3O62C

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62C00
2AROD 3AZGC 1P3LD 5AV8A 3REJD 5B2JA 5B33D 5GT0C 1M18D 1AOID 3LELC 2FJ7B 1HQ3A 5B32C 3AZNB 4J8XC 5B2ID 1P3MB 4H9NA 3X1SD 3AN2B 1P3IB 3X1VC 1P3GB 1M1AC 3KSYA 2HIOA 4XUJD 3RELC 4J8WD 2BYKB 4KGCD 5GT3D 1M19A 3REKD 2YFWB 4AWLB 2BYMA 3WTPE 4LD9C 5B40B 5DNND 3AV2D 4J8VB 1BH9A 3UT9D 2YFVB 1ULYA 3MGRA 1KX4C 5BNXB 1EQZD 2CV5C 3AZFB 1KU5A 1KX3B 3AZKD 3AZJA 4H9PB 3AZEA 4R8PB 3UTBA 3C1BC 3AFAB 5B1MC 4WU9B 4XZQA 4YM6C 3VH5T 1N1JA 3R45A 1P3LA 1P3OB 3REJA 1HQ3C 4Z66B 5B0ZA 5B33A 5CPID 1M18A 1AOIA 3KXBD 3REHB 3LJAB 3MGPD 2PYOB 4QLCB 5B2IA 3X1SA 5AV5D 5CP6B 3MVDC 4JJNB 1U35D 3A6NB 3REIB 4J8WA 3AV1D 4KHAB 4KGCA 4X23B 3KUYD 5GSUB 3WKJC 4WZSB 3REKA 4HGAC 4H9OB 5F99B 3W99D 3V9RB 1P3IA 3MGRC 3W98B 3AV2A 3AYWB 3X1TD 3B6GB 1H3OB 3UT9A 3AZJC 3AZEC 5BNVB 3TU4B 2BYKA 1F66D 4KUDD 3AZLD 3AZKA 2HUEB 1ID3D 4WU8B 3LZ0D 3C1CC 4XZQC 2F8NH 5G49B 5B31C 2AROC 1P3LC 3REJC 3WA9B 3MGSB 5B33C 1M18C 1AOIC 2IO5C 3B6FB 1P3AB 5B2IC 3MGPA 3X1SC 5AV8D 5DNMB 5B2JD 4UUZB 5AV5A 4XUJC 5B1MB 1P3FD 4J8WC 4NFTA 5B24B 4KGCC 3AV1A 5GT3C 1P3OA 5AY8B 3REKC 2HIOD 3KUYA 1TZYB 5B1LB 2NZDD 5CPJD 5DNNC 3AV2C 1M19D 3UT9C 5JRGD 3KWQD 3X1TA 1P3PD 1EQZC 1KX5D 1JFIB 5E5AD 3AZKC 3WTPD 5CPKD 1F66A 4H9QB 4KHAA 3X1UD 5JA4B 3AZLA 5BS7A 4EO5B 1ID3A 3WKJB 4NE3A 4HGAB 1P34B 3UTBD 1P3KB 5CPIC 3KXBC 3MGPC 4E44A 1S32B 5AV5C 4NE5A 1BFMA 5B0ZD 4WU8A 4J8UB 1U35C 1P3FA 5B31B 3AV1C 3MNND 2AROB 3UTAD 3W97D 5AVBB 2F8NK 4YS3D 4CAYB 3KUYC 1A7WA 3AZMD 1BH8B 4Z5TB 5AV9D 2NZDA 3W99C 5CPJA 3X1TC 4H9SA 4XUJB 2FJ7D 2JSSA 5AVCB 5JRGA 3KWQA 3AZND 1P3PA 4ZUXB 1P3BA 1KX5A 5GXQB 5E5AA 3AZLC 1P3MD 1F66C 4KUDC 3WTPA 5BS7C 5KDMA 3AN2D 5CPKA 3LZ0C 1P3ID 3MGQB 1ID3C 3X1UA 5AV6B 3O62B 4G92C 3NQUB 3AZIB 3B0DB 2NQBB 3W96C 5BO0B 4WNNB 1TAFA 5AV8C 4WV4B 5B2JC 1R4VA 4J8VD 3AZHB 1ZLAA 4CSRA 1P3FC 3WAAB 5B0YB 3AZFD 2L5AA 1KX3D 3LZ1B 4R8PD 3MNNA 3W97A 3UTAA 2HIOC 4YS3A 3AZMA 5CPIB 3KXBB 4WU9D 2NZDC 5CPJC 5AV9A 4H9SC 1M19C 1P3OD 3AZGB 5C3IC 1WWIA 5JRGC 5GT0B 3KWQC 1P3PC 1KX5C 5E5AC 3LELB 3REHD 5B32B 3WTPC 3LJAD 5CPKC 2FJ7A 3AZNA 4QLCD 4J8XB 1P3MA 4H9RB 3AN2A 3VH6W 5CP6D 3X1VB 1P3GA 1M1AB 3A6ND 3RELB 3REID 3UTBC 3W99B 5B31G 2F8NG 4X23D 4G91C 5GSUD 5FUGB 2YFWA 5AVCA 4LD9B 2LY8A 5F99D 5B40A 5B0ZC 3W98D 4J8VA 3AYWD 3B6GD 3O62A 1KX4B 2YFVA 3VH6A 3MNNC 3TU4D 5BNXA 2CV5B 3UTAC 3W97C 3AZFA 1KX3A 4YS3C 4H9PA 4R8PA 3AZMC 4WU8D 3C1BB 3W96B 3AFAA 4WNNA 5AV9C 4WU9A 5AV8B 4YM6B 3WA9D 3MGSD 1HQ3B 2FJ7C 4Z66A 3B6FD 3AZNC 3WAAA 1P3AD 1P3MC 4H9NB 4Z2MG 3LJAA 3REHA 3AN2C 5DNMD 1P3IC 2PYOA 4QLCA 4DRBA 2CWEA 5CP6A 3MVDB 4JJNA 5B24D 3A6NA 1P3BD 3REIA 1M19B 5AY8D 4AWLC 4X23A 5GSUA 1B6WA 1TZYD 4DRAA 3LELA 5B1LD 4H9OA 4J8VC 3B0CW 5F99A 3V9RA 3MGRB 3W98A 3AYWA 3AZFC 3B6GA 1H3OA 1KX3C 3RELA 3AZJB 3AZEB 4R8PC 5BNVA 3TU4A 1ZLAD 3VH6T 2RVQD 5B32G 3C1CB 4WU9C 4XZQB 5G49A 1P34D 2F8NB 1N1JB 3R45B 1P3LB 1P3OC 3REJB 1P3KD 5B0ZB 3WA9A 5B33B 3MGSA 1M18B 1AOIB 2IO5B 3REHC 3LJAC 3B6FA 3B0BA 4QLCC 1P3AA 5B2IB 3X1SB 1S32D 5DNMA 5CP6C 4J8UD 3C1BA 4UUZA 3A6NC 5B1MA 3REIC 5B31D 4J8WB 5B24A 5AVBD 4YM6A 4KGCB 4X23C 5GSUC 5GT3B 1P3GD 5AY8A 4Z5TD 3REKB 1TZYA 5F99C 5CHLB 5B1LA 5DNNB 3AV2B 3W98C 3AYWC 3UT9B 3B6GC 3MVDA 5AVCD 3TU4C 1EQZB 4ZUXD 1JFIA 5GXQD 3AZKB 2HUEC 5B40D 4WU8C 3MGQD 4H9QA 5JA4A 5AV6D 3O62D 3WKJA 3AZID 3WA9C 1P34A 3MGSC 1HTAA 2NQBD 1P3KA 3AFAD 3B6FC 1P3AC 3MGPB 3B0CT 5DNMC 1WWSA 3AZHD 1S32A 5AV5B 4Z66D 4J8UA 3C1CA 3WAAD 5B0YD 1U35B 5B24C 1P3BC 4ZBJC 3LZ1D 5B31A 3AV1B 2F8NA 2AROA 5AY8C 2PYOD 5AVBA 3X1UC 3KUYB 4CAYA 1TZYC 1BH8A 4Z5TA 4JJND 5B1LC 5BT1D 4NE6A 3AZGD 4M6BA 3X1TB 5GT0D 3LELD 4XUJA 5B32D 1Q9CA 3NQJB 4ZUXA 1F66B 1ZLAC 2RVQC 5GXQA 4J8XD 3AZLB 4KUDB 1ID3B 4EO5C 3LZ0B 5GT3A 3X1VD 1M1AD 3MGQA 4G92B 5AV6A 3RELD 1P34C 3NQUA 3AZIA 1P3KC 5DNNA 2NQBA 5BO0A 1EQZA 4LD9D 1S32C 5B2JB 4J8UC 3AZHA 1P3FB 1KX4D 5B0YA 2CV5D 5AVBC 3LZ1A 1P3GC 3C1BD 4Z5TC 2HIOB 3W96D 5B1MD 5CPIA 3KXBA 1B67A 2NZDB 4E45A 4YM6D 5CPJB 5C3IB 3AZGA 1HQ3D 5JRGB 5AVCC 3KWQB 2BYMB 5GT0A 1P3PB 1U35A 4ZUXC 5E5AB 1P3BB 4ZBJB 5GXQC 1KX5B 3WTPB 5KDMB 5B32A 5B40C 5CPKB 3MGQC 3X1UB 4J8XA 1BH9B 4H9RA 1F1EA 5AV6C 3O62C 3MVDD 3X1VA 1M1AA 3AZIC 3B0DC 4Z2MH 3UTBB 3W99A 2NQBC 3VH5W 3AFAC 4G91B 3WKJD 5FUGA 1TAFB 1ZLAB 3NQJA 4LD9A 4CSRB 3AZHC 4KUDA 3LZ0A 4Z66C 3MGRD 3WAAC 5B0YC 3AZJD 3LZ1C 1KX4A 3AZED 3MNNB 3W97B 3UTAB 2CV5A 2PYOC 4YS3B 3AZMB 3C1CD 4XZQD 4JJNC 3W96A 5BT1C 3VH5A 5AV9B 2F8ND
