3O62C

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62C00
3LELD 4G91B 5GT3D 5KDMB 3REIA 4KHAB 5B0YC 4YM6D 5AV6B 3UTBB 1S32D 2RVQC 3AZFB 5B2IA 3LELB 1ULYA 3VH6A 4LD9D 4H9SA 4M6BA 2HIOA 4H9NB 1S32B 2F8NA 3TU4B 3A6NA 3AZJA 3UTBC 4NE6A 5B40B 5DNND 3KWQA 1P3PB 5FUGB 3X1VC 5AVCA 4KGCB 4LD9B 3B0BA 3LELC 3X1SC 3X1TB 4R8PB 5BO0B 5GT3C 5AV8A 2IO5B 2NQBD 3WTPD 3AZHD 1M19A 3W97B 3UTAD 1BH8B 3AV1D 4YM6C 5DNNB 5F99A 1S32C 2PYOD 1B67A 5GT0B 1TZYB 3AYWB 1U35C 1P3AD 3UTAB 3AV1B 5AV9D 3AZEA 3MVDA 3AZND 3AN2D 3B6FA 4J8VD 1EQZB 2F8NG 3REHA 3AZIB 2PYOB 4HGAB 5BNVB 1P3GD 5B33D 3REKB 1F1EA 5DNNC 4WU9A 5AV9B 3AFAD 3AV2A 1P34A 3UT9D 4Z5TD 4J8VB 4JJND 2YFVA 5GSUA 2NQBC 2BYMB 3WTPC 3AZHC 3LZ0D 3MGSA 3UTAC 3REJC 5B33B 1BH9B 4CSRB 3AFAB 3REIC 2PYOC 4HGAC 4Z5TB 4JJNB 4X23D 3NQJB 5AY8B 5E5AD 5CPID 1P3AC 1P3OD 4ZUXA 3MGQA 5B32A 5AV9C 3AZNC 4H9PA 3AN2C 5B31A 5B2IC 4J8VC 5JRGB 3AZMB 3LZ1B 1P3GC 4X23B 5B33C 3WAAB 1M18B 5CPIB 1P3OB 1H3OA 3O62B 2CV5D 3UT9C 1P3ID 4KUDD 4JJNC 4CAYB 4Z66A 4WNNB 3LZ0C 4J8XA 1TAFA 1ZLAD 1N1JA 1ID3B 5B24D 1HQ3D 5CP6A 4X23C 1P3BA 3AZKD 5E5AC 5CPIC 3W98A 1P3OC 1P3LB 4H9RA 1HTAA 5CPJA 1M1AD 3WKJD 1WWSA 1P3FB 1ZLAB 5CPKA 5B24B 4KHAA 1P3MA 4AWLC 3C1CD 1AOIB 5GXQB 3AZKB 5AV6A 3AZFA 2CV5C 4WZSB 3REHC 1P3IC 4KUDC 3WKJB 1JFIA 3WA9D 2BYKA 1KX5A 3C1CB 4UUZA 5CHLB 4QLCA 1P34C 4H9QB 5DNMA 3X1UD 3TU4A 1HQ3C 3X1VD 3KSYA 3WA9B 3W99D 5B40A 4KGCA 3X1SD 1P3PA 3B6GA 3X1TA 4R8PA 5BO0A 1M1AC 3WKJC 3B0CT 2AROA 5BS7A 5CP6D 2NZDD 1KX4A 1WWIA 2FJ7D 4YS3D 3C1CC 3MGQC 3X1VB 3X1SB 5GT3B 4ZBJC 5G49B 5GT0A 1U35D 4XUJD 3WA9C 1TZYA 3AYWA 4J8UD 2NZDB 3MNND 5BT1D 4YM6B 2FJ7B 4YS3B 5B0ZD 5B1MD 1KX3D 1F66D 3LJAD 3AZLA 1EQZA 2JSSA 3NQUA 1P3KA 3R45A 3X1UC 3AZIA 1U35B 3W99C 3REKA 3AZGD 3B0CW 4QLCD 4XZQA 4WU8A 1F66B 5B1LD 3REJD 5CP6C 3MGRD 2NZDC 2FJ7C 4YS3C 3AZGB 3REID 2AROD 2NQBB 3WTPB 5B1LB 3AZHB 5AY8A 4XUJC 3REJB 4J8UC 3MGPA 3MNNC 5BT1C 5B2ID 5AVBA 5B1MC 5B0ZC 1KX3C 1F66C 3LJAC 3B0DC 3REIB 3C1BA 2L5AA 3KXBA 5JRGA 3AZMA 3LZ1A 1P3AB 3WAAA 2HIOD 3AZGC 3AZNB 3AN2B 4QLCC 5JA4B 1A7WA 2F8ND 5B2IB 3O62A 3A6ND 5B1LC 4CAYA 3AZJD 3KUYA 5BNXA 4G92C 1P3GB 3KWQD 3MGRC 1Q9CA 4WNNA 5AVCD 2HIOB 5AV8D 3VH6W 3UT9B 2F8NK 1ID3A 1M19D 3RELA 2AROC 3LZ0B 3V9RB 3KWQB 4J8WA 5F99D 1P3LA 4Z2MH 4EO5B 5AV8B 5B2JA 2HUEB 1P3FA 1M19B 4H9SC 2YFWB 5E5AB 3AZED 3MVDD 1AOIA 3B6FD 5GXQA 2HIOC 3W96A 3REHD 3AZLC 4NE5A 3A6NC 3AZJC 4AWLB 5B0YA 1KU5A 3KWQC 4WU9D 5AVCC 3MVDB 3AV2D 1P34D 4EO5C 5AV8C 2CV5B 5GSUD 4H9QA 3REHB 2HUEC 1P3IB 4KUDB 1M19C 3MGSD 5AV5A 4WU9B 5F99C 1P34B 5KDMA 1HQ3B 3MGSB 4ZUXD 3MGQD 5B32D 3UTBA 3AZEC 3MVDC 3B6FC 5B31D 4NE3A 3LELA 5GT3A 1M1AB 3MGQB 5B32B 4WU9C 4YM6A 4H9NA 3AV2C 5B31B 4ZBJB 1S32A 5GSUC 4H9OB 4Z66D 3KUYC 3MGSC 4J8XD 4LD9A 5FUGA 3VH5T 3X1UB 1P3BD 3W98D 3W97A 1BH8A 4Z66B 4ZUXC 5B32C 3W99B 4J8XB 5CPJD 5DNNA 5B31C 1N1JB 5CPKD 1P3MD 2NQBA 5CP6B 3AZHA 5AV6D 3UTAA 3AV1A 4H9RB 3AZFD 5CPJB 3VH5W 2PYOA 5BNVA 5CPKB 1KX5D 4Z66C 1P3MB 4XUJB 4J8UB 4J8XC 1P3AA 3MNNB 1KX3B 5AV9A 5B1MB 5DNMD 5B0ZB 3AZNA 3AN2A 5JA4A 3LJAB 5C3IC 3B0DB 4J8VA 3TU4D 4Z2MG 2BYMA 1JFIB 1P3BC 3W98C 2BYKB 1P3GA 1KX5B 5B40D 5AV5C 5B33A 4KGCD 1P3PD 3B6GD 4UUZB 1BFMA 5CPJC 4QLCB 3X1TD 4G91C 1BH9A 4CSRA 4R8PD 5DNMB 3AFAA 3UT9A 2CWEA 4Z5TA 4JJNA 5CPKC 3NQJA 3VH6T 4G92B 1P3MC 1KX4D 3W97D 3MGRB 3LZ0A 5AV6C 3V9RA 3B6GB 3AZFC 5GT0D 2AROB 1TZYD 3AYWD 1KX5C 4X23A 1KX4B 2YFWA 5E5AA 5CPIA 1M18A 1P3OA 3AZLD 1EQZD 5DNMC 1P3KD 3AZID 3TU4C 3REKD 5B40C 4KGCC 4XZQD 4WU8D 1P3PC 3B6GC 4LD9C 3X1TC 4R8PC 3AZLB 2F8NB 2IO5C 2CV5A 3NQUB 5BS7C 1P3KB 3A6NB 1P3IA 3R45B 4KUDA 3AZJB 1KX4C 3W97C 5AVCB 4NFTA 4XZQB 4WU8B 1R4VA 5GT0C 1ZLAA 5AY8D 5B24A 1TZYC 3AYWC 1HQ3A 3MGPD 3AZKA 3AV1C 5AVBD 5F99B 1EQZC 3C1BD 1P3KC 3KXBD 5JRGD 1M1AA 3AZMD 3AZIC 3LZ1D 3WKJA 4DRAA 3WAAD 1M18D 3REKC 3AZEB 3MGPB 3C1CA 3B6FB 4XZQC 4WU8C 5AVBB 3O62D 3KUYD 3C1BB 3KXBB 4H9OA 3WA9A 3AV2B 1ID3D 3AFAC 2YFVB 5GSUB 3RELD 4Z5TC 3KUYB 5AY8C 5BNXB 3X1UA 3WTPE 3MGPC 4J8WD 1P3LD 3X1VA 4WV4B 2F8NH 3W99A 5AVBC 4DRBA 3X1SA 5B2JD 5G49A 3C1BC 1P3FD 3KXBC 5JRGC 3RELB 3AZMC 3LZ1C 1AOID 5GXQD 3WAAC 4ZUXB 5B32G 1M18C 2FJ7A 3W96D 3VH5A 4YS3A 2NZDA 4H9PB 4J8WB 5B31G 3O62C 4E44A 5B2JB 5B0YD 1U35A 4XUJA 4J8UA 3MNNA 3W96B 1H3OB 2RVQD 1KX3A 5B0ZA 5B1MA 1F66A 3LJAA 1ID3C 3RELC 5AV5D 5B0YB 1TAFB 4J8WC 1P3LC 1B6WA 3AZGA 5B2JC 5C3IB 1ZLAC 4E45A 1P3FC 5B1LA 3WTPA 5B24C 1P3BB 3W98B 3UTBD 5AV5B 3REJA 2LY8A 3MGRA 1AOIC 5GXQC 3AZKC 3W96C
