLC D;  2YFW B;  1TZY C;  3MGR D;  1P3K A;  3AV2 B;  1N1J B;  5DNM C;  3W99 A;  1S32 C;  3H0L C;  3REL A;  5B32 C;  4WU8 D;  4ZUX C;  1P3B D;  3W96 B;  3UT9 D;  2HUE B;  5B24 B;  3AZF A;  5B1M A;  3NQU B;  5KDM B;  3AZM B;  5GT0 A;  4XUJ A;  3A1K A;  3EPH A;  1P3O A;  3C1C D;  4KGC C;  1P3G D;  1P3F A;  1M18 B;  2Y2K A;  3WTP D;  3KSY A;  3AV2 D;  4CSR A;  4Z66 C;  3MGP C;  3MGQ A;  3X1V A;  4XZQ D;  3AZN B;  4R8P C;  2BYK B;  3REH C;  1P3L D;  1JFI B;  3W98 B;  5B40 B;  3LEL B;  3UTA A;  1P3M C;  3LJA A;  1EQZ C;  2RVQ D;  4J8U B;  3EPL A;  4ZUX A;  3NQJ B;  3X1S B;  2NQB D;  4LD9 B;  5GSU C;  2ARO B;  5CP6 B;  1U35 C;  1HQ3 C;  4J8X A;  1P34 A;  5AV8 D;  4J8V C;  1M18 D;  5B2J B;  4WZS B;  5B31 C;  3VH5 T;  5GT3 B;  3AZL A;  1ID3 B;  3X1U D;  5BNV A;  3AYW B;  3AZH B;  2Y2H A;  5GXQ C;  3REK A;  2BG1 A;  3UTB B;  5B33 C;  1KX4 C;  3KWQ D;  5DNN B;  1M19 B;  5E5A D;  4G92 C;  3TU4 A;  3W98 D;  3AN2 A;  3LZ0 C;  3LEL D;  4X23 C;  2F8N D;  1WWI A;  3IP4 C;  3MGP A;  2Y2L A;  4J8U D;  5CHL B;  5JRG B;  3O62 B;  4YM6 A;  3A1I A;  5AV5 C;  4ZBJ C;  3A6N B;  3B6G C;  4DRB A;  3KUY A;  1EQZ A;  1P3P C;  5BO0 A;  5B1L C;  3WAA C;  3WKJ B;  1P3A A;  2Y2J A;  2NZD B;  3MNN D;  3UTB D;  3C1B A;  1F66 B;  4J8V B;  4EO5 B;  5AV6 B;  5CPJ B;  4YS3 B;  1WWS A;  1N1J A;  3AZI B;  3AFA C;  2FJ7 C;  1M1A C;  5JRG D;  1ZLA B;  2Y2P A;  1TAF A;  3O62 D;  5CPK A;  3A6N D;  1KX5 B;  2PYO C;  4AWL C;  3LZ1 C;  4JJN D;  2CV5 C;  3NQU A;  3AZM A;  4NE5 A;  3B6F D;  3REI D;  3AZK D;  5AV5 A;  1BH9 B;  1P3P A;  5B1L A;  3AZE D;  4Z2M H;  5B2I A;  3AZI D;  5AY8 A;  3W97 B;  1ZLA D;  3AZN A;  2BYK A;  1B67 A;  1KX5 D;  3X1T B;  2G5H C;  5B40 A;  4J8W B;  5B0Y D;  5AV9 A;  3AFA A;  4H9O A;  1P3I A;  2XD1 A;  1M1A A;  3REJ B;  5JA4 B;  5AVC A;  3AV1 A;  4LD9 A;  5CP6 A;  4WNN A;  2L5A A;  2PYO A;  5AVB C;  1P3K C;  3KXB C;  3W99 D;  5GT3 A;  4H9R B;  3REL C;  3AYW A;  4QLC B;  3W97 D;  3MGR B;  5FUG A;  5GT0 D;  1P3O D;  5B0Z D;  2HIO C;  4WU8 B;  1P3F D;  3AZG A;  2UWX A;  3C1C B;  4KGC B;  1A7W A;  3MGQ C;  1T3U A;  3X1V C;  1P3G B;  5G49 A;  2NZD A;  1TZY D;  4KHA B;  4CAY A;  4G91 B;  3WTP B;  5AVB A;  3UTA C;  3KXB A;  5DNM D;  1Q9C A;  