chains in the Genus database with same CATH superfamily
2AROD 3AZGC 1P3LD 5AV8A 3REJD 5B2JA 5B33D 5GT0C 1M18D 1AOID 3LELC 2FJ7B 1HQ3A 5B32C 3AZNB 4J8XC 5B2ID 2J8PA 1P3MB 4H9NA 3X1SD 2Y2OA 3AN2B 1P3IB 3X1VC 1P3GB 1M1AC 3KSYA 3KFUG 2HIOA 4XUJD 3RELC 4J8WD 2BYKB 4KGCD 5GT3D 1M19A 3REKD 2YFWB 4AWLB 2BYMA 3WTPE 4LD9C 5B40B 5DNND 3AV2D 4J8VB 1BH9A 3UT9D 2YFVB 1ULYA 3MGRA 1KX4C 1PZRA 5BNXB 1EQZD 2CV5C 3AZFB 1KU5A 1KX3B 3AZKD 3AZJA 4H9PB 3AZEA 4R8PB 3UTBA 3C1BC 2Y2PA 3AFAB 5B1MC 4WU9B 4XZQA 4YM6C 2Y2LA 3VH5T 1N1JA 3R45A 1P3LA 1P3OB 3REJA 1HQ3C 4Z66B 5B0ZA 5B33A 5CPID 1M18A 1AOIA 3KXBD 3REHB 3LJAB 3MGPD 2PYOB 4QLCB 5B2IA 3AL0C 3X1SA 5AV5D 5CP6B 3MVDC 4JJNB 1U35D 3A6NB 3REIB 3A1KA 4J8WA 3AV1D 4KHAB 4KGCA 4X23B 3KUYD 5GSUB 3WKJC 4WZSB 3REKA 4HGAC 4H9OB 5F99B 3W99D 3V9RB 1P3IA 3MGRC 3W98B 3AV2A 3AYWB 3X1TD 3B6GB 1H3OB 3UT9A 3AZJC 3AZEC 5BNVB 2ZM5A 3TU4B 2BYKA 2F2AC 1F66D 4KUDD 3AZLD 3AZKA 2HUEB 1ID3D 4WU8B 3LZ0D 3C1CC 4XZQC 2F8NH 5G49B 5B31C 2AROC 1P3LC 3REJC 3WA9B 3MGSB 5B33C 1M18C 1AOIC 2IO5C 3B6FB 1P3AB 5B2IC 3MGPA 3X1SC 5AV8D 5DNMB 1W2EA 5B2JD 4UUZB 5AV5A 4XUJC 5B1MB 1P3FD 4J8WC 4NFTA 3H0RC 5B24B 4KGCC 3AV1A 5GT3C 1P3OA 5AY8B 3REKC 2XD1A 2HIOD 3KUYA 1TZYB 5B1LB 2NZDD 5CPJD 5DNNC 3AV2C 1M19D 3UT9C 5JRGD 3KWQD 3X1TA 1P3PD 1EQZC 1KX5D 1JFIB 5E5AD 3AZKC 3WTPD 5CPKD 1F66A 4H9QB 4KHAA 3X1UD 5JA4B 3AZLA 5BS7A 4EO5B 1ID3A 3WKJB 4NE3A 4HGAB 1P34B 3UTBD 1P3KB 5CPIC 3KXBC 3MGPC 2Y2KA 2JCHA 4E44A 1S32B 5AV5C 4NE5A 1BFMA 5B0ZD 4WU8A 4J8UB 1U35C 1P3FA 5B31B 3AV1C 3MNND 2AROB 3UTAD 3W97D 5AVBB 2F8NK 4YS3D 4CAYB 3KUYC 1A7WA 3AZMD 1BH8B 4Z5TB 5AV9D 2NZDA 3W99C 5CPJA 3X1TC 4H9SA 4XUJB 2FJ7D 2JSSA 5AVCB 5JRGA 3KWQA 3AZND 1P3PA 4ZUXB 1P3BA 1KX5A 5GXQB 5E5AA 3AZLC 1P3MD 1F66C 4KUDC 3WTPA 5BS7C 2ZY5A 5KDMA 3AN2D 3LZ0C 5CPKA 3MGQB 1P3ID 1ID3C 3X1UA 5AV6B 3O62B 4G92C 3NQUB 3AZIB 3B0DB 2NQBB 3W96C 5BO0B 2ZY2A 4WNNB 1TAFA 5AV8C 4WV4B 5B2JC 1R4VA 4J8VD 3AZHB 1ZLAA 4CSRA 1P3FC 3WAAB 5B0YB 3AZFD 2L5AA 1KX3D 3LZ1B 4R8PD 3MNNA 3W97A 3UTAA 2HIOC 4YS3A 2FFFB 3AZMA 5CPIB 4WJ3C 3KXBB 4WU9D 2NZDC 5CPJC 5AV9A 4H9SC 1M19C 1P3OD 3AZGB 5C3IC 1WWIA 5JRGC 5GT0B 3KWQC 1P3PC 1KX5C 5E5AC 3LELB 3REHD 5B32B 3WTPC 3LJAD 5CPKC 2FJ7A 3AZNA 4QLCD 4J8XB 1P3MA 4H9RB 3AN2A 3VH6W 5CP6D 3X1VB 1P3GA 1M1AB 3A6ND 3RELB 3REID 3UTBC 3W99B 5B31G 2F8NG 4X23D 4G91C 5GSUD 5FUGB 2YFWA 5AVCA 4LD9B 2LY8A 5F99D 5B40A 5B0ZC 3W98D 4J8VA 3AYWD 3B6GD 4UPKA 3O62A 1KX4B 2YFVA 3VH6A 3MNNC 3TU4D 5BNXA 2CV5B 3UTAC 3W97C 3AZFA 1KX3A 4YS3C 2DF4C 2ZY4A 4H9PA 4R8PA 3AZMC 3A1IA 4WU8D 3C1BB 3W96B 3AFAA 4WNNA 3H0LC 5AV9C 4WU9A 5AV8B 4YM6B 3WA9D 3EPJA 3MGSD 3FDDA 1HQ3B 2FJ7C 4Z66A 3B6FD 3AZNC 3WAAA 1P3AD 1P3MC 4H9NB 4Z2MG 3LJAA 3REHA 3AN2C 5DNMD 1P3IC 2PYOA 4QLCA 4DRBA 2CWEA 5CP6A 3MVDB 4JJNA 2BG1A 5B24D 3A6NA 1P3BD 3REIA 1M19B 5AY8D 4AWLC 4X23A 5GSUA 1B6WA 1TZYD 4DRAA 3LELA 5B1LD 4H9OA 4J8VC 3B0CW 5F99A 3V9RA 3MGRB 3W98A 3AYWA 3AZFC 3B6GA 1H3OA 1KX3C 3RELA 3AZJB 3AZEB 4R8PC 5BNVA 3TU4A 2DQNC 1ZLAD 3VH6T 2RVQD 5B32G 3C1CB 4WU9C 4XZQB 5G49A 1P34D 2F8NB 1N1JB 3R45B 1P3LB 1P3OC 3REJB 1P3KD 5B0ZB 3WA9A 5B33B 3MGSA 1M18B 1AOIB 2Y2NA 2IO5B 3REHC 3LJAC 3B6FA 3B0BA 4QLCC 1P3AA 5B2IB 3X1SB 1S32D 5DNMA 5CP6C 4J8UD 3C1BA 4UUZA 3A6NC 5B1MA 3REIC 5B31D 4J8WB 2UWXA 5B24A 5AVBD 4YM6A 4KGCB 4X23C 5GSUC 5GT3B 1P3GD 5AY8A 4Z5TD 3REKB 1TZYA 2G5IC 5F99C 5CHLB 5B1LA 5DNNB 4DQYB 3AV2B 3W98C 3AYWC 3UT9B 3B6GC 3MVDA 5AVCD 3TU4C 1EQZB 4ZUXD 1JFIA 5GXQD 3AZKB 3EG5B 2HUEC 5B40D 2XD5A 4WU8C 3MGQD 4H9QA 5JA4A 5AV6D 3O62D 3WKJA 3P5JB 3AZID 3WA9C 1P34A 3MGSC 1HTAA 2NQBD 1P3KA 3AFAD 3B6FC 1P3AC 2Y2HA 3MGPB 1Z2CB 3B0CT 5DNMC 2Y2GA 1WWSA 3AZHD 1S32A 5AV5B 4Z66D 4J8UA 3C1CA 3WAAD 5B0YD 1U35B 5B24C 1P3BC 4ZBJC 3LZ1D 5B31A 3AV1B 2F8NA 2AROA 5AY8C 2PYOD 5AVBA 3X1UC 3KUYB 4CAYA 1TZYC 1BH8A 4Z5TA 4JJND 5B1LC 5BT1D 4NE6A 2Y2IA 3AZGD 4M6BA 3X1TB 5GT0D 3LELD 4XUJA 5B32D 1Q9CA 2Y2JA 3NQJB 4ZUXA 1F66B 1ZLAC 2RVQC 5GXQA 4J8XD 3AZLB 2W8SA 4KUDB 1ID3B 2G5HC 4EO5C 5GT3A 3LZ0B 3X1VD 3MGQA 1M1AD 4G92B 5AV6A 3RELD 1P34C 3NQUA 3AZIA 1P3KC 5DNNA 2NQBA 5BO0A 1EQZA 4LD9D 1S32C 2RIQA 3IP4C 5B2JB 4J8UC 3AZHA 1P3FB 1T3UA 1KX4D 5B0YA 2CV5D 3EPKA 5AVBC 3LZ1A 2ZY3A 1P3GC 3C1BD 4Z5TC 2HIOB 3W96D 2Y2MA 5B1MD 5CPIA 2Y2QA 3KXBA 1B67A 2NZDB 4E45A 4YM6D 5CPJB 5C3IB 3AZGA 1HQ3D 5JRGB 5AVCC 3KWQB 2BYMB 5GT0A 1P3PB 1U35A 4ZUXC 5E5AB 1P3BB 4ZBJB 5GXQC 1KX5B 3WTPB 5KDMB 5B32A 5B40C 5CPKB 3MGQC 3X1UB 4J8XA 1BH9B 4H9RA 1F1EA 5AV6C 3O62C 3MVDD 3X1VA 3H0MC 1M1AA 3AZIC 3B0DC 4Z2MH 3UTBB 3F6TA 3W99A 2NQBC 3VH5W 3AFAC 4G91B 3WKJD 5FUGA 1TAFB 3EPLA 1ZLAB 3NQJA 4LD9A 4CSRB 3AZHC 4KUDA 3LZ0A 2VQRA 4Z66C 3MGRD 3EPHA 3WAAC 5B0YC 3AZJD 3LZ1C 1KX4A 3AZED 3MNNB 3W97B 3UTAB 2CV5A 2PYOC 4YS3B 3AZMB 3C1CD 4XZQD 4JJNC 3W96A 2JE5A 5BT1C 3VH5A 5AV9B 2F8ND