chains in the Genus database with same CATH superfamily
2JCHA 3LELD 4G91B 5GT3D 5KDMB 3REIA 4KHAB 5B0YC 4YM6D 5AV6B 3UTBB 1S32D 2RVQC 3AZFB 5B2IA 3LELB 1PZRA 1ULYA 2XD1A 3VH6A 4LD9D 4H9SA 4M6BA 2HIOA 4H9NB 2BG1A 1W2EA 1S32B 2F8NA 3TU4B 1Z2CB 3A6NA 3AZJA 3UTBC 4NE6A 5B40B 5DNND 3KWQA 1P3PB 5FUGB 3X1VC 5AVCA 4KGCB 4LD9B 3B0BA 3LELC 3X1SC 3X1TB 4R8PB 5BO0B 5GT3C 5AV8A 2IO5B 3IP4C 2NQBD 3WTPD 3AZHD 1M19A 3W97B 3UTAD 1BH8B 3AV1D 4YM6C 5DNNB 5F99A 1S32C 2PYOD 1B67A 5GT0B 1TZYB 3AYWB 1U35C 1P3AD 3UTAB 3AV1B 5AV9D 3AZEA 3MVDA 3AZND 3AN2D 3B6FA 4J8VD 1EQZB 2F8NG 3REHA 3EG5B 3AZIB 2PYOB 4HGAB 5BNVB 1P3GD 5B33D 3REKB 1F1EA 5DNNC 4DQYB 4WU9A 3H0LC 5AV9B 3AFAD 3AV2A 1P34A 3UT9D 4Z5TD 4J8VB 4JJND 2YFVA 5GSUA 2NQBC 2BYMB 3WTPC 3AZHC 3LZ0D 3MGSA 3UTAC 3REJC 5B33B 1BH9B 4CSRB 3AFAB 3REIC 2PYOC 4HGAC 4Z5TB 4JJNB 4X23D 3NQJB 5AY8B 5E5AD 5CPID 2ZY3A 1P3AC 1P3OD 4ZUXA 3MGQA 5B32A 5AV9C 3AZNC 4H9PA 2Y2QA 3AN2C 5B31A 5B2IC 4J8VC 5JRGB 3AZMB 2Y2HA 3LZ1B 1P3GC 3F6TA 4X23B 5B33C 3WAAB 1M18B 5CPIB 1P3OB 1H3OA 3O62B 2CV5D 3UT9C 1P3ID 4KUDD 4JJNC 2Y2NA 3A1KA 4CAYB 4Z66A 4WNNB 3LZ0C 2ZM5A 4J8XA 1TAFA 2Y2LA 1ZLAD 1N1JA 1ID3B 5B24D 1HQ3D 5CP6A 4X23C 1P3BA 2XD5A 5E5AC 5CPIC 3AZKD 3W98A 1P3OC 1P3LB 4H9RA 1HTAA 5CPJA 1M1AD 3WKJD 1WWSA 1P3FB 1ZLAB 5CPKA 5B24B 4KHAA 1P3MA 4AWLC 3C1CD 1AOIB 5GXQB 3AZKB 5AV6A 3AZFA 2CV5C 4WZSB 3REHC 1P3IC 4KUDC 3WKJB 1JFIA 3WA9D 2BYKA 1KX5A 3C1CB 4UUZA 5CHLB 4QLCA 1P34C 4H9QB 5DNMA 3X1UD 3TU4A 1HQ3C 3X1VD 3KSYA 3WA9B 3W99D 5B40A 4KGCA 3X1SD 1P3PA 3B6GA 3X1TA 4R8PA 5BO0A 1M1AC 3WKJC 3B0CT 2AROA 5BS7A 3AL0C 2UWXA 5CP6D 2NZDD 1KX4A 1WWIA 2FJ7D 4YS3D 3C1CC 3MGQC 3H0MC 3X1VB 3X1SB 5GT3B 4ZBJC 5G49B 5GT0A 1U35D 4XUJD 3WA9C 1TZYA 3AYWA 4J8UD 2NZDB 3MNND 2G5IC 5BT1D 4YM6B 2FJ7B 4YS3B 5B0ZD 5B1MD 1KX3D 1F66D 3LJAD 3AZLA 1EQZA 2JSSA 3NQUA 1P3KA 3R45A 3X1UC 3AZIA 1U35B 4UPKA 3KFUG 3W99C 3REKA 3AZGD 3B0CW 4QLCD 4XZQA 4WU8A 1F66B 5B1LD 3REJD 4WJ3C 5CP6C 3MGRD 2NZDC 2FJ7C 4YS3C 3AZGB 3REID 2AROD 2NQBB 3WTPB 5B1LB 3AZHB 5AY8A 4XUJC 3REJB 4J8UC 3MGPA 3MNNC 5BT1C 5B2ID 5AVBA 5B1MC 5B0ZC 1KX3C 1F66C 2ZY2A 3LJAC 3B0DC 3REIB 3C1BA 2L5AA 3KXBA 5JRGA 3AZMA 3LZ1A 1P3AB 3WAAA 2HIOD 3AZGC 3AZNB 3AN2B 4QLCC 5JA4B 1A7WA 2F8ND 5B2IB 3EPLA 3O62A 3A6ND 5B1LC 4CAYA 3AZJD 2DQNC 3KUYA 5BNXA 4G92C 1P3GB 3KWQD 3MGRC 1Q9CA 4WNNA 5AVCD 2HIOB 5AV8D 3VH6W 2Y2OA 3UT9B 2F8NK 1ID3A 1M19D 3RELA 2AROC 3LZ0B 3V9RB 3KWQB 4J8WA 5F99D 1P3LA 4Z2MH 4EO5B 5AV8B 5B2JA 2HUEB 1P3FA 1M19B 4H9SC 2YFWB 5E5AB 3AZED 3MVDD 1AOIA 3B6FD 5GXQA 2HIOC 3W96A 3REHD 3AZLC 4NE5A 3A6NC 2Y2GA 3AZJC 4AWLB 5B0YA 1KU5A 3KWQC 4WU9D 5AVCC 3MVDB 3AV2D 1P34D 2Y2MA 4EO5C 5AV8C 2CV5B 5GSUD 4H9QA 3REHB 2HUEC 1P3IB 4KUDB 2G5HC 1M19C 3MGSD 5AV5A 4WU9B 5F99C 2J8PA 1P34B 5KDMA 1HQ3B 3MGSB 4ZUXD 3MGQD 5B32D 3UTBA 3AZEC 3MVDC 3B6FC 5B31D 4NE3A 3LELA 5GT3A 1M1AB 3MGQB 5B32B 4WU9C 4YM6A 4H9NA 3AV2C 2Y2IA 5B31B 4ZBJB 1S32A 5GSUC 4H9OB 4Z66D 3KUYC 3MGSC 4J8XD 4LD9A 5FUGA 3VH5T 2Y2PA 3X1UB 1P3BD 3W98D 3W97A 1BH8A 4Z66B 4ZUXC 5B32C 3W99B 3FDDA 4J8XB 5CPJD 5DNNA 5B31C 1N1JB 5CPKD 3EPHA 1P3MD 2NQBA 5CP6B 3AZHA 5AV6D 3UTAA 3AV1A 4H9RB 3AZFD 5CPJB 3VH5W 2PYOA 5BNVA 5CPKB 1KX5D 4Z66C 1P3MB 4XUJB 2F2AC 4J8XC 4J8UB 1P3AA 3MNNB 1KX3B 5AV9A 5B1MB 5DNMD 5B0ZB 3AZNA 3AN2A 5JA4A 3LJAB 5C3IC 3B0DB 4J8VA 3TU4D 4Z2MG 2BYMA 1JFIB 1P3BC 3W98C 2BYKB 1P3GA 1KX5B 5B40D 5AV5C 5B33A 4KGCD 1P3PD 3B6GD 4UUZB 1BFMA 5CPJC 4QLCB 3X1TD 4G91C 1BH9A 4CSRA 4R8PD 5DNMB 3AFAA 3UT9A 2CWEA 4Z5TA 4JJNA 5CPKC 3NQJA 3VH6T 2W8SA 4G92B 1P3MC 1KX4D 3W97D 3MGRB 3LZ0A 5AV6C 3V9RA 3B6GB 3AZFC 5GT0D 2AROB 1TZYD 3AYWD 1KX5C 4X23A 2RIQA 1KX4B 2YFWA 5E5AA 5CPIA 1M18A 1P3OA 3AZLD 1EQZD 3H0RC 5DNMC 1P3KD 3AZID 3TU4C 2ZY5A 3REKD 5B40C 4KGCC 4XZQD 4WU8D 1P3PC 3B6GC 4LD9C 3X1TC 4R8PC 3AZLB 2F8NB 2IO5C 2CV5A 3NQUB 5BS7C 1P3KB 3A6NB 1P3IA 