5F99 B;  4Z66 B;  1F66 A;  3MGS C;  1S32 D;  3LJA C;  5AV6 A;  5CPJ A;  5B32 D;  4XZQ B;  4R8P B;  5BT1 C;  4ZUX D;  4YS3 A;  1KX3 C;  2LY8 A;  1P3L B;  3B0D C;  4J8X C;  1P34 C;  4M6B A;  1P3M B;  3AZL C;  2HIO A;  3WA9 B;  4KGC D;  4Z5T C;  2NQB B;  1HQ3 B;  3REK C;  5AV8 B;  3MVD C;  3TU4 C;  3AN2 C;  5F99 D;  3X1U B;  4Z66 D;  5GXQ B;  4R8P D;  4H9Q B;  3REH D;  2F8N K;  3KWQ B;  1AOI C;  4H9N A;  4G92 B;  5E5A B;  4YM6 C;  4WU9 A;  4X23 B;  1P3M D;  2F8N B;  3UT9 C;  3MGS A;  3KUY C;  2FFF B;  1EQZ D;  5CPI C;  1Z2C B;  3WA9 D;  4J8W A;  1KX3 A;  5GSU D;  1BH8 A;  1P3A C;  1U35 D;  1HQ3 D;  1H3O A;  2ZM5 A;  4ZBJ B;  3C1B C;  5B31 D;  2G5I C;  3AZJ B;  4Z5T A;  5GXQ D;  3EG5 B;  3MNN B;  5B33 D;  1KX4 D;  5C3I C;  3MVD A;  5CPK C;  3W96 C;  3LZ0 D;  4E44 A;  4X23 D;  2HUE C;  5B24 C;  3V9R B;  5BNX B;  3AZM C;  1AOI A;  4HGA B;  4WU8 A;  1P3B A;  3VH5 A;  3B6G D;  3UT9 A;  3AZJ D;  4JJN B;  5CPI A;  1P3P D;  5B1L D;  3B6F B;  3WAA D;  3REI B;  5B2I C;  3P5J B;  3AZK B;  5AY8 C;  1P3G A;  3AZN C;  2YFV B;  2YFW A;  3EPJ A;  3W98 C;  3WTP A;  5B40 C;  3AZE B;  5AV9 C;  3AV2 A;  3AFA D;  2FJ7 D;  1P3I C;  1M1A D;  4XZQ A;  4UUZ B;  3W96 A;  5AVC C;  3X1S C;  3AV1 C;  4LD9 C;  1P3L A;  2ARO C;  5CP6 C;  5B24 A;  2PYO D;  4KUD B;  3LZ1 D;  1B6W A;  2CV5 D;  5B0Y B;  4NFT A;  3R45 B;  5BS7 C;  5KDM A;  5B2J C;  4E45 A;  5GT3 C;  1ID3 C;  3AYW C;  3AZH C;  2NQB A;  1BFM A;  2JSS A;  1M18 A;  5DNN C;  2XD5 A;  1M19 C;  3W99 B;  3REL B;  3WTP E;  3AZG C;  3AZF B;  5B1M B;  3KWQ A;  1JFI A;  4KUD D;  5GT0 B;  4XUJ B;  3W98 A;  2F8N A;  3LEL A;  3A6N C;  1P3O B;  5B0Z B;  4J8U A;  1P3F B;  3NQJ A;  3VH5 W;  3X1S A;  3WKJ C;  2ARO A;  2NZD C;  2Y2I A;  1P3K D;  3KXB D;  5BS7 A;  5B2J A;  1F66 C;  4CSR B;  4EO5 C;  3REL D;  1ID3 A; 
#chains in the Genus database with same CATH homology
 5AV6 C;  5CPJ C;  4YS3 C;  3AZH A;  3MNN A;  1TZY B;  4H9S A;  3UTB A;  3AZF D;  5B1M D;  2J8P A;  5DNN A;  5DNM B;  4XUJ D;  1M19 A;  1S32 B;  2HIO D;  5B32 B;  1KX5 C;  4ZUX B;  2IO5 C;  2ZY2 A;  2BYM B;  5JRG A;  3O62 A;  3A6N A;  3MGQ D;  3B0B A;  4JJN A;  3X1V D;  3B0C T;  3B6F A;  3WKJ A;  3AZK A;  2DQN C;  4NE6 A;  3UTA D;  3AN2 B;  