chains in the Genus database with same CATH topology
2AROD 3AZGC 1P3LD 5AV8A 3REJD 5B2JA 5B33D 5GT0C 1M18D 1AOID 3LELC 2FJ7B 1HQ3A 5B32C 3AZNB 4J8XC 5B2ID 2J8PA 1P3MB 4H9NA 3X1SD 2Y2OA 3AN2B 1P3IB 3X1VC 1P3GB 1M1AC 3KSYA 3KFUG 2HIOA 4XUJD 3RELC 4J8WD 2BYKB 4KGCD 5GT3D 1M19A 3REKD 2YFWB 4AWLB 2BYMA 3WTPE 4LD9C 5B40B 5DNND 3AV2D 4J8VB 1BH9A 3UT9D 2YFVB 1ULYA 3MGRA 1KX4C 1PZRA 5BNXB 1EQZD 2CV5C 3AZFB 1KU5A 1KX3B 3AZKD 3AZJA 4H9PB 3AZEA 4R8PB 3UTBA 3C1BC 2Y2PA 3AFAB 5B1MC 4WU9B 4XZQA 4YM6C 2Y2LA 3VH5T 1N1JA 3R45A 1P3LA 1P3OB 3REJA 1HQ3C 4Z66B 5B0ZA 5B33A 5CPID 1M18A 1AOIA 3KXBD 3REHB 3LJAB 3MGPD 2PYOB 4QLCB 5B2IA 3AL0C 3X1SA 5AV5D 5CP6B 3MVDC 4JJNB 1U35D 3A6NB 3REIB 3A1KA 4J8WA 3AV1D 4KHAB 4KGCA 4X23B 3KUYD 5GSUB 3WKJC 4WZSB 3REKA 4HGAC 4H9OB 5F99B 3W99D 3V9RB 1P3IA 3MGRC 3W98B 3AV2A 3AYWB 3X1TD 3B6GB 1H3OB 3UT9A 3AZJC 3AZEC 5BNVB 2ZM5A 3TU4B 2BYKA 2F2AC 1F66D 4KUDD 3AZLD 3AZKA 2HUEB 1ID3D 4WU8B 3LZ0D 3C1CC 4XZQC 2F8NH 5G49B 5B31C 2AROC 1P3LC 3REJC 3WA9B 3MGSB 5B33C 1M18C 1AOIC 2IO5C 3B6FB 1P3AB 5B2IC 3MGPA 3X1SC 5AV8D 5DNMB 1W2EA 5B2JD 4UUZB 5AV5A 4XUJC 5B1MB 1P3FD 4J8WC 4NFTA 3H0RC 5B24B 4KGCC 3AV1A 5GT3C 1P3OA 5AY8B 3REKC 2XD1A 2HIOD 3KUYA 1TZYB 5B1LB 2NZDD 5CPJD 5DNNC 3AV2C 1M19D 3UT9C 5JRGD 3KWQD 3X1TA 1P3PD 1EQZC 1KX5D 1JFIB 5E5AD 3AZKC 3WTPD 5CPKD 1F66A 4H9QB 4KHAA 3X1UD 5JA4B 3AZLA 5BS7A 4EO5B 1ID3A 3WKJB 4NE3A 4HGAB 1P34B 3UTBD 1P3KB 5CPIC 3KXBC 3MGPC 2Y2KA 2JCHA 4E44A 1S32B 5AV5C 4NE5A 1BFMA 5B0ZD 4WU8A 4J8UB 1U35C 1P3FA 5B31B 3AV1C 3MNND 2AROB 3UTAD 3W97D 5AVBB 2F8NK 4YS3D 4CAYB 3KUYC 1A7WA 3AZMD 1BH8B 4Z5TB 5AV9D 2NZDA 3W99C 5CPJA 3X1TC 4H9SA 4XUJB 2FJ7D 2JSSA 5AVCB 5JRGA 3KWQA 3AZND 1P3PA 4ZUXB 1P3BA 1KX5A 5GXQB 5E5AA 3AZLC 1P3MD 1F66C 4KUDC 3WTPA 5BS7C 2ZY5A 5KDMA 3AN2D 3LZ0C 5CPKA 3MGQB 1P3ID 1ID3C 3X1UA 5AV6B 3O62B 4G92C 3NQUB 3AZIB 3B0DB 2NQBB 3W96C 5BO0B 2ZY2A 4WNNB 1TAFA 5AV8C 4WV4B 5B2JC 1R4VA 4J8VD 3AZHB 1ZLAA 4CSRA 1P3FC 3WAAB 5B0YB 3AZFD 2L5AA 1KX3D 3LZ1B 4R8PD 3MNNA 3W97A 3UTAA 2HIOC 4YS3A 2FFFB 3AZMA 5CPIB 4WJ3C 3KXBB 4WU9D 2NZDC 5CPJC 5AV9A 4H9SC 1M19C 1P3OD 3AZGB 5C3IC 1WWIA 5JRGC 5GT0B 3KWQC 1P3PC 1KX5C 5E5AC 3LELB 3REHD 5B32B 3WTPC 3LJAD 5CPKC 2FJ7A 3AZNA 4QLCD 4J8XB 1P3MA 4H9RB 3AN2A 3VH6W 5CP6D 3X1VB 1P3GA 1M1AB 3A6ND 3RELB 3REID 3UTBC 3W99B 5B31G 2F8NG 4X23D 4G91C 5GSUD 5FUGB 2YFWA 5AVCA 4LD9B 2LY8A 5F99D 5B40A 5B0ZC 3W98D 4J8VA 3AYWD 3B6GD 4UPKA 3O62A 1KX4B 2YFVA 3VH6A 3MNNC 3TU4D 5BNXA 2CV5B 3UTAC 3W97C 3AZFA 1KX3A 4YS3C 2DF4C 2ZY4A 4H9PA 4R8PA 3AZMC 3A1IA 4WU8D 3C1BB 3W96B 3AFAA 4WNNA 3H0LC 5AV9C 4WU9A 5AV8B 4YM6B 3WA9D 3EPJA 3MGSD 3FDDA 1HQ3B 2FJ7C 4Z66A 3B6FD 3AZNC 3WAAA 1P3AD 1P3MC 4H9NB 4Z2MG 3LJAA 3REHA 3AN2C 5DNMD 1P3IC 2PYOA 4QLCA 4DRBA 2CWEA 5CP6A 3MVDB 4JJNA 2BG1A 5B24D 3A6NA 1P3BD 3REIA 1M19B 5AY8D 4AWLC 4X23A 5GSUA 1B6WA 1TZYD 4DRAA 3LELA 5B1LD 4H9OA 4J8VC 3B0CW 5F99A 3V9RA 3MGRB 3W98A 3AYWA 3AZFC 3B6GA 1H3OA 1KX3C 3RELA 3AZJB 3AZEB 4R8PC 5BNVA 3TU4A 2DQNC 1ZLAD 3VH6T 2RVQD 5B32G 3C1CB 4WU9C 4XZQB 5G49A 1P34D 2F8NB 1N1JB 3R45B 1P3LB 1P3OC 3REJB 1P3KD 5B0ZB 3WA9A 5B33B 3MGSA 1M18B 1AOIB 2Y2NA 2IO5B 3REHC 3LJAC 3B6FA 3B0BA 4QLCC 1P3AA 5B2IB 3X1SB 1S32D 5DNMA 5CP6C 4J8UD 3C1BA 4UUZA 3A6NC 5B1MA 3REIC 5B31D 4J8WB 2UWXA 5B24A 5AVBD 4YM6A 4KGCB 4X23C 5GSUC 5GT3B 1P3GD 5AY8A 4Z5TD 3REKB 1TZYA 2G5IC 5F99C 5CHLB 5B1LA 5DNNB 4DQYB 3AV2B 3W98C 3AYWC 3UT9B 3B6GC 3MVDA 5AVCD 3TU4C 1EQZB 4ZUXD 1JFIA 5GXQD 3AZKB 3EG5B 2HUEC 5B40D 2XD5A 4WU8C 3MGQD 4H9QA 5JA4A 5AV6D 3O62D 3WKJA 3P5JB 3AZID 3WA9C 1P34A 3MGSC 1HTAA 2NQBD 1P3KA 3AFAD 3B6FC 1P3AC 2Y2HA 3MGPB 1Z2CB 3B0CT 5DNMC 2Y2GA 1WWSA 3AZHD 1S32A 5AV5B 4Z66D 4J8UA 3C1CA 3WAAD 5B0YD 1U35B 5B24C 1P3BC 4ZBJC 3LZ1D 5B31A 3AV1B 2F8NA 2AROA 5AY8C 2PYOD 5AVBA 3X1UC 3KUYB 4CAYA 1TZYC 1BH8A 4Z5TA 4JJND 5B1LC 5BT1D 4NE6A 2Y2IA 3AZGD 4M6BA 3X1TB 5GT0D 3LELD 4XUJA 5B32D 