3R45B 4KUDA 2ZY4A 3AZJB 1KX4C 3W97C 5AVCB 4NFTA 4XZQB 4WU8B 3EPJA 1R4VA 5GT0C 3EPKA 1ZLAA 5AY8D 5B24A 1TZYC 3AYWC 1HQ3A 3A1IA 3MGPD 3AZKA 3AV1C 5AVBD 5F99B 1EQZC 3C1BD 1P3KC 3KXBD 5JRGD 1M1AA 3AZMD 3AZIC 3LZ1D 2FFFB 3WKJA 4DRAA 3WAAD 1M18D 2JE5A 3REKC 3AZEB 3MGPB 3C1CA 3B6FB 4XZQC 4WU8C 5AVBB 3O62D 3KUYD 3C1BB 3KXBB 4H9OA 3WA9A 3AV2B 2Y2KA 2VQRA 1ID3D 3AFAC 2YFVB 5GSUB 3RELD 4Z5TC 3KUYB 5AY8C 5BNXB 3X1UA 3WTPE 3MGPC 4J8WD 1P3LD 3X1VA 4WV4B 2F8NH 3W99A 5AVBC 4DRBA 3X1SA 5B2JD 5G49A 3C1BC 1P3FD 3KXBC 5JRGC 3RELB 3AZMC 3LZ1C 1AOID 5GXQD 3WAAC 4ZUXB 5B32G 1M18C 2FJ7A 3W96D 3VH5A 4YS3A 2NZDA 4H9PB 4J8WB 5B31G 3O62C 4E44A 5B2JB 2Y2JA 3P5JB 5B0YD 1U35A 4XUJA 4J8UA 3MNNA 3W96B 1H3OB 2RVQD 1KX3A 5B0ZA 5B1MA 2DF4C 1F66A 3LJAA 1ID3C 3RELC 5AV5D 5B0YB 1TAFB 4J8WC 1P3LC 1B6WA 3AZGA 1T3UA 5B2JC 5C3IB 1ZLAC 4E45A 1P3FC 5B1LA 3WTPA 5B24C 1P3BB 3W98B 3UTBD 5AV5B 3REJA 2LY8A 3MGRA 1AOIC 5GXQC 3AZKC 3W96C
chains in the Genus database with same CATH topology
2JCHA 3LELD 4G91B 5GT3D 5KDMB 3REIA 4KHAB 5B0YC 4YM6D 5AV6B 3UTBB 1S32D 2RVQC 3AZFB 5B2IA 3LELB 1PZRA 1ULYA 2XD1A 3VH6A 4LD9D 4H9SA 4M6BA 2HIOA 4H9NB 2BG1A 1W2EA 1S32B 2F8NA 3TU4B 1Z2CB 3A6NA 3AZJA 3UTBC 4NE6A 5B40B 5DNND 3KWQA 1P3PB 5FUGB 3X1VC 5AVCA 4KGCB 4LD9B 3B0BA 3LELC 3X1SC 3X1TB 4R8PB 5BO0B 5GT3C 5AV8A 2IO5B 3IP4C 2NQBD 3WTPD 3AZHD 1M19A 3W97B 3UTAD 1BH8B 3AV1D 4YM6C 5DNNB 5F99A 1S32C 2PYOD 1B67A 5GT0B 1TZYB 3AYWB 1U35C 1P3AD 3UTAB 3AV1B 5AV9D 3AZEA 3MVDA 3AZND 3AN2D 3B6FA 4J8VD 1EQZB 2F8NG 3REHA 3EG5B 3AZIB 2PYOB 4HGAB 5BNVB 1P3GD 5B33D 3REKB 1F1EA 5DNNC 4DQYB 4WU9A 3H0LC 5AV9B 3AFAD 3AV2A 1P34A 3UT9D 4Z5TD 4J8VB 4JJND 2YFVA 5GSUA 2NQBC 2BYMB 3WTPC 3AZHC 3LZ0D 3MGSA 3UTAC 3REJC 5B33B 1BH9B 4CSRB 3AFAB 3REIC 2PYOC 4HGAC 4Z5TB 4JJNB 4X23D 3NQJB 5AY8B 5E5AD 5CPID 2ZY3A 1P3AC 1P3OD 4ZUXA 3MGQA 5B32A 5AV9C 3AZNC 4H9PA 2Y2QA 3AN2C 5B31A 5B2IC 4J8VC 5JRGB 3AZMB 2Y2HA 3LZ1B 1P3GC 3F6TA 4X23B 5B33C 3WAAB 1M18B 5CPIB 1P3OB 1H3OA 3O62B 2CV5D 3UT9C 1P3ID 4KUDD 4JJNC 2Y2NA 3A1KA 4CAYB 4Z66A 4WNNB 3LZ0C 2ZM5A 4J8XA 1TAFA 2Y2LA 1ZLAD 1N1JA 1ID3B 5B24D 1HQ3D 5CP6A 4X23C 1P3BA 2XD5A 5E5AC 5CPIC 3AZKD 3W98A 1P3OC 1P3LB 4H9RA 1HTAA 5CPJA 1M1AD 3WKJD 1WWSA 1P3FB 1ZLAB 5CPKA 5B24B 4KHAA 1P3MA 4AWLC 3C1CD 1AOIB 5GXQB 3AZKB 5AV6A 3AZFA 2CV5C 4WZSB 3REHC 1P3IC 4KUDC 3WKJB 1JFIA 3WA9D 2BYKA 1KX5A 3C1CB 4UUZA 5CHLB 4QLCA 1P34C 4H9QB 5DNMA 3X1UD 3TU4A 1HQ3C 3X1VD 3KSYA 3WA9B 3W99D 5B40A 4KGCA 3X1SD 1P3PA 3B6GA 3X1TA 4R8PA 5BO0A 1M1AC 3WKJC 3B0CT 2AROA 5BS7A 3AL0C 2UWXA 5CP6D 2NZDD 1KX4A 1WWIA 2FJ7D 4YS3D 3C1CC 3MGQC 3H0MC 3X1VB 3X1SB 5GT3B 4ZBJC 5G49B 5GT0A 1U35D 4XUJD 3WA9C 1TZYA 3AYWA 4J8UD 2NZDB 3MNND 2G5IC 5BT1D 4YM6B 2FJ7B 4YS3B 5B0ZD 5B1MD 1KX3D 1F66D 3LJAD 3AZLA 1EQZA 2JSSA 3NQUA 1P3KA 3R45A 3X1UC 3AZIA 1U35B 4UPKA 3KFUG 3W99C 3REKA 3AZGD 3B0CW 4QLCD 4XZQA 4WU8A 1F66B 5B1LD 3REJD 4WJ3C 5CP6C 3MGRD 2NZDC 2FJ7C 4YS3C 3AZGB 3REID 2AROD 2NQBB 3WTPB 5B1LB 3AZHB 5AY8A 4XUJC 3REJB 4J8UC 3MGPA 3MNNC 5BT1C 5B2ID 5AVBA 5B1MC 5B0ZC 1KX3C 1F66C 2ZY2A 3LJAC 3B0DC 3REIB 3C1BA 2L5AA 3KXBA 5JRGA 3AZMA 3LZ1A 1P3AB 3WAAA 2HIOD 3AZGC 3AZNB 3AN2B 4QLCC 5JA4B 1A7WA 2F8ND 5B2IB 3EPLA 3O62A 3A6ND 5B1LC 4CAYA 3AZJD 2DQNC 3KUYA 5BNXA 4G92C 1P3GB 3KWQD 3MGRC 1Q9CA 4WNNA 5AVCD 2HIOB 5AV8D 3VH6W 2Y2OA 3UT9B 2F8NK 1ID3A 1M19D 3RELA 2AROC 3LZ0B 3V9RB 3KWQB 4J8WA 5F99D 1P3LA 4Z2MH 4EO5B 5AV8B 5B2JA 2HUEB 1P3FA 1M19B 4H9SC 2YFWB 5E5AB 3AZED 3MVDD 1AOIA 3B6FD 5GXQA 2HIOC 3W96A 3REHD 3AZLC 4NE5A 3A6NC 2Y2GA 3AZJC 4AWLB 5B0YA 1KU5A 3KWQC 4WU9D 5AVCC 3MVDB 3AV2D 1P34D 2Y2MA 4EO5C 5AV8C 2CV5B 5GSUD 4H9QA 3REHB 2HUEC 1P3IB 4KUDB 2G5HC 1M19C 3MGSD 5AV5A 4WU9B 5F99C 2J8PA 1P34B 5KDMA 1HQ3B 3MGSB 4ZUXD 3MGQD 5B32D 3UTBA 3AZEC 3MVDC 3B6FC 5B31D 4NE3A 3LELA 5GT3A 1M1AB 3MGQB 5B32B 4WU9C 4YM6A 4H9NA 3AV2C 2Y2IA 5B31B 4ZBJB 1S32A 5GSUC 4H9OB 4Z66D 3KUYC 3MGSC 4J8XD 4LD9A 5FUGA 3VH5T 2Y2PA 3X1UB 1P3BD 3W98D 3W97A 1BH8A 4Z66B 4ZUXC 5B32C 3W99B 3FDDA 4J8XB 5CPJD 5DNNA 5B31C 1N1JB 5CPKD 3EPHA 1P3MD 2NQBA 5CP6B 3AZHA 5AV6D 3UTAA 3AV1A 4H9RB 3AZFD 5CPJB 3VH5W 2PYOA 5BNVA 5CPKB 1KX5D 4Z66C 1P3MB 4XUJB 