4WU9 C;  3MGS D;  3MGP B;  4J8V A;  2YFV A;  3LJA D;  3X1T C;  1KU5 A;  5BT1 D;  2F8N G;  1KX3 D;  4J8W C;  3REH B;  3AZE A;  4J8X D;  3AZI A;  1P34 D;  4YM6 B;  2Y2O A;  1ZLA A;  3REJ C;  3KUY B;  4UUZ A;  1EQZ B;  3AZL D;  4UPK A;  1KX5 A;  5BO0 B;  4Z5T D;  5GSU B;  5B0Y A;  1P3A B;  3REK D;  1U35 B;  3C1B B;  2F2A C;  3MVD D;  5B31 B;  3TU4 D;  4DRA A;  3AN2 D;  4Z2M G;  4QLC C;  3VH6 T;  1BH9 A;  3MGP D;  3MGR C;  5B33 B;  1KX4 B;  1AOI D;  5C3I B;  1TAF B;  5CPK B;  4YM6 D;  3LZ0 B;  4WU8 C;  3W97 A;  1P3B C;  3KUY D;  5CPI D;  3X1T A;  2JCH A;  1P3A D;  5B0Z A;  3C1C C;  5AV5 B;  3C1B D;  3REJ A;  5JA4 A;  1P3G C;  3B6G B;  3VH6 A;  1F1E A;  1PZR A;  1P3P B;  5B1L B;  4G91 C;  3WTP C;  3WAA B;  5B2I B;  3AV2 C;  5F99 C;  5AY8 B;  4H9R A;  5CPK D;  4XZQ C;  3W96 D;  4QLC A;  1P3L C;  1TZY A;  5B24 D;  3MGR A;  5AV9 B;  3AZM D;  5DNM A;  3AFA B;  4H9O B;  1S32 A;  1P3I B;  2FJ7 B;  1M1A B;  2RVQ C;  5B32 A;  3WA9 C;  3AL0 C;  5AVC B;  4DQY B;  5AV5 D;  3AV1 B;  2NQB C;  4WNN B;  2DF4 C;  2PYO B;  4AWL B;  3FDD A;  3LZ1 B;  2CV5 B;  2BYM A;  5AV8 C;  1M18 C;  3B0C W;  2RIQ A;  5B2I D;  3C1C A;  4KGC A;  3X1U C;  5AY8 D;  3AZN D;  3KWQ C;  4KHA A;  5FUG B;  5B40 D;  4H9P B;  5E5A C;  5AV9 D;  3LEL C;  3H0M C;  5F99 A;  2CWE A;  4Z66 A;  1P3I D;  4J8U C;  3AZG B;  5AVC D;  4R8P A;  2Y2Q A;  3X1S D;  3REH A;  3AV1 D;  4LD9 D;  5CP6 D;  2ARO D;  2Y2M A;  1P3M A;  1ULY A;  5B2J D;  5GT3 D;  3AZJ C;  1ID3 D;  3WA9 A;  5G49 B;  3AYW D;  3AZH D;  5GSU A;  2W8S A;  4CAY B;  1HQ3 A;  3VH6 W;  3MNN C;  4H9S C;  3EPK A;  3UTB C;  5AVB B;  1U35 A;  5AV8 A;  5DNN D;  3KXB B;  1P3K B;  1M19 D;  5B31 A;  3X1U A;  5GXQ A;  3AZG D;  4H9Q A;  5B33 A;  5B32 G;  1KX4 A;  4HGA C;  1R4V A;  5JRG C;  3O62 C;  5E5A A;  2F8N H;  3LZ0 A;  4X23 A;  2VQR A;  2HIO B;  2IO5 B;  4JJN C;  1HTA A;  4WV4 B;  3B6F C;  3WKJ D;  2JE5 A;  3REI C;  2NZD D;  3AZK C;  5AVB D;  3B6G A;  1F66 D;  4J8V D;  3MGQ B;  3AZJ A;  3X1V B;  5CPJ D;  5AV6 D;  2ZY4 A;  4YS3 D;  3WAA A;  3AZE C;  4H9N B;  3AZI C;  4WU9 B;  3UTA B;  1ZLA C;  3H0R C;  3MGS B;  3LJA B;  4KUD C;  1KX3 B;  1BH8 B;  3V9R A;  5B0Y C;  3B0D B;  5BNX A;  4J8X B;  1H3O B;  1P34 B;  2FJ7 A;  