1Q9CA 2Y2JA 3NQJB 4ZUXA 1F66B 1ZLAC 2RVQC 5GXQA 4J8XD 3AZLB 2W8SA 4KUDB 1ID3B 2G5HC 4EO5C 5GT3A 3LZ0B 3X1VD 3MGQA 1M1AD 4G92B 5AV6A 3RELD 1P34C 3NQUA 3AZIA 1P3KC 5DNNA 2NQBA 5BO0A 1EQZA 4LD9D 1S32C 2RIQA 3IP4C 5B2JB 4J8UC 3AZHA 1P3FB 1T3UA 1KX4D 5B0YA 2CV5D 3EPKA 5AVBC 3LZ1A 2ZY3A 1P3GC 3C1BD 4Z5TC 2HIOB 3W96D 2Y2MA 5B1MD 5CPIA 2Y2QA 3KXBA 1B67A 2NZDB 4E45A 4YM6D 5CPJB 5C3IB 3AZGA 1HQ3D 5JRGB 5AVCC 3KWQB 2BYMB 5GT0A 1P3PB 1U35A 4ZUXC 5E5AB 1P3BB 4ZBJB 5GXQC 1KX5B 3WTPB 5KDMB 5B32A 5B40C 5CPKB 3MGQC 3X1UB 4J8XA 1BH9B 4H9RA 1F1EA 5AV6C 3O62C 3MVDD 3X1VA 3H0MC 1M1AA 3AZIC 3B0DC 4Z2MH 3UTBB 3F6TA 3W99A 2NQBC 3VH5W 3AFAC 4G91B 3WKJD 5FUGA 1TAFB 3EPLA 1ZLAB 3NQJA 4LD9A 4CSRB 3AZHC 4KUDA 3LZ0A 2VQRA 4Z66C 3MGRD 3EPHA 3WAAC 5B0YC 3AZJD 3LZ1C 1KX4A 3AZED 3MNNB 3W97B 3UTAB 2CV5A 2PYOC 4YS3B 3AZMB 3C1CD 4XZQD 4JJNC 3W96A 2JE5A 5BT1C 3VH5A 5AV9B 2F8ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO D;  3AZG C;  1P3L D;  5AV8 A;  3REJ D;  5B2J A;  5B33 D;  5GT0 C;  1M18 D;  1AOI D;  3LEL C;  2FJ7 B;  1HQ3 A;  5B32 C;  3AZN B;  4J8X C;  5B2I D;  1P3M B;  4H9N A;  3X1S D;  3AN2 B;  1P3I B;  3X1V C;  1P3G B;  1M1A C;  3KSY A;  2HIO A;  4XUJ D;  3REL C;  4J8W D;  2BYK B;  4KGC D;  5GT3 D;  1M19 A;  3REK D;  2YFW B;  4AWL B;  2BYM A;  3WTP E;  4LD9 C;  5B40 B;  5DNN D;  3AV2 D;  4J8V B;  1BH9 A;  3UT9 D;  2YFV B;  1ULY A;  3MGR A;  1KX4 C;  5BNX B;  1EQZ D;  2CV5 C;  3AZF B;  1KU5 A;  1KX3 B;  3AZK D;  3AZJ A;  4H9P B;  3AZE A;  4R8P B;  3UTB A;  3C1B C;  3AFA B;  5B1M C;  4WU9 B;  4XZQ A;  4YM6 C;  3VH5 T;  1N1J A;  3R45 A;  1P3L A;  1P3O B;  3REJ A;  1HQ3 C;  4Z66 B;  5B0Z A;  5B33 A;  5CPI D;  1M18 A;  1AOI A;  3KXB D;  3REH B;  3LJA B;  3MGP D;  2PYO B;  4QLC B;  5B2I A;  3X1S A;  5AV5 D;  5CP6 B;  3MVD C;  4JJN B;  1U35 D;  3A6N B;  3REI B;  4J8W A;  3AV1 D;  4KHA B;  4KGC A;  4X23 B;  3KUY D;  5GSU B;  3WKJ C;  4WZS B;  3REK A;  4HGA C;  4H9O B;  5F99 B;  3W99 D;  3V9R B;  1P3I A;  3MGR C;  3W98 B;  3AV2 A;  3AYW B;  3X1T D;  3B6G B;  1H3O B;  3UT9 A;  3AZJ C;  3AZE C;  5BNV B;  3TU4 B;  2BYK A;  1F66 D;  4KUD D;  3AZL D;  3AZK A;  2HUE B;  1ID3 D;  4WU8 B;  3LZ0 D;  3C1C C;  4XZQ C;  2F8N H;  5G49 B;  5B31 C;  2ARO C;  1P3L C;  3REJ C;  3WA9 B;  3MGS B;  5B33 C;  1M18 C;  1AOI C;  2IO5 C;  3B6F B;  1P3A B;  5B2I C;  3MGP A;  3X1S C;  5AV8 D;  5DNM B;  5B2J D;  4UUZ B;  5AV5 A;  4XUJ C;  5B1M B;  1P3F D;  4J8W C;  4NFT A;  5B24 B;  4KGC C;  3AV1 A;  5GT3 C;  1P3O A;  5AY8 B;  3REK C;  2HIO D;  3KUY A;  1TZY B;  5B1L B;  2NZD D;  5CPJ D;  5DNN C;  3AV2 C;  1M19 D;  3UT9 C;  5JRG D;  3KWQ D;  3X1T A;  1P3P D;  1EQZ C;  1KX5 D;  1JFI B;  5E5A D;  3AZK C;  3WTP D;  5CPK D;  1F66 A;  4H9Q B;  4KHA A;  3X1U D;  5JA4 B;  3AZL A;  5BS7 A;  4EO5 B;  1ID3 A;  3WKJ B;  4NE3 A;  4HGA B;  1P34 B;  3UTB D;  1P3K B;  5CPI C;  3KXB C;  3MGP C;  4E44 A;  1S32 B;  5AV5 C;  4NE5 A;  1BFM A;  5B0Z D;  4WU8 A;  4J8U B;  1U35 C;  1P3F A;  5B31 B;  3AV1 C;  3MNN D;  2ARO B;  3UTA D;  3W97 D;  5AVB B;  2F8N K;  4YS3 D;  4CAY B;  3KUY C;  1A7W A;  3AZM D;  1BH8 B;  4Z5T B;  5AV9 D;  2NZD A;  3W99 C;  5CPJ A;  3X1T C;  4H9S A;  4XUJ B;  2FJ7 D;  2JSS A;  5AVC B;  5JRG A;  3KWQ A;  3AZN D;  1P3P A;  4ZUX B;  1P3B A;  1KX5 A;  5GXQ B;  5E5A A;  3AZL C;  1P3M D;  1F66 C;  4KUD C;  3WTP A;  5BS7 C;  5KDM A;  3AN2 D;  5CPK A;  3LZ0 C;  1P3I D;  3MGQ B;  1ID3 C;  3X1U A;  5AV6 B;  3O62 B;  4G92 C;  3NQU B;  3AZI B;  3B0D B;  2NQB B;  3W96 C;  5BO0 B;  4WNN B;  1TAF A;  5AV8 C;  4WV4 B;  5B2J C;  1R4V A;  4J8V D;  3AZH B;  1ZLA A;  4CSR A;  1P3F C;  3WAA B;  5B0Y B;  3AZF D;  2L5A A;  1KX3 D;  3LZ1 B;  4R8P D;  3MNN A;  3W97 A;  3UTA A;  2HIO C;  4YS3 A;  3AZM A;  5CPI B;  3KXB B;  4WU9 D;  2NZD C;  5CPJ C;  5AV9 A;  4H9S C;  1M19 C;  1P3O D;  3AZG B;  5C3I C;  1WWI A;  5JRG C;  5GT0 B;  3KWQ C;  1P3P C;  1KX5 C;  5E5A C;  3LEL B;  3REH D;  5B32 B;  3WTP C;  3LJA D;  5CPK C;  2FJ7 A;  3AZN A;  4QLC D;  4J8X B;  1P3M A;  4H9R B;  3AN2 A;  3VH6 W;  5CP6 D;  3X1V B;  1P3G A;  1M1A B;  3A6N D;  3REL B;  3REI D;  3UTB C;  3W99 B;  5B31 G;  2F8N G;  4X23 D;  4G91 C;  5GSU D;  5FUG B;  2YFW A;  5AVC A;  4LD9 B;  2LY8 A;  5F99 D;  5B40 A;  5B0Z C;  3W98 D;  4J8V A;  3AYW D;  3B6G D;  3O62 A;  1KX4 B;  2YFV A;  3VH6 A;  3MNN C;  3TU4 