2F2AC 4J8XC 4J8UB 1P3AA 3MNNB 1KX3B 5AV9A 5B1MB 5DNMD 5B0ZB 3AZNA 3AN2A 5JA4A 3LJAB 5C3IC 3B0DB 4J8VA 3TU4D 4Z2MG 2BYMA 1JFIB 1P3BC 3W98C 2BYKB 1P3GA 1KX5B 5B40D 5AV5C 5B33A 4KGCD 1P3PD 3B6GD 4UUZB 1BFMA 5CPJC 4QLCB 3X1TD 4G91C 1BH9A 4CSRA 4R8PD 5DNMB 3AFAA 3UT9A 2CWEA 4Z5TA 4JJNA 5CPKC 3NQJA 3VH6T 2W8SA 4G92B 1P3MC 1KX4D 3W97D 3MGRB 3LZ0A 5AV6C 3V9RA 3B6GB 3AZFC 5GT0D 2AROB 1TZYD 3AYWD 1KX5C 4X23A 2RIQA 1KX4B 2YFWA 5E5AA 5CPIA 1M18A 1P3OA 3AZLD 1EQZD 3H0RC 5DNMC 1P3KD 3AZID 3TU4C 2ZY5A 3REKD 5B40C 4KGCC 4XZQD 4WU8D 1P3PC 3B6GC 4LD9C 3X1TC 4R8PC 3AZLB 2F8NB 2IO5C 2CV5A 3NQUB 5BS7C 1P3KB 3A6NB 1P3IA 3R45B 4KUDA 2ZY4A 3AZJB 1KX4C 3W97C 5AVCB 4NFTA 4XZQB 4WU8B 3EPJA 1R4VA 5GT0C 3EPKA 1ZLAA 5AY8D 5B24A 1TZYC 3AYWC 1HQ3A 3A1IA 3MGPD 3AZKA 3AV1C 5AVBD 5F99B 1EQZC 3C1BD 1P3KC 3KXBD 5JRGD 1M1AA 3AZMD 3AZIC 3LZ1D 2FFFB 3WKJA 4DRAA 3WAAD 1M18D 2JE5A 3REKC 3AZEB 3MGPB 3C1CA 3B6FB 4XZQC 4WU8C 5AVBB 3O62D 3KUYD 3C1BB 3KXBB 4H9OA 3WA9A 3AV2B 2Y2KA 2VQRA 1ID3D 3AFAC 2YFVB 5GSUB 3RELD 4Z5TC 3KUYB 5AY8C 5BNXB 3X1UA 3WTPE 3MGPC 4J8WD 1P3LD 3X1VA 4WV4B 2F8NH 3W99A 5AVBC 4DRBA 3X1SA 5B2JD 5G49A 3C1BC 1P3FD 3KXBC 5JRGC 3RELB 3AZMC 3LZ1C 1AOID 5GXQD 3WAAC 4ZUXB 5B32G 1M18C 2FJ7A 3W96D 3VH5A 4YS3A 2NZDA 4H9PB 4J8WB 5B31G 3O62C 4E44A 5B2JB 2Y2JA 3P5JB 5B0YD 1U35A 4XUJA 4J8UA 3MNNA 3W96B 1H3OB 2RVQD 1KX3A 5B0ZA 5B1MA 2DF4C 1F66A 3LJAA 1ID3C 3RELC 5AV5D 5B0YB 1TAFB 4J8WC 1P3LC 1B6WA 3AZGA 1T3UA 5B2JC 5C3IB 1ZLAC 4E45A 1P3FC 5B1LA 3WTPA 5B24C 1P3BB 3W98B 3UTBD 5AV5B 3REJA 2LY8A 3MGRA 1AOIC 5GXQC 3AZKC 3W96C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL D;  4G91 B;  5GT3 D;  5KDM B;  3REI A;  4KHA B;  5B0Y C;  4YM6 D;  5AV6 B;  3UTB B;  1S32 D;  2RVQ C;  3AZF B;  5B2I A;  3LEL B;  1ULY A;  3VH6 A;  4LD9 D;  4H9S A;  4M6B A;  2HIO A;  4H9N B;  1S32 B;  2F8N A;  3TU4 B;  3A6N A;  3AZJ A;  3UTB C;  4NE6 A;  5B40 B;  5DNN D;  3KWQ A;  1P3P B;  5FUG B;  3X1V C;  5AVC A;  4KGC B;  4LD9 B;  3B0B A;  3LEL C;  3X1S C;  3X1T B;  4R8P B;  5BO0 B;  5GT3 C;  5AV8 A;  2IO5 B;  2NQB D;  3WTP D;  3AZH D;  1M19 A;  3W97 B;  3UTA D;  1BH8 B;  3AV1 D;  4YM6 C;  5DNN B;  5F99 A;  1S32 C;  2PYO D;  1B67 A;  5GT0 B;  1TZY B;  3AYW B;  1U35 C;  1P3A D;  3UTA B;  3AV1 B;  5AV9 D;  3AZE A;  3MVD A;  3AZN D;  3AN2 D;  3B6F A;  4J8V D;  1EQZ B;  2F8N G;  3REH A;  3AZI B;  2PYO B;  4HGA B;  5BNV B;  1P3G D;  5B33 D;  3REK B;  1F1E A;  5DNN C;  4WU9 A;  5AV9 B;  3AFA D;  3AV2 A;  1P34 A;  3UT9 D;  4Z5T D;  4J8V B;  4JJN D;  2YFV A;  5GSU A;  2NQB C;  2BYM B;  3WTP C;  3AZH C;  3LZ0 D;  3MGS A;  3UTA C;  3REJ C;  5B33 B;  1BH9 B;  4CSR B;  3AFA B;  3REI C;  2PYO C;  4HGA C;  4Z5T B;  4JJN B;  4X23 D;  3NQJ B;  5AY8 B;  5E5A D;  5CPI D;  1P3A C;  1P3O D;  4ZUX A;  3MGQ A;  5B32 A;  5AV9 C;  3AZN C;  4H9P A;  3AN2 C;  5B31 A;  5B2I C;  4J8V C;  5JRG B;  3AZM B;  3LZ1 B;  1P3G C;  4X23 B;  5B33 C;  3WAA B;  1M18 B;  5CPI B;  1P3O B;  1H3O A;  3O62 B;  2CV5 D;  3UT9 C;  1P3I D;  4KUD D;  4JJN C;  4CAY B;  4Z66 A;  4WNN B;  3LZ0 C;  4J8X A;  1TAF A;  1ZLA D;  1N1J A;  1ID3 B;  5B24 D;  1HQ3 D;  5CP6 A;  4X23 C;  1P3B A;  3AZK D;  5E5A C;  5CPI C;  3W98 A;  1P3O C;  1P3L B;  4H9R A;  1HTA A;  5CPJ A;  1M1A D;  3WKJ D;  1WWS A;  1P3F B;  1ZLA B;  5CPK A;  5B24 B;  4KHA A;  1P3M A;  4AWL C;  3C1C D;  1AOI B;  5GXQ B;  3AZK B;  5AV6 A;  3AZF A;  2CV5 C;  4WZS B;  3REH C;  1P3I C;  4KUD C;  3WKJ B;  1JFI A;  3WA9 D;  2BYK A;  1KX5 A;  3C1C B;  4UUZ A;  5CHL B;  4QLC A;  1P34 C;  4H9Q B;  5DNM A;  3X1U D;  3TU4 A;  1HQ3 C;  3X1V D;  3KSY A;  3WA9 B;  3W99 D;  5B40 A;  4KGC A;  3X1S D;  1P3P A;  3B6G A;  3X1T A;  4R8P A;  5BO0 A;  1M1A C;  3WKJ C;  3B0C T;  2ARO A;  5BS7 A;  5CP6 D;  2NZD D;  1KX4 A;  1WWI A;  2FJ7 D;  4YS3 D;  3C1C C;  3MGQ C;  3X1V B;  3X1S B;  5GT3 B;  4ZBJ C;  5G49 B;  5GT0 A;  1U35 D;  4XUJ D;  3WA9 C;  1TZY A;  3AYW A;  4J8U D;  2NZD B;  3MNN D;  5BT1 D;  4YM6 B;  2FJ7 B;  4YS3 B;  5B0Z D;  5B1M D;  1KX3 D;  1F66 D;  3LJA D;  3AZL A;  1EQZ A;  2JSS A;  3NQU A;  1P3K A;  3R45 A;  3X1U C;  3AZI A;  1U35 B;  3W99 