4WJ3 C;  3AZL B;  5BNV B;  3LZ1 A;  4Z5T B;  5B31 G;  2CV5 A;  3REK B;  3F6T A;  3W99 C;  3REI A;  4NE3 A;  3MVD B;  3TU4 B;  4WU9 D;  3W97 C;  2ZY5 A;  3AZF C;  1W2E A;  5B1M C;  2ZY3 A;  3X1T D;  5GT0 C;  4XUJ C;  4H9P A;  4J8W D;  1AOI B;  1P3O C;  5B0Z C;  1P3B B;  3REJ D;  3UT9 B;  2Y2N A;  1P3F C;  3KFU G;  5CPI B;  4KUD A;  3R45 A;  2Y2G A;  4QLC D;  2YFW B;  1TZY C;  3MGR D;  1P3K A;  3AV2 B;  1N1J B;  5DNM C;  3W99 A;  1S32 C;  3H0L C;  3REL A;  5B32 C;  4WU8 D;  4ZUX C;  1P3B D;  3W96 B;  3UT9 D;  2HUE B;  5B24 B;  3AZF A;  5B1M A;  3NQU B;  5KDM B;  3AZM B;  5GT0 A;  4XUJ A;  3A1K A;  3EPH A;  1P3O A;  3C1C D;  4KGC C;  1P3G D;  1P3F A;  1M18 B;  2Y2K A;  3WTP D;  3KSY A;  3AV2 D;  4CSR A;  4Z66 C;  3MGP C;  3MGQ A;  3X1V A;  4XZQ D;  3AZN B;  4R8P C;  2BYK B;  3REH C;  1P3L D;  1JFI B;  3W98 B;  5B40 B;  3LEL B;  3UTA A;  1P3M C;  3LJA A;  1EQZ C;  2RVQ D;  4J8U B;  3EPL A;  4ZUX A;  3NQJ B;  3X1S B;  2NQB D;  4LD9 B;  5GSU C;  2ARO B;  5CP6 B;  1U35 C;  1HQ3 C;  4J8X A;  1P34 A;  5AV8 D;  4J8V C;  1M18 D;  5B2J B;  4WZS B;  5B31 C;  3VH5 T;  5GT3 B;  3AZL A;  1ID3 B;  3X1U D;  5BNV A;  3AYW B;  3AZH B;  2Y2H A;  5GXQ C;  3REK A;  2BG1 A;  3UTB B;  5B33 C;  1KX4 C;  3KWQ D;  5DNN B;  1M19 B;  5E5A D;  4G92 C;  3TU4 A;  3W98 D;  3AN2 A;  3LZ0 C;  3LEL D;  4X23 C;  2F8N D;  1WWI A;  3IP4 C;  3MGP A;  2Y2L A;  4J8U D;  5CHL B;  5JRG B;  3O62 B;  4YM6 A;  3A1I A;  5AV5 C;  4ZBJ C;  3A6N B;  3B6G C;  4DRB A;  3KUY A;  1EQZ A;  1P3P C;  5BO0 A;  5B1L C;  3WAA C;  3WKJ B;  1P3A A;  2Y2J A;  2NZD B;  3MNN D;  3UTB D;  3C1B A;  1F66 B;  4J8V B;  4EO5 B;  5AV6 B;  5CPJ B;  4YS3 B;  1WWS A;  1N1J A;  3AZI B;  3AFA C;  2FJ7 C;  1M1A C;  5JRG D;  1ZLA B;  2Y2P A;  1TAF A;  3O62 D;  5CPK A;  3A6N D;  1KX5 B;  2PYO C;  4AWL C;  3LZ1 C;  4JJN D;  2CV5 C;  3NQU A;  3AZM A;  4NE5 A;  3B6F D;  3REI D;  3AZK D;  5AV5 A;  1BH9 B;  1P3P A;  5B1L A;  3AZE D;  4Z2M H;  5B2I A;  3AZI D;  5AY8 A;  3W97 B;  1ZLA D;  3AZN A;  2BYK A;  1B67 A;  1KX5 D;  3X1T B;  2G5H C;  5B40 A;  4J8W B;  5B0Y D;  5AV9 A;  3AFA A;  4H9O A;  1P3I A;  2XD1 A;  1M1A A;  3REJ B;  5JA4 B;  5AVC A;  3AV1 A;  4LD9 A;  5CP6 A;  4WNN A;  2L5A A;  2PYO A;  5AVB