D;  5BNX A;  2CV5 B;  3UTA C;  3W97 C;  3AZF A;  1KX3 A;  4YS3 C;  4H9P A;  4R8P A;  3AZM C;  4WU8 D;  3C1B B;  3W96 B;  3AFA A;  4WNN A;  5AV9 C;  4WU9 A;  5AV8 B;  4YM6 B;  3WA9 D;  3MGS D;  1HQ3 B;  2FJ7 C;  4Z66 A;  3B6F D;  3AZN C;  3WAA A;  1P3A D;  1P3M C;  4H9N B;  4Z2M G;  3LJA A;  3REH A;  3AN2 C;  5DNM D;  1P3I C;  2PYO A;  4QLC A;  4DRB A;  2CWE A;  5CP6 A;  3MVD B;  4JJN A;  5B24 D;  3A6N A;  1P3B D;  3REI A;  1M19 B;  5AY8 D;  4AWL C;  4X23 A;  5GSU A;  1B6W A;  1TZY D;  4DRA A;  3LEL A;  5B1L D;  4H9O A;  4J8V C;  3B0C W;  5F99 A;  3V9R A;  3MGR B;  3W98 A;  3AYW A;  3AZF C;  3B6G A;  1H3O A;  1KX3 C;  3REL A;  3AZJ B;  3AZE B;  4R8P C;  5BNV A;  3TU4 A;  1ZLA D;  3VH6 T;  2RVQ D;  5B32 G;  3C1C B;  4WU9 C;  4XZQ B;  5G49 A;  1P34 D;  2F8N B;  1N1J B;  3R45 B;  1P3L B;  1P3O C;  3REJ B;  1P3K D;  5B0Z B;  3WA9 A;  5B33 B;  3MGS A;  1M18 B;  1AOI B;  2IO5 B;  3REH C;  3LJA C;  3B6F A;  3B0B A;  4QLC C;  1P3A A;  5B2I B;  3X1S B;  1S32 D;  5DNM A;  5CP6 C;  4J8U D;  3C1B A;  4UUZ A;  3A6N C;  5B1M A;  3REI C;  5B31 D;  4J8W B;  5B24 A;  5AVB D;  4YM6 A;  4KGC B;  4X23 C;  5GSU C;  5GT3 B;  1P3G D;  5AY8 A;  4Z5T D;  3REK B;  1TZY A;  5F99 C;  5CHL B;  5B1L A;  5DNN B;  3AV2 B;  3W98 C;  3AYW C;  3UT9 B;  3B6G C;  3MVD A;  5AVC D;  3TU4 C;  1EQZ B;  4ZUX D;  1JFI A;  5GXQ D;  3AZK B;  2HUE C;  5B40 D;  4WU8 C;  3MGQ D;  4H9Q A;  5JA4 A;  5AV6 D;  3O62 D;  3WKJ A;  3AZI D;  3WA9 C;  1P34 A;  3MGS C;  1HTA A;  2NQB D;  1P3K A;  3AFA D;  3B6F C;  1P3A C;  3MGP B;  3B0C T;  5DNM C;  1WWS A;  3AZH D;  1S32 A;  5AV5 B;  4Z66 D;  4J8U A;  3C1C A;  3WAA D;  5B0Y D;  1U35 B;  5B24 C;  1P3B C;  4ZBJ C;  3LZ1 D;  5B31 A;  3AV1 B;  2F8N A;  2ARO A;  5AY8 C;  2PYO D;  5AVB A;  3X1U C;  3KUY B;  4CAY A;  1TZY C;  1BH8 A;  4Z5T A;  4JJN D;  5B1L C;  5BT1 D;  4NE6 A;  3AZG D;  4M6B A;  3X1T B;  5GT0 D;  3LEL D;  4XUJ A;  5B32 D;  1Q9C A;  3NQJ B;  4ZUX A;  1F66 B;  1ZLA C;  2RVQ C;  5GXQ A;  4J8X D;  3AZL B;  4KUD B;  1ID3 B;  4EO5 C;  3LZ0 B;  5GT3 A;  3X1V D;  1M1A D;  3MGQ A;  4G92 B;  5AV6 A;  3REL D;  1P34 C;  3NQU A;  3AZI A;  1P3K C;  5DNN A;  2NQB A;  5BO0 A;  1EQZ A;  4LD9 D;  1S32 C;  5B2J B;  4J8U C;  3AZH A;  1P3F B;  1KX4 D;  5B0Y A;  2CV5 D;  5AVB C;  3LZ1 A;  1P3G C;  3C1B D;  4Z5T C;  2HIO B;  3W96 D;  5B1M D;  5CPI A;  3KXB A;  1B67 A;  2NZD B;  4E45 A;  4YM6 D;  5CPJ B;  5C3I B;  3AZG A;  1HQ3 D;  5JRG B;  5AVC C;  3KWQ B;  2BYM B;  5GT0 A;  1P3P B;  1U35 A;  4ZUX C;  5E5A B;  1P3B B;  4ZBJ B;  5GXQ C;  1KX5 B;  3WTP B;  5KDM B;  5B32 A;  5B40 C;  5CPK B;  3MGQ C;  3X1U B;  4J8X A;  1BH9 B;  4H9R A;  1F1E A;  5AV6 C;  3O62 C;  3MVD D;  3X1V A;  1M1A A;  3AZI C;  3B0D C;  4Z2M H;  3UTB B;  3W99 A;  2NQB C;  3VH5 W;  3AFA C;  4G91 B;  3WKJ D;  5FUG A;  1TAF B;  1ZLA B;  3NQJ A;  4LD9 A;  4CSR B;  3AZH C;  4KUD A;  3LZ0 A;  4Z66 C;  3MGR D;  3WAA C;  5B0Y C;  3AZJ D;  3LZ1 C;  1KX4 A;  3AZE D;  3MNN B;  3W97 B;  3UTA B;  2CV5 A;  2PYO C;  4YS3 B;  3AZM B;  3C1C D;  4XZQ D;  4JJN C;  3W96 A;  5BT1 C;  3VH5 A;  5AV9 B;  2F8N D; 
#chains in the Genus database with same CATH topology
 2ARO D;  3AZG C;  1P3L D;  5AV8 A;  3REJ D;  5B2J A;  5B33 D;  5GT0 C;  1M18 D;  1AOI D;  3LEL C;  2FJ7 B;  1HQ3 A;  5B32 C;  3AZN B;  4J8X C;  5B2I D;  2J8P A;  1P3M B;  4H9N A;  3X1S D;  2Y2O A;  3AN2 B;  1P3I B;  3X1V C;  1P3G B;  1M1A C;  3KSY A;  3KFU G;  2HIO A;  4XUJ D;  3REL C;  4J8W D;  2BYK B;  4KGC D;  5GT3 D;  1M19 A;  3REK D;  2YFW B;  4AWL B;  2BYM A;  3WTP E;  4LD9 C;  5B40 B;  5DNN D;  3AV2 D;  4J8V B;  1BH9 A;  3UT9 D;  2YFV B;  1ULY A;  3MGR A;  1KX4 C;  1PZR A;  5BNX B;  1EQZ D;  2CV5 C;  3AZF B;  1KU5 A;  1KX3 B;  3AZK D;  3AZJ A;  4H9P B;  3AZE A;  4R8P B;  3UTB A;  3C1B C;  2Y2P A;  3AFA B;  5B1M C;  4WU9 B;  4XZQ A;  4YM6 C;  2Y2L A;  3VH5 T;  1N1J A;  3R45 A;  1P3L A;  1P3O B;  3REJ A;  1HQ3 C;  4Z66 B;  5B0Z A;  5B33 A;  5CPI D;  1M18 A;  1AOI A;  3KXB D;  3REH B;  3LJA B;  3MGP D;  2PYO B;  4QLC B;  5B2I A;  3AL0 C;  3X1S A;  5AV5 D;  5CP6 B;  3MVD C;  4JJN B;  1U35 D;  3A6N B;  3REI B;  3A1K A;  4J8W A;  3AV1 D;  4KHA B;  4KGC A;  4X23 B;  3KUY D;  5GSU B;  3WKJ C;  4WZS B;  3REK A;  4HGA C;  4H9O B;  5F99 B;  3W99 D;  3V9R B;  1P3I A;  3MGR C;  3W98 B;  3AV2 A;  3AYW B;  