C;  3REK A;  3AZG D;  3B0C W;  4QLC D;  4XZQ A;  4WU8 A;  1F66 B;  5B1L D;  3REJ D;  5CP6 C;  3MGR D;  2NZD C;  2FJ7 C;  4YS3 C;  3AZG B;  3REI D;  2ARO D;  2NQB B;  3WTP B;  5B1L B;  3AZH B;  5AY8 A;  4XUJ C;  3REJ B;  4J8U C;  3MGP A;  3MNN C;  5BT1 C;  5B2I D;  5AVB A;  5B1M C;  5B0Z C;  1KX3 C;  1F66 C;  3LJA C;  3B0D C;  3REI B;  3C1B A;  2L5A A;  3KXB A;  5JRG A;  3AZM A;  3LZ1 A;  1P3A B;  3WAA A;  2HIO D;  3AZG C;  3AZN B;  3AN2 B;  4QLC C;  5JA4 B;  1A7W A;  2F8N D;  5B2I B;  3O62 A;  3A6N D;  5B1L C;  4CAY A;  3AZJ D;  3KUY A;  5BNX A;  4G92 C;  1P3G B;  3KWQ D;  3MGR C;  1Q9C A;  4WNN A;  5AVC D;  2HIO B;  5AV8 D;  3VH6 W;  3UT9 B;  2F8N K;  1ID3 A;  1M19 D;  3REL A;  2ARO C;  3LZ0 B;  3V9R B;  3KWQ B;  4J8W A;  5F99 D;  1P3L A;  4Z2M H;  4EO5 B;  5AV8 B;  5B2J A;  2HUE B;  1P3F A;  1M19 B;  4H9S C;  2YFW B;  5E5A B;  3AZE D;  3MVD D;  1AOI A;  3B6F D;  5GXQ A;  2HIO C;  3W96 A;  3REH D;  3AZL C;  4NE5 A;  3A6N C;  3AZJ C;  4AWL B;  5B0Y A;  1KU5 A;  3KWQ C;  4WU9 D;  5AVC C;  3MVD B;  3AV2 D;  1P34 D;  4EO5 C;  5AV8 C;  2CV5 B;  5GSU D;  4H9Q A;  3REH B;  2HUE C;  1P3I B;  4KUD B;  1M19 C;  3MGS D;  5AV5 A;  4WU9 B;  5F99 C;  1P34 B;  5KDM A;  1HQ3 B;  3MGS B;  4ZUX D;  3MGQ D;  5B32 D;  3UTB A;  3AZE C;  3MVD C;  3B6F C;  5B31 D;  4NE3 A;  3LEL A;  5GT3 A;  1M1A B;  3MGQ B;  5B32 B;  4WU9 C;  4YM6 A;  4H9N A;  3AV2 C;  5B31 B;  4ZBJ B;  1S32 A;  5GSU C;  4H9O B;  4Z66 D;  3KUY C;  3MGS C;  4J8X D;  4LD9 A;  5FUG A;  3VH5 T;  3X1U B;  1P3B D;  3W98 D;  3W97 A;  1BH8 A;  4Z66 B;  4ZUX C;  5B32 C;  3W99 B;  4J8X B;  5CPJ D;  5DNN A;  5B31 C;  1N1J B;  5CPK D;  1P3M D;  2NQB A;  5CP6 B;  3AZH A;  5AV6 D;  3UTA A;  3AV1 A;  4H9R B;  3AZF D;  5CPJ B;  3VH5 W;  2PYO A;  5BNV A;  5CPK B;  1KX5 D;  4Z66 C;  1P3M B;  4XUJ B;  4J8U B;  4J8X C;  1P3A A;  3MNN B;  1KX3 B;  5AV9 A;  5B1M B;  5DNM D;  5B0Z B;  3AZN A;  3AN2 A;  5JA4 A;  3LJA B;  5C3I C;  3B0D B;  4J8V A;  3TU4 D;  4Z2M G;  2BYM A;  1JFI B;  1P3B C;  3W98 C;  2BYK B;  1P3G A;  1KX5 B;  5B40 D;  5AV5 C;  5B33 A;  4KGC D;  1P3P D;  3B6G D;  4UUZ B;  1BFM A;  5CPJ C;  4QLC B;  3X1T D;  4G91 C;  1BH9 A;  4CSR A;  4R8P D;  5DNM B;  3AFA A;  3UT9 A;  2CWE A;  4Z5T A;  4JJN A;  5CPK C;  3NQJ A;  3VH6 T;  4G92 B;  1P3M C;  1KX4 D;  3W97 D;  3MGR B;  3LZ0 A;  5AV6 C;  3V9R A;  3B6G B;  3AZF C;  5GT0 D;  2ARO B;  1TZY D;  3AYW D;  1KX5 C;  4X23 A;  1KX4 B;  2YFW A;  5E5A A;  5CPI A;  1M18 A;  1P3O A;  3AZL D;  1EQZ D;  5DNM C;  1P3K D;  3AZI D;  3TU4 C;  3REK D;  5B40 C;  4KGC C;  4XZQ D;  4WU8 D;  1P3P C;  3B6G C;  4LD9 C;  3X1T C;  4R8P C;  3AZL B;  2F8N B;  2IO5 C;  2CV5 A;  3NQU B;  5BS7 C;  1P3K B;  3A6N B;  1P3I A;  3R45 B;  4KUD A;  3AZJ B;  1KX4 C;  3W97 C;  5AVC B;  4NFT A;  4XZQ B;  4WU8 B;  1R4V A;  5GT0 C;  1ZLA A;  5AY8 D;  5B24 A;  1TZY C;  3AYW C;  1HQ3 A;  3MGP D;  3AZK A;  3AV1 C;  5AVB D;  5F99 B;  1EQZ C;  3C1B D;  1P3K C;  3KXB D;  5JRG D;  1M1A A;  3AZM D;  3AZI C;  3LZ1 D;  3WKJ A;  4DRA A;  3WAA D;  1M18 D;  3REK C;  3AZE B;  3MGP B;  3C1C A;  3B6F B;  4XZQ C;  4WU8 C;  5AVB B;  3O62 D;  3KUY D;  3C1B B;  3KXB B;  4H9O A;  3WA9 A;  3AV2 B;  1ID3 D;  3AFA C;  2YFV B;  5GSU B;  3REL D;  4Z5T C;  3KUY B;  5AY8 C;  5BNX B;  3X1U A;  3WTP E;  3MGP C;  4J8W D;  1P3L D;  3X1V A;  4WV4 B;  2F8N H;  3W99 A;  5AVB C;  4DRB A;  3X1S A;  5B2J D;  5G49 A;  3C1B C;  1P3F D;  3KXB C;  5JRG C;  3REL B;  3AZM C;  3LZ1 C;  1AOI D;  5GXQ D;  3WAA C;  4ZUX B;  5B32 G;  1M18 C;  2FJ7 A;  3W96 D;  3VH5 A;  4YS3 A;  2NZD A;  4H9P B;  4J8W B;  5B31 G;  3O62 C;  4E44 A;  5B2J B;  5B0Y D;  1U35 A;  4XUJ A;  4J8U A;  3MNN A;  3W96 B;  1H3O B;  2RVQ D;  1KX3 A;  5B0Z A;  5B1M A;  1F66 A;  3LJA A;  1ID3 C;  3REL C;  5AV5 D;  5B0Y B;  1TAF B;  4J8W C;  1P3L C;  1B6W A;  3AZG A;  5B2J C;  5C3I B;  1ZLA C;  4E45 A;  1P3F C;  5B1L A;  3WTP A;  5B24 C;  1P3B B;  3W98 B;  3UTB D;  5AV5 B;  3REJ A;  2LY8 A;  3MGR A;  1AOI C;  5GXQ C;  3AZK C;  3W96 C; 
#chains in the Genus database with same CATH topology