C;  1P3K C;  3KXB C;  3W99 D;  5GT3 A;  4H9R B;  3REL C;  3AYW A;  4QLC B;  3W97 D;  3MGR B;  5FUG A;  5GT0 D;  1P3O D;  5B0Z D;  2HIO C;  4WU8 B;  1P3F D;  3AZG A;  2UWX A;  3C1C B;  4KGC B;  1A7W A;  3MGQ C;  1T3U A;  3X1V C;  1P3G B;  5G49 A;  2NZD A;  1TZY D;  4KHA B;  4CAY A;  4G91 B;  3WTP B;  5AVB A;  3UTA C;  3KXB A;  5DNM D;  1Q9C A;  5F99 B;  4Z66 B;  1F66 A;  3MGS C;  1S32 D;  3LJA C;  5AV6 A;  5CPJ A;  5B32 D;  4XZQ B;  4R8P B;  5BT1 C;  4ZUX D;  4YS3 A;  1KX3 C;  2LY8 A;  1P3L B;  3B0D C;  4J8X C;  1P34 C;  4M6B A;  1P3M B;  3AZL C;  2HIO A;  3WA9 B;  4KGC D;  4Z5T C;  2NQB B;  1HQ3 B;  3REK C;  5AV8 B;  3MVD C;  3TU4 C;  3AN2 C;  5F99 D;  3X1U B;  4Z66 D;  5GXQ B;  4R8P D;  4H9Q B;  3REH D;  2F8N K;  3KWQ B;  1AOI C;  4H9N A;  4G92 B;  5E5A B;  4YM6 C;  4WU9 A;  4X23 B;  1P3M D;  2F8N B;  3UT9 C;  3MGS A;  3KUY C;  2FFF B;  1EQZ D;  5CPI C;  1Z2C B;  3WA9 D;  4J8W A;  1KX3 A;  5GSU D;  1BH8 A;  1P3A C;  1U35 D;  1HQ3 D;  1H3O A;  2ZM5 A;  4ZBJ B;  3C1B C;  5B31 D;  2G5I C;  3AZJ B;  4Z5T A;  5GXQ D;  3EG5 B;  3MNN B;  5B33 D;  1KX4 D;  5C3I C;  3MVD A;  5CPK C;  3W96 C;  3LZ0 D;  4E44 A;  4X23 D;  2HUE C;  5B24 C;  3V9R B;  5BNX B;  3AZM C;  1AOI A;  4HGA B;  4WU8 A;  1P3B A;  3VH5 A;  3B6G D;  3UT9 A;  3AZJ D;  4JJN B;  5CPI A;  1P3P D;  5B1L D;  3B6F B;  3WAA D;  3REI B;  5B2I C;  3P5J B;  3AZK B;  5AY8 C;  1P3G A;  3AZN C;  2YFV B;  2YFW A;  3EPJ A;  3W98 C;  3WTP A;  5B40 C;  3AZE B;  5AV9 C;  3AV2 A;  3AFA D;  2FJ7 D;  1P3I C;  1M1A D;  4XZQ A;  4UUZ B;  3W96 A;  5AVC C;  3X1S C;  3AV1 C;  4LD9 C;  1P3L A;  2ARO C;  5CP6 C;  5B24 A;  2PYO D;  4KUD B;  3LZ1 D;  1B6W A;  2CV5 D;  5B0Y B;  4NFT A;  3R45 B;  5BS7 C;  5KDM A;  5B2J C;  4E45 A;  5GT3 C;  1ID3 C;  3AYW C;  3AZH C;  2NQB A;  1BFM A;  2JSS A;  1M18 A;  5DNN C;  2XD5 A;  1M19 C;  3W99 B;  3REL B;  3WTP E;  3AZG C;  3AZF B;  5B1M B;  3KWQ A;  1JFI A;  4KUD D;  5GT0 B;  4XUJ B;  3W98 A;  2F8N A;  3LEL A;  3A6N C;  1P3O B;  5B0Z B;  4J8U A;  1P3F B;  3NQJ A;  3VH5 W;  3X1S A;  3WKJ C;  2ARO A;  2NZD C;  2Y2I A;  1P3K D;  3KXB D;  5BS7 A;  5B2J A;  1F66 C;  4CSR B;  4EO5 C;  3REL D;  1ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...