3X1T D;  3B6G B;  1H3O B;  3UT9 A;  3AZJ C;  3AZE C;  5BNV B;  2ZM5 A;  3TU4 B;  2BYK A;  2F2A C;  1F66 D;  4KUD D;  3AZL D;  3AZK A;  2HUE B;  1ID3 D;  4WU8 B;  3LZ0 D;  3C1C C;  4XZQ C;  2F8N H;  5G49 B;  5B31 C;  2ARO C;  1P3L C;  3REJ C;  3WA9 B;  3MGS B;  5B33 C;  1M18 C;  1AOI C;  2IO5 C;  3B6F B;  1P3A B;  5B2I C;  3MGP A;  3X1S C;  5AV8 D;  5DNM B;  1W2E A;  5B2J D;  4UUZ B;  5AV5 A;  4XUJ C;  5B1M B;  1P3F D;  4J8W C;  4NFT A;  3H0R C;  5B24 B;  4KGC C;  3AV1 A;  5GT3 C;  1P3O A;  5AY8 B;  3REK C;  2XD1 A;  2HIO D;  3KUY A;  1TZY B;  5B1L B;  2NZD D;  5CPJ D;  5DNN C;  3AV2 C;  1M19 D;  3UT9 C;  5JRG D;  3KWQ D;  3X1T A;  1P3P D;  1EQZ C;  1KX5 D;  1JFI B;  5E5A D;  3AZK C;  3WTP D;  5CPK D;  1F66 A;  4H9Q B;  4KHA A;  3X1U D;  5JA4 B;  3AZL A;  5BS7 A;  4EO5 B;  1ID3 A;  3WKJ B;  4NE3 A;  4HGA B;  1P34 B;  3UTB D;  1P3K B;  5CPI C;  3KXB C;  3MGP C;  2Y2K A;  2JCH A;  4E44 A;  1S32 B;  5AV5 C;  4NE5 A;  1BFM A;  5B0Z D;  4WU8 A;  4J8U B;  1U35 C;  1P3F A;  5B31 B;  3AV1 C;  3MNN D;  2ARO B;  3UTA D;  3W97 D;  5AVB B;  2F8N K;  4YS3 D;  4CAY B;  3KUY C;  1A7W A;  3AZM D;  1BH8 B;  4Z5T B;  5AV9 D;  2NZD A;  3W99 C;  5CPJ A;  3X1T C;  4H9S A;  4XUJ B;  2FJ7 D;  2JSS A;  5AVC B;  5JRG A;  3KWQ A;  3AZN D;  1P3P A;  4ZUX B;  1P3B A;  1KX5 A;  5GXQ B;  5E5A A;  3AZL C;  1P3M D;  1F66 C;  4KUD C;  3WTP A;  5BS7 C;  2ZY5 A;  5KDM A;  3AN2 D;  3LZ0 C;  5CPK A;  3MGQ B;  1P3I D;  1ID3 C;  3X1U A;  5AV6 B;  3O62 B;  4G92 C;  3NQU B;  3AZI B;  3B0D B;  2NQB B;  3W96 C;  5BO0 B;  2ZY2 A;  4WNN B;  1TAF A;  5AV8 C;  4WV4 B;  5B2J C;  1R4V A;  4J8V D;  3AZH B;  1ZLA A;  4CSR A;  1P3F C;  3WAA B;  5B0Y B;  3AZF D;  2L5A A;  1KX3 D;  3LZ1 B;  4R8P D;  3MNN A;  3W97 A;  3UTA A;  2HIO C;  4YS3 A;  2FFF B;  3AZM A;  5CPI B;  4WJ3 C;  3KXB B;  4WU9 D;  2NZD C;  5CPJ C;  5AV9 A;  4H9S C;  1M19 C;  1P3O D;  3AZG B;  5C3I C;  1WWI A;  5JRG C;  5GT0 B;  3KWQ C;  1P3P C;  1KX5 C;  5E5A C;  3LEL B;  3REH D;  5B32 B;  3WTP C;  3LJA D;  5CPK C;  2FJ7 A;  3AZN A;  4QLC D;  4J8X B;  1P3M A;  4H9R B;  3AN2 A;  3VH6 W;  5CP6 D;  3X1V B;  1P3G A;  1M1A B;  3A6N D;  3REL B;  3REI D;  3UTB C;  3W99 B;  5B31 G;  2F8N G;  4X23 D;  4G91 C;  5GSU D;  5FUG B;  2YFW A;  5AVC A;  4LD9 B;  2LY8 A;  5F99 D;  5B40 A;  5B0Z C;  3W98 D;  4J8V A;  3AYW D;  3B6G D;  4UPK A;  3O62 A;  1KX4 B;  2YFV A;  3VH6 A;  3MNN C;  3TU4 D;  5BNX A;  2CV5 B;  3UTA C;  3W97 C;  3AZF A;  1KX3 A;  4YS3 C;  2DF4 C;  2ZY4 A;  4H9P A;  4R8P A;  3AZM C;  3A1I A;  4WU8 D;  3C1B B;  3W96 B;  3AFA A;  4WNN A;  3H0L C;  5AV9 C;  4WU9 A;  5AV8 B;  4YM6 B;  3WA9 D;  3EPJ A;  3MGS D;  3FDD A;  1HQ3 B;  2FJ7 C;  4Z66 A;  3B6F D;  3AZN C;  3WAA A;  1P3A D;  1P3M C;  4H9N B;  4Z2M G;  3LJA A;  3REH A;  3AN2 C;  5DNM D;  1P3I C;  2PYO A;  4QLC A;  4DRB A;  2CWE A;  5CP6 A;  3MVD B;  4JJN A;  2BG1 A;  5B24 D;  3A6N A;  1P3B D;  3REI A;  1M19 B;  5AY8 D;  4AWL C;  4X23 A;  5GSU A;  1B6W A;  1TZY D;  4DRA A;  3LEL A;  5B1L D;  4H9O A;  4J8V C;  3B0C W;  5F99 A;  3V9R A;  3MGR B;  3W98 A;  3AYW A;  3AZF C;  3B6G A;  1H3O A;  1KX3 C;  3REL A;  3AZJ B;  3AZE B;  4R8P C;  5BNV A;  3TU4 A;  2DQN C;  1ZLA D;  3VH6 T;  2RVQ D;  5B32 G;  3C1C B;  4WU9 C;  4XZQ B;  5G49 A;  1P34 D;  2F8N B;  1N1J B;  3R45 B;  1P3L B;  1P3O C;  3REJ B;  1P3K D;  5B0Z B;  3WA9 A;  5B33 B;  3MGS A;  1M18 B;  1AOI B;  2Y2N A;  2IO5 B;  3REH C;  3LJA C;  3B6F A;  3B0B A;  4QLC C;  1P3A A;  5B2I B;  3X1S B;  1S32 D;  5DNM A;  5CP6 C;  4J8U D;  3C1B A;  4UUZ A;  3A6N C;  5B1M A;  3REI C;  5B31 D;  4J8W B;  2UWX A;  5B24 A;  5AVB D;  4YM6 A;  4KGC B;  4X23 C;  5GSU C;  5GT3 B;  1P3G D;  5AY8 A;  4Z5T D;  3REK B;  1TZY A;  2G5I C;  5F99 C;  5CHL B;  5B1L A;  5DNN B;  4DQY B;  3AV2 B;  3W98 C;  3AYW C;  3UT9 B;  3B6G C;  3MVD A;  5AVC D;  3TU4 C;  1EQZ B;  4ZUX D;  1JFI A;  5GXQ D;  3AZK B;  3EG5 B;  2HUE C;  5B40 D;  2XD5 A;  4WU8 C;  3MGQ D;  4H9Q A;  5JA4 A;  5AV6 D;  3O62 D;  3WKJ A;  3P5J B;  3AZI D;  3WA9 C;  1P34 A;  3MGS C;  1HTA A;  2NQB D;  1P3K A;  3AFA D;  3B6F C;  1P3A C;  2Y2H A;  3MGP B;  1Z2C B;  3B0C T;  5DNM C;  2Y2G A;  1WWS A;  3AZH D;  1S32 A;  5AV5 B;  4Z66 D;  4J8U A;  3C1C A;  3WAA D;  5B0Y D;  1U35 B;  5B24 C;  1P3B C;  4ZBJ C;  3LZ1 D;  5B31 A;  3AV1 B;  2F8N A;  2ARO