 2JCH A;  3LEL D;  4G91 B;  5GT3 D;  5KDM B;  3REI A;  4KHA B;  5B0Y C;  4YM6 D;  5AV6 B;  3UTB B;  1S32 D;  2RVQ C;  3AZF B;  5B2I A;  3LEL B;  1PZR A;  1ULY A;  2XD1 A;  3VH6 A;  4LD9 D;  4H9S A;  4M6B A;  2HIO A;  4H9N B;  2BG1 A;  1W2E A;  1S32 B;  2F8N A;  3TU4 B;  1Z2C B;  3A6N A;  3AZJ A;  3UTB C;  4NE6 A;  5B40 B;  5DNN D;  3KWQ A;  1P3P B;  5FUG B;  3X1V C;  5AVC A;  4KGC B;  4LD9 B;  3B0B A;  3LEL C;  3X1S C;  3X1T B;  4R8P B;  5BO0 B;  5GT3 C;  5AV8 A;  2IO5 B;  3IP4 C;  2NQB D;  3WTP D;  3AZH D;  1M19 A;  3W97 B;  3UTA D;  1BH8 B;  3AV1 D;  4YM6 C;  5DNN B;  5F99 A;  1S32 C;  2PYO D;  1B67 A;  5GT0 B;  1TZY B;  3AYW B;  1U35 C;  1P3A D;  3UTA B;  3AV1 B;  5AV9 D;  3AZE A;  3MVD A;  3AZN D;  3AN2 D;  3B6F A;  4J8V D;  1EQZ B;  2F8N G;  3REH A;  3EG5 B;  3AZI B;  2PYO B;  4HGA B;  5BNV B;  1P3G D;  5B33 D;  3REK B;  1F1E A;  5DNN C;  4DQY B;  4WU9 A;  3H0L C;  5AV9 B;  3AFA D;  3AV2 A;  1P34 A;  3UT9 D;  4Z5T D;  4J8V B;  4JJN D;  2YFV A;  5GSU A;  2NQB C;  2BYM B;  3WTP C;  3AZH C;  3LZ0 D;  3MGS A;  3UTA C;  3REJ C;  5B33 B;  1BH9 B;  4CSR B;  3AFA B;  3REI C;  2PYO C;  4HGA C;  4Z5T B;  4JJN B;  4X23 D;  3NQJ B;  5AY8 B;  5E5A D;  5CPI D;  2ZY3 A;  1P3A C;  1P3O D;  4ZUX A;  3MGQ A;  5B32 A;  5AV9 C;  3AZN C;  4H9P A;  2Y2Q A;  3AN2 C;  5B31 A;  5B2I C;  4J8V C;  5JRG B;  3AZM B;  2Y2H A;  3LZ1 B;  1P3G C;  3F6T A;  4X23 B;  5B33 C;  3WAA B;  1M18 B;  5CPI B;  1P3O B;  1H3O A;  3O62 B;  2CV5 D;  3UT9 C;  1P3I D;  4KUD D;  4JJN C;  2Y2N A;  3A1K A;  4CAY B;  4Z66 A;  4WNN B;  3LZ0 C;  2ZM5 A;  4J8X A;  1TAF A;  2Y2L A;  1ZLA D;  1N1J A;  1ID3 B;  5B24 D;  1HQ3 D;  5CP6 A;  4X23 C;  1P3B A;  2XD5 A;  5E5A C;  5CPI C;  3AZK D;  3W98 A;  1P3O C;  1P3L B;  4H9R A;  1HTA A;  5CPJ A;  1M1A D;  3WKJ D;  1WWS A;  1P3F B;  1ZLA B;  5CPK A;  5B24 B;  4KHA A;  1P3M A;  4AWL C;  3C1C D;  1AOI B;  5GXQ B;  3AZK B;  5AV6 A;  3AZF A;  2CV5 C;  4WZS B;  3REH C;  1P3I C;  4KUD C;  3WKJ B;  1JFI A;  3WA9 D;  2BYK A;  1KX5 A;  3C1C B;  4UUZ A;  5CHL B;  4QLC A;  1P34 C;  4H9Q B;  5DNM A;  3X1U D;  3TU4 A;  1HQ3 C;  3X1V D;  3KSY A;  3WA9 B;  3W99 D;  5B40 A;  4KGC A;  3X1S D;  1P3P A;  3B6G A;  3X1T A;  4R8P A;  5BO0 A;  1M1A C;  3WKJ C;  3B0C T;  2ARO A;  5BS7 A;  3AL0 C;  2UWX A;  5CP6 D;  2NZD D;  1KX4 A;  1WWI A;  2FJ7 D;  4YS3 D;  3C1C C;  3MGQ C;  3H0M C;  3X1V B;  3X1S B;  5GT3 B;  4ZBJ C;  5G49 B;  5GT0 A;  1U35 D;  4XUJ D;  3WA9 C;  1TZY A;  3AYW A;  4J8U D;  2NZD B;  3MNN D;  2G5I C;  5BT1 D;  4YM6 B;  2FJ7 B;  4YS3 B;  5B0Z D;  5B1M D;  1KX3 D;  1F66 D;  3LJA D;  3AZL A;  1EQZ A;  2JSS A;  3NQU A;  1P3K A;  3R45 A;  3X1U C;  3AZI A;  1U35 B;  4UPK A;  3KFU G;  3W99 C;  3REK A;  3AZG D;  3B0C W;  4QLC D;  4XZQ A;  4WU8 A;  1F66 B;  5B1L D;  3REJ D;  4WJ3 C;  5CP6 C;  3MGR D;  2NZD C;  2FJ7 C;  4YS3 C;  3AZG B;  3REI D;  2ARO D;  2NQB B;  3WTP B;  5B1L B;  3AZH B;  5AY8 A;  4XUJ C;  3REJ B;  4J8U C;  3MGP A;  3MNN C;  5BT1 C;  5B2I D;  5AVB A;  5B1M C;  5B0Z C;  1KX3 C;  1F66 C;  2ZY2 A;  3LJA C;  3B0D C;  3REI B;  3C1B A;  2L5A A;  3KXB A;  5JRG A;  3AZM A;  3LZ1 A;  1P3A B;  3WAA A;  2HIO D;  3AZG C;  3AZN B;  3AN2 B;  4QLC C;  5JA4 B;  1A7W A;  2F8N D;  5B2I B;  3EPL A;  3O62 A;  3A6N D;  5B1L C;  4CAY A;  3AZJ D;  2DQN C;  3KUY A;  5BNX A;  4G92 C;  1P3G B;  3KWQ D;  3MGR C;  1Q9C A;  4WNN A;  5AVC D;  2HIO B;  5AV8 D;  3VH6 W;  2Y2O A;  3UT9 B;  2F8N K;  1ID3 A;  1M19 D;  3REL A;  2ARO C;  3LZ0 B;  3V9R B;  3KWQ B;  4J8W A;  5F99 D;  1P3L A;  4Z2M H;  4EO5 B;  5AV8 B;  5B2J A;  2HUE B;  1P3F A;  1M19 B;  4H9S C;  2YFW B;  5E5A B;  3AZE D;  3MVD D;  1AOI A;  3B6F D;  5GXQ A;  2HIO C;  3W96 A;  3REH D;  3AZL C;  4NE5 A;  3A6N C;  2Y2G A;  3AZJ C;  4AWL B;  5B0Y A;  1KU5 A;  3KWQ C;  4WU9 D;  5AVC C;  3MVD B;  3AV2 D;  1P34 D;  2Y2M A;  4EO5 C;  5AV8 C;  2CV5 B;  5GSU D;  4H9Q A;  3REH B;  2HUE C;  1P3I B;  4KUD B;  2G5H C;  1M19 C;  3MGS D;  5AV5 A;  4WU9 B;  5F99 C;  2J8P A;  1P34 B;  5KDM A;  1HQ3 B;  3MGS B;  4ZUX D;  3MGQ D;  5B32 D;  3UTB A;  3AZE C;  3MVD C;  3B6F C;  5B31 D;  4NE3 A;  