A;  5AY8 C;  2PYO D;  5AVB A;  3X1U C;  3KUY B;  4CAY A;  1TZY C;  1BH8 A;  4Z5T A;  4JJN D;  5B1L C;  5BT1 D;  4NE6 A;  2Y2I A;  3AZG D;  4M6B A;  3X1T B;  5GT0 D;  3LEL D;  4XUJ A;  5B32 D;  1Q9C A;  2Y2J A;  3NQJ B;  4ZUX A;  1F66 B;  1ZLA C;  2RVQ C;  5GXQ A;  4J8X D;  3AZL B;  2W8S A;  4KUD B;  1ID3 B;  2G5H C;  4EO5 C;  5GT3 A;  3LZ0 B;  3X1V D;  3MGQ A;  1M1A D;  4G92 B;  5AV6 A;  3REL D;  1P34 C;  3NQU A;  3AZI A;  1P3K C;  5DNN A;  2NQB A;  5BO0 A;  1EQZ A;  4LD9 D;  1S32 C;  2RIQ A;  3IP4 C;  5B2J B;  4J8U C;  3AZH A;  1P3F B;  1T3U A;  1KX4 D;  5B0Y A;  2CV5 D;  3EPK A;  5AVB C;  3LZ1 A;  2ZY3 A;  1P3G C;  3C1B D;  4Z5T C;  2HIO B;  3W96 D;  2Y2M A;  5B1M D;  5CPI A;  2Y2Q A;  3KXB A;  1B67 A;  2NZD B;  4E45 A;  4YM6 D;  5CPJ B;  5C3I B;  3AZG A;  1HQ3 D;  5JRG B;  5AVC C;  3KWQ B;  2BYM B;  5GT0 A;  1P3P B;  1U35 A;  4ZUX C;  5E5A B;  1P3B B;  4ZBJ B;  5GXQ C;  1KX5 B;  3WTP B;  5KDM B;  5B32 A;  5B40 C;  5CPK B;  3MGQ C;  3X1U B;  4J8X A;  1BH9 B;  4H9R A;  1F1E A;  5AV6 C;  3O62 C;  3MVD D;  3X1V A;  3H0M C;  1M1A A;  3AZI C;  3B0D C;  4Z2M H;  3UTB B;  3F6T A;  3W99 A;  2NQB C;  3VH5 W;  3AFA C;  4G91 B;  3WKJ D;  5FUG A;  1TAF B;  3EPL A;  1ZLA B;  3NQJ A;  4LD9 A;  4CSR B;  3AZH C;  4KUD A;  3LZ0 A;  2VQR A;  4Z66 C;  3MGR D;  3EPH A;  3WAA C;  5B0Y C;  3AZJ D;  3LZ1 C;  1KX4 A;  3AZE D;  3MNN B;  3W97 B;  3UTA B;  2CV5 A;  2PYO C;  4YS3 B;  3AZM B;  3C1C D;  4XZQ D;  4JJN C;  3W96 A;  2JE5 A;  5BT1 C;  3VH5 A;  5AV9 B;  2F8N D; 
#chains in the Genus database with same CATH homology
 2ARO D;  3AZG C;  1P3L D;  5AV8 A;  3REJ D;  5B2J A;  5B33 D;  5GT0 C;  1M18 D;  1AOI D;  3LEL C;  2FJ7 B;  1HQ3 A;  5B32 C;  3AZN B;  4J8X C;  5B2I D;  2J8P A;  1P3M B;  4H9N A;  3X1S D;  2Y2O A;  3AN2 B;  1P3I B;  3X1V C;  1P3G B;  1M1A C;  3KSY A;  3KFU G;  2HIO A;  4XUJ D;  3REL C;  4J8W D;  2BYK B;  4KGC D;  5GT3 D;  1M19 A;  3REK D;  2YFW B;  4AWL B;  2BYM A;  3WTP E;  4LD9 C;  5B40 B;  5DNN D;  3AV2 D;  4J8V B;  1BH9 A;  3UT9 D;  2YFV B;  1ULY A;  3MGR A;  1KX4 C;  1PZR A;  5BNX B;  1EQZ D;  2CV5 C;  3AZF B;  1KU5 A;  1KX3 B;  3AZK D;  3AZJ A;  4H9P B;  3AZE A;  4R8P B;  3UTB A;  3C1B C;  2Y2P A;  3AFA B;  5B1M C;  4WU9 B;  4XZQ A;  4YM6 C;  2Y2L A;  3VH5 T;  1N1J A;  3R45 A;  1P3L A;  1P3O B;  3REJ A;  1HQ3 C;  4Z66 B;  5B0Z A;  5B33 A;  5CPI D;  1M18 A;  1AOI A;  3KXB D;  3REH B;  3LJA B;  3MGP D;  2PYO B;  4QLC B;  5B2I A;  3AL0 C;  3X1S A;  5AV5 D;  5CP6 B;  3MVD C;  4JJN B;  1U35 D;  3A6N B;  3REI B;  3A1K A;  4J8W A;  3AV1 D;  4KHA B;  4KGC A;  4X23 B;  3KUY D;  5GSU B;  3WKJ C;  4WZS B;  3REK A;  4HGA C;  4H9O B;  5F99 B;  3W99 D;  3V9R B;  1P3I A;  3MGR C;  3W98 B;  3AV2 A;  3AYW B;  3X1T D;  3B6G B;  1H3O B;  3UT9 A;  3AZJ C;  3AZE C;  5BNV B;  2ZM5 A;  3TU4 B;  2BYK A;  2F2A C;  1F66 D;  4KUD D;  3AZL D;  3AZK A;  2HUE B;  1ID3 D;  4WU8 B;  3LZ0 D;  3C1C C;  4XZQ C;  2F8N H;  5G49 B;  5B31 C;  2ARO C;  1P3L C;  3REJ C;  3WA9 B;  3MGS B;  5B33 C;  1M18 C;  1AOI C;  2IO5 C;  3B6F B;  1P3A B;  5B2I C;  3MGP A;  3X1S C;  5AV8 D;  5DNM B;  1W2E A;  5B2J D;  4UUZ B;  5AV5 A;  4XUJ C;  5B1M B;  1P3F D;  4J8W C;  4NFT A;  3H0R C;  5B24 B;  4KGC C;  3AV1 A;  5GT3 C;  1P3O A;  5AY8 B;  3REK C;  2XD1 A;  2HIO D;  3KUY A;  1TZY B;  5B1L B;  2NZD D;  5CPJ D;  5DNN C;  3AV2 C;  1M19 D;  3UT9 C;  5JRG D;  3KWQ D;  3X1T A;  1P3P D;  1EQZ C;  1KX5 D;  1JFI B;  5E5A D;  3AZK C;  3WTP D;  5CPK D;  1F66 A;  4H9Q B;  4KHA A;  3X1U D;  5JA4 B;  3AZL A;  5BS7 A;  4EO5 B;  1ID3 A;  3WKJ B;  4NE3 A;  4HGA B;  1P34 B;  3UTB D;  1P3K B;  5CPI C;  3KXB C;  3MGP C;  2Y2K A;  2JCH A;  4E44 A;  1S32 B;  5AV5 C;  4NE5 A;  1BFM A;  5B0Z D;  4WU8 A;  4J8U B;  1U35 C;  1P3F A;  5B31 B;  3AV1 C;  3MNN D;  2ARO B;  3UTA D;  3W97 D;  5AVB B;  2F8N K;  4YS3 D;  4CAY B;  3KUY C;  1A7W A;  3AZM D;  1BH8 B;  4Z5T B;  5AV9 D;  2NZD A;  3W99 C;  5CPJ A;  3X1T C;  4H9S A;  4XUJ B;  2FJ7 D;  2JSS A;  5AVC B;  5JRG A;  3KWQ A;  3AZN D;  1P3P A;  4ZUX B;  1P3B A;  1KX5 A;  5GXQ B;  5E5A A;  3AZL C;  1P3M D;  1F66 C;  4KUD C;  3WTP A;  5BS7 C;  2ZY5 A;  5KDM A;  3AN2 D;  3LZ0 C;  5CPK A;  3MGQ B;  1P3I D;  1ID3 C;  3X1U A;  5AV6 B;  3O62 B;  4G92 C;  3NQU B;  3AZI B;  3B0D B;  2NQB B;  3W96 C;  5BO0 B;  2ZY2 A;  4WNN B;  