3LEL A;  5GT3 A;  1M1A B;  3MGQ B;  5B32 B;  4WU9 C;  4YM6 A;  4H9N A;  3AV2 C;  2Y2I A;  5B31 B;  4ZBJ B;  1S32 A;  5GSU C;  4H9O B;  4Z66 D;  3KUY C;  3MGS C;  4J8X D;  4LD9 A;  5FUG A;  3VH5 T;  2Y2P A;  3X1U B;  1P3B D;  3W98 D;  3W97 A;  1BH8 A;  4Z66 B;  4ZUX C;  5B32 C;  3W99 B;  3FDD A;  4J8X B;  5CPJ D;  5DNN A;  5B31 C;  1N1J B;  5CPK D;  3EPH A;  1P3M D;  2NQB A;  5CP6 B;  3AZH A;  5AV6 D;  3UTA A;  3AV1 A;  4H9R B;  3AZF D;  5CPJ B;  3VH5 W;  2PYO A;  5BNV A;  5CPK B;  1KX5 D;  4Z66 C;  1P3M B;  4XUJ B;  2F2A C;  4J8X C;  4J8U B;  1P3A A;  3MNN B;  1KX3 B;  5AV9 A;  5B1M B;  5DNM D;  5B0Z B;  3AZN A;  3AN2 A;  5JA4 A;  3LJA B;  5C3I C;  3B0D B;  4J8V A;  3TU4 D;  4Z2M G;  2BYM A;  1JFI B;  1P3B C;  3W98 C;  2BYK B;  1P3G A;  1KX5 B;  5B40 D;  5AV5 C;  5B33 A;  4KGC D;  1P3P D;  3B6G D;  4UUZ B;  1BFM A;  5CPJ C;  4QLC B;  3X1T D;  4G91 C;  1BH9 A;  4CSR A;  4R8P D;  5DNM B;  3AFA A;  3UT9 A;  2CWE A;  4Z5T A;  4JJN A;  5CPK C;  3NQJ A;  3VH6 T;  2W8S A;  4G92 B;  1P3M C;  1KX4 D;  3W97 D;  3MGR B;  3LZ0 A;  5AV6 C;  3V9R A;  3B6G B;  3AZF C;  5GT0 D;  2ARO B;  1TZY D;  3AYW D;  1KX5 C;  4X23 A;  2RIQ A;  1KX4 B;  2YFW A;  5E5A A;  5CPI A;  1M18 A;  1P3O A;  3AZL D;  1EQZ D;  3H0R C;  5DNM C;  1P3K D;  3AZI D;  3TU4 C;  2ZY5 A;  3REK D;  5B40 C;  4KGC C;  4XZQ D;  4WU8 D;  1P3P C;  3B6G C;  4LD9 C;  3X1T C;  4R8P C;  3AZL B;  2F8N B;  2IO5 C;  2CV5 A;  3NQU B;  5BS7 C;  1P3K B;  3A6N B;  1P3I A;  3R45 B;  4KUD A;  2ZY4 A;  3AZJ B;  1KX4 C;  3W97 C;  5AVC B;  4NFT A;  4XZQ B;  4WU8 B;  3EPJ A;  1R4V A;  5GT0 C;  3EPK A;  1ZLA A;  5AY8 D;  5B24 A;  1TZY C;  3AYW C;  1HQ3 A;  3A1I A;  3MGP D;  3AZK A;  3AV1 C;  5AVB D;  5F99 B;  1EQZ C;  3C1B D;  1P3K C;  3KXB D;  5JRG D;  1M1A A;  3AZM D;  3AZI C;  3LZ1 D;  2FFF B;  3WKJ A;  4DRA A;  3WAA D;  1M18 D;  2JE5 A;  3REK C;  3AZE B;  3MGP B;  3C1C A;  3B6F B;  4XZQ C;  4WU8 C;  5AVB B;  3O62 D;  3KUY D;  3C1B B;  3KXB B;  4H9O A;  3WA9 A;  3AV2 B;  2Y2K A;  2VQR A;  1ID3 D;  3AFA C;  2YFV B;  5GSU B;  3REL D;  4Z5T C;  3KUY B;  5AY8 C;  5BNX B;  3X1U A;  3WTP E;  3MGP C;  4J8W D;  1P3L D;  3X1V A;  4WV4 B;  2F8N H;  3W99 A;  5AVB C;  4DRB A;  3X1S A;  5B2J D;  5G49 A;  3C1B C;  1P3F D;  3KXB C;  5JRG C;  3REL B;  3AZM C;  3LZ1 C;  1AOI D;  5GXQ D;  3WAA C;  4ZUX B;  5B32 G;  1M18 C;  2FJ7 A;  3W96 D;  3VH5 A;  4YS3 A;  2NZD A;  4H9P B;  4J8W B;  5B31 G;  3O62 C;  4E44 A;  5B2J B;  2Y2J A;  3P5J B;  5B0Y D;  1U35 A;  4XUJ A;  4J8U A;  3MNN A;  3W96 B;  1H3O B;  2RVQ D;  1KX3 A;  5B0Z A;  5B1M A;  2DF4 C;  1F66 A;  3LJA A;  1ID3 C;  3REL C;  5AV5 D;  5B0Y B;  1TAF B;  4J8W C;  1P3L C;  1B6W A;  3AZG A;  1T3U A;  5B2J C;  5C3I B;  1ZLA C;  4E45 A;  1P3F C;  5B1L A;  3WTP A;  5B24 C;  1P3B B;  3W98 B;  3UTB D;  5AV5 B;  3REJ A;  2LY8 A;  3MGR A;  1AOI C;  5GXQ C;  3AZK C;  3W96 C; 
#chains in the Genus database with same CATH homology
 2JCH A;  3LEL D;  4G91 B;  5GT3 D;  5KDM B;  3REI A;  4KHA B;  5B0Y C;  4YM6 D;  5AV6 B;  3UTB B;  1S32 D;  2RVQ C;  3AZF B;  5B2I A;  3LEL B;  1PZR A;  1ULY A;  2XD1 A;  3VH6 A;  4LD9 D;  4H9S A;  4M6B A;  2HIO A;  4H9N B;  2BG1 A;  1W2E A;  1S32 B;  2F8N A;  3TU4 B;  1Z2C B;  3A6N A;  3AZJ A;  3UTB C;  4NE6 A;  5B40 B;  5DNN D;  3KWQ A;  1P3P B;  5FUG B;  3X1V C;  5AVC A;  4KGC B;  4LD9 B;  3B0B A;  3LEL C;  3X1S C;  3X1T B;  4R8P B;  5BO0 B;  5GT3 C;  5AV8 A;  2IO5 B;  3IP4 C;  2NQB D;  3WTP D;  3AZH D;  1M19 A;  3W97 B;  3UTA D;  1BH8 B;  3AV1 D;  4YM6 C;  5DNN B;  5F99 A;  1S32 C;  2PYO D;  1B67 A;  5GT0 B;  1TZY B;  3AYW B;  1U35 C;  1P3A D;  3UTA B;  3AV1 B;  5AV9 D;  3AZE A;  3MVD A;  3AZN D;  3AN2 D;  3B6F A;  4J8V D;  1EQZ B;  2F8N G;  3REH A;  3EG5 B;  3AZI B;  2PYO B;  4HGA B;  5BNV B;  1P3G D;  5B33 D;  3REK B;  1F1E A;  5DNN C;  4DQY B;  4WU9 A;  3H0L C;  5AV9 B;  3AFA D;  3AV2 A;  1P34 A;  3UT9 D;  4Z5T D;  4J8V B;  4JJN D;  2YFV A;  5GSU A;  2NQB C;  2BYM B;  3WTP C;  3AZH C;  3LZ0 D;  3MGS A;  3UTA C;  3REJ C;  5B33 B;  1BH9 B;  4CSR B;  3AFA B;  3REI C;  2PYO C;  4HGA C;  4Z5T