1TAF A;  5AV8 C;  4WV4 B;  5B2J C;  1R4V A;  4J8V D;  3AZH B;  1ZLA A;  4CSR A;  1P3F C;  3WAA B;  5B0Y B;  3AZF D;  2L5A A;  1KX3 D;  3LZ1 B;  4R8P D;  3MNN A;  3W97 A;  3UTA A;  2HIO C;  4YS3 A;  2FFF B;  3AZM A;  5CPI B;  4WJ3 C;  3KXB B;  4WU9 D;  2NZD C;  5CPJ C;  5AV9 A;  4H9S C;  1M19 C;  1P3O D;  3AZG B;  5C3I C;  1WWI A;  5JRG C;  5GT0 B;  3KWQ C;  1P3P C;  1KX5 C;  5E5A C;  3LEL B;  3REH D;  5B32 B;  3WTP C;  3LJA D;  5CPK C;  2FJ7 A;  3AZN A;  4QLC D;  4J8X B;  1P3M A;  4H9R B;  3AN2 A;  3VH6 W;  5CP6 D;  3X1V B;  1P3G A;  1M1A B;  3A6N D;  3REL B;  3REI D;  3UTB C;  3W99 B;  5B31 G;  2F8N G;  4X23 D;  4G91 C;  5GSU D;  5FUG B;  2YFW A;  5AVC A;  4LD9 B;  2LY8 A;  5F99 D;  5B40 A;  5B0Z C;  3W98 D;  4J8V A;  3AYW D;  3B6G D;  4UPK A;  3O62 A;  1KX4 B;  2YFV A;  3VH6 A;  3MNN C;  3TU4 D;  5BNX A;  2CV5 B;  3UTA C;  3W97 C;  3AZF A;  1KX3 A;  4YS3 C;  2DF4 C;  2ZY4 A;  4H9P A;  4R8P A;  3AZM C;  3A1I A;  4WU8 D;  3C1B B;  3W96 B;  3AFA A;  4WNN A;  3H0L C;  5AV9 C;  4WU9 A;  5AV8 B;  4YM6 B;  3WA9 D;  3EPJ A;  3MGS D;  3FDD A;  1HQ3 B;  2FJ7 C;  4Z66 A;  3B6F D;  3AZN C;  3WAA A;  1P3A D;  1P3M C;  4H9N B;  4Z2M G;  3LJA A;  3REH A;  3AN2 C;  5DNM D;  1P3I C;  2PYO A;  4QLC A;  4DRB A;  2CWE A;  5CP6 A;  3MVD B;  4JJN A;  2BG1 A;  5B24 D;  3A6N A;  1P3B D;  3REI A;  1M19 B;  5AY8 D;  4AWL C;  4X23 A;  5GSU A;  1B6W A;  1TZY D;  4DRA A;  3LEL A;  5B1L D;  4H9O A;  4J8V C;  3B0C W;  5F99 A;  3V9R A;  3MGR B;  3W98 A;  3AYW A;  3AZF C;  3B6G A;  1H3O A;  1KX3 C;  3REL A;  3AZJ B;  3AZE B;  4R8P C;  5BNV A;  3TU4 A;  2DQN C;  1ZLA D;  3VH6 T;  2RVQ D;  5B32 G;  3C1C B;  4WU9 C;  4XZQ B;  5G49 A;  1P34 D;  2F8N B;  1N1J B;  3R45 B;  1P3L B;  1P3O C;  3REJ B;  1P3K D;  5B0Z B;  3WA9 A;  5B33 B;  3MGS A;  1M18 B;  1AOI B;  2Y2N A;  2IO5 B;  3REH C;  3LJA C;  3B6F A;  3B0B A;  4QLC C;  1P3A A;  5B2I B;  3X1S B;  1S32 D;  5DNM A;  5CP6 C;  4J8U D;  3C1B A;  4UUZ A;  3A6N C;  5B1M A;  3REI C;  5B31 D;  4J8W B;  2UWX A;  5B24 A;  5AVB D;  4YM6 A;  4KGC B;  4X23 C;  5GSU C;  5GT3 B;  1P3G D;  5AY8 A;  4Z5T D;  3REK B;  1TZY A;  2G5I C;  5F99 C;  5CHL B;  5B1L A;  5DNN B;  4DQY B;  3AV2 B;  3W98 C;  3AYW C;  3UT9 B;  3B6G C;  3MVD A;  5AVC D;  3TU4 C;  1EQZ B;  4ZUX D;  1JFI A;  5GXQ D;  3AZK B;  3EG5 B;  2HUE C;  5B40 D;  2XD5 A;  4WU8 C;  3MGQ D;  4H9Q A;  5JA4 A;  5AV6 D;  3O62 D;  3WKJ A;  3P5J B;  3AZI D;  3WA9 C;  1P34 A;  3MGS C;  1HTA A;  2NQB D;  1P3K A;  3AFA D;  3B6F C;  1P3A C;  2Y2H A;  3MGP B;  1Z2C B;  3B0C T;  5DNM C;  2Y2G A;  1WWS A;  3AZH D;  1S32 A;  5AV5 B;  4Z66 D;  4J8U A;  3C1C A;  3WAA D;  5B0Y D;  1U35 B;  5B24 C;  1P3B C;  4ZBJ C;  3LZ1 D;  5B31 A;  3AV1 B;  2F8N A;  2ARO A;  5AY8 C;  2PYO D;  5AVB A;  3X1U C;  3KUY B;  4CAY A;  1TZY C;  1BH8 A;  4Z5T A;  4JJN D;  5B1L C;  5BT1 D;  4NE6 A;  2Y2I A;  3AZG D;  4M6B A;  3X1T B;  5GT0 D;  3LEL D;  4XUJ A;  5B32 D;  1Q9C A;  2Y2J A;  3NQJ B;  4ZUX A;  1F66 B;  1ZLA C;  2RVQ C;  5GXQ A;  4J8X D;  3AZL B;  2W8S A;  4KUD B;  1ID3 B;  2G5H C;  4EO5 C;  5GT3 A;  3LZ0 B;  3X1V D;  3MGQ A;  1M1A D;  4G92 B;  5AV6 A;  3REL D;  1P34 C;  3NQU A;  3AZI A;  1P3K C;  5DNN A;  2NQB A;  5BO0 A;  1EQZ A;  4LD9 D;  1S32 C;  2RIQ A;  3IP4 C;  5B2J B;  4J8U C;  3AZH A;  1P3F B;  1T3U A;  1KX4 D;  5B0Y A;  2CV5 D;  3EPK A;  5AVB C;  3LZ1 A;  2ZY3 A;  1P3G C;  3C1B D;  4Z5T C;  2HIO B;  3W96 D;  2Y2M A;  5B1M D;  5CPI A;  2Y2Q A;  3KXB A;  1B67 A;  2NZD B;  4E45 A;  4YM6 D;  5CPJ B;  5C3I B;  3AZG A;  1HQ3 D;  5JRG B;  5AVC C;  3KWQ B;  2BYM B;  5GT0 A;  1P3P B;  1U35 A;  4ZUX C;  5E5A B;  1P3B B;  4ZBJ B;  5GXQ C;  1KX5 B;  3WTP B;  5KDM B;  5B32 A;  5B40 C;  5CPK B;  3MGQ C;  3X1U B;  4J8X A;  1BH9 B;  4H9R A;  1F1E A;  5AV6 C;  3O62 C;  3MVD D;  3X1V A;  3H0M C;  1M1A A;  3AZI C;  3B0D C;  4Z2M H;  3UTB B;  3F6T A;  3W99 A;  2NQB C;  3VH5 W;  3AFA C;  4G91 B;  3WKJ D;  5FUG A;  1TAF B;  3EPL A;  1ZLA B;  3NQJ A;  4LD9 A;  4CSR B;  3AZH C;  4KUD A;  3LZ0 A;  2VQR A;  4Z66 C;  3MGR D;  3EPH A;  3WAA C;  5B0Y C;  3AZJ D;  3LZ1 C;  1KX4 A;  3AZE D;  3MNN B;  3W97 B;  3UTA B;  2CV5 A;  2PYO C;  4YS3 B;  3AZM B;  3C1C D;  4XZQ D;  4JJN C;  3W96 A;  2JE5 A;  5BT1 C;  3VH5 A;  5AV9 B;  2F8N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...