B;  4JJN B;  4X23 D;  3NQJ B;  5AY8 B;  5E5A D;  5CPI D;  2ZY3 A;  1P3A C;  1P3O D;  4ZUX A;  3MGQ A;  5B32 A;  5AV9 C;  3AZN C;  4H9P A;  2Y2Q A;  3AN2 C;  5B31 A;  5B2I C;  4J8V C;  5JRG B;  3AZM B;  2Y2H A;  3LZ1 B;  1P3G C;  3F6T A;  4X23 B;  5B33 C;  3WAA B;  1M18 B;  5CPI B;  1P3O B;  1H3O A;  3O62 B;  2CV5 D;  3UT9 C;  1P3I D;  4KUD D;  4JJN C;  2Y2N A;  3A1K A;  4CAY B;  4Z66 A;  4WNN B;  3LZ0 C;  2ZM5 A;  4J8X A;  1TAF A;  2Y2L A;  1ZLA D;  1N1J A;  1ID3 B;  5B24 D;  1HQ3 D;  5CP6 A;  4X23 C;  1P3B A;  2XD5 A;  5E5A C;  5CPI C;  3AZK D;  3W98 A;  1P3O C;  1P3L B;  4H9R A;  1HTA A;  5CPJ A;  1M1A D;  3WKJ D;  1WWS A;  1P3F B;  1ZLA B;  5CPK A;  5B24 B;  4KHA A;  1P3M A;  4AWL C;  3C1C D;  1AOI B;  5GXQ B;  3AZK B;  5AV6 A;  3AZF A;  2CV5 C;  4WZS B;  3REH C;  1P3I C;  4KUD C;  3WKJ B;  1JFI A;  3WA9 D;  2BYK A;  1KX5 A;  3C1C B;  4UUZ A;  5CHL B;  4QLC A;  1P34 C;  4H9Q B;  5DNM A;  3X1U D;  3TU4 A;  1HQ3 C;  3X1V D;  3KSY A;  3WA9 B;  3W99 D;  5B40 A;  4KGC A;  3X1S D;  1P3P A;  3B6G A;  3X1T A;  4R8P A;  5BO0 A;  1M1A C;  3WKJ C;  3B0C T;  2ARO A;  5BS7 A;  3AL0 C;  2UWX A;  5CP6 D;  2NZD D;  1KX4 A;  1WWI A;  2FJ7 D;  4YS3 D;  3C1C C;  3MGQ C;  3H0M C;  3X1V B;  3X1S B;  5GT3 B;  4ZBJ C;  5G49 B;  5GT0 A;  1U35 D;  4XUJ D;  3WA9 C;  1TZY A;  3AYW A;  4J8U D;  2NZD B;  3MNN D;  2G5I C;  5BT1 D;  4YM6 B;  2FJ7 B;  4YS3 B;  5B0Z D;  5B1M D;  1KX3 D;  1F66 D;  3LJA D;  3AZL A;  1EQZ A;  2JSS A;  3NQU A;  1P3K A;  3R45 A;  3X1U C;  3AZI A;  1U35 B;  4UPK A;  3KFU G;  3W99 C;  3REK A;  3AZG D;  3B0C W;  4QLC D;  4XZQ A;  4WU8 A;  1F66 B;  5B1L D;  3REJ D;  4WJ3 C;  5CP6 C;  3MGR D;  2NZD C;  2FJ7 C;  4YS3 C;  3AZG B;  3REI D;  2ARO D;  2NQB B;  3WTP B;  5B1L B;  3AZH B;  5AY8 A;  4XUJ C;  3REJ B;  4J8U C;  3MGP A;  3MNN C;  5BT1 C;  5B2I D;  5AVB A;  5B1M C;  5B0Z C;  1KX3 C;  1F66 C;  2ZY2 A;  3LJA C;  3B0D C;  3REI B;  3C1B A;  2L5A A;  3KXB A;  5JRG A;  3AZM A;  3LZ1 A;  1P3A B;  3WAA A;  2HIO D;  3AZG C;  3AZN B;  3AN2 B;  4QLC C;  5JA4 B;  1A7W A;  2F8N D;  5B2I B;  3EPL A;  3O62 A;  3A6N D;  5B1L C;  4CAY A;  3AZJ D;  2DQN C;  3KUY A;  5BNX A;  4G92 C;  1P3G B;  3KWQ D;  3MGR C;  1Q9C A;  4WNN A;  5AVC D;  2HIO B;  5AV8 D;  3VH6 W;  2Y2O A;  3UT9 B;  2F8N K;  1ID3 A;  1M19 D;  3REL A;  2ARO C;  3LZ0 B;  3V9R B;  3KWQ B;  4J8W A;  5F99 D;  1P3L A;  4Z2M H;  4EO5 B;  5AV8 B;  5B2J A;  2HUE B;  1P3F A;  1M19 B;  4H9S C;  2YFW B;  5E5A B;  3AZE D;  3MVD D;  1AOI A;  3B6F D;  5GXQ A;  2HIO C;  3W96 A;  3REH D;  3AZL C;  4NE5 A;  3A6N C;  2Y2G A;  3AZJ C;  4AWL B;  5B0Y A;  1KU5 A;  3KWQ C;  4WU9 D;  5AVC C;  3MVD B;  3AV2 D;  1P34 D;  2Y2M A;  4EO5 C;  5AV8 C;  2CV5 B;  5GSU D;  4H9Q A;  3REH B;  2HUE C;  1P3I B;  4KUD B;  2G5H C;  1M19 C;  3MGS D;  5AV5 A;  4WU9 B;  5F99 C;  2J8P A;  1P34 B;  5KDM A;  1HQ3 B;  3MGS B;  4ZUX D;  3MGQ D;  5B32 D;  3UTB A;  3AZE C;  3MVD C;  3B6F C;  5B31 D;  4NE3 A;  3LEL A;  5GT3 A;  1M1A B;  3MGQ B;  5B32 B;  4WU9 C;  4YM6 A;  4H9N A;  3AV2 C;  2Y2I A;  5B31 B;  4ZBJ B;  1S32 A;  5GSU C;  4H9O B;  4Z66 D;  3KUY C;  3MGS C;  4J8X D;  4LD9 A;  5FUG A;  3VH5 T;  2Y2P A;  3X1U B;  1P3B D;  3W98 D;  3W97 A;  1BH8 A;  4Z66 B;  4ZUX C;  5B32 C;  3W99 B;  3FDD A;  4J8X B;  5CPJ D;  5DNN A;  5B31 C;  1N1J B;  5CPK D;  3EPH A;  1P3M D;  2NQB A;  5CP6 B;  3AZH A;  5AV6 D;  3UTA A;  3AV1 A;  4H9R B;  3AZF D;  5CPJ B;  3VH5 W;  2PYO A;  5BNV A;  5CPK B;  1KX5 D;  4Z66 C;  1P3M B;  4XUJ B;  2F2A C;  4J8X C;  4J8U B;  1P3A A;  3MNN B;  1KX3 B;  5AV9 A;  5B1M B;  5DNM D;  5B0Z B;  3AZN A;  3AN2 A;  5JA4 A;  3LJA B;  5C3I C;  3B0D B;  4J8V A;  3TU4 D;  4Z2M G;  2BYM A;  1JFI B;  1P3B C;  3W98 C;  2BYK B;  1P3G A;  1KX5 B;  5B40 D;  5AV5 C;  5B33 A;  4KGC D;  1P3P D;  3B6G D;  4UUZ B;  1BFM A;  5CPJ C;  4QLC B;  3X1T D;  4G91 C;  1BH9 A;  4CSR A;  4R8P D;  5DNM B;  3AFA A;  3UT9 A;  2CWE A;  4Z5T A;  4JJN A;  5CPK C;  3NQJ A;  3VH6 T;  2W8S A;  4G92 B;  1P3M C;  1KX4 D;  3W97 D;  3MGR B;  3LZ0 A;  5AV6 C;  3V9R A;  3B6G B;  3AZF C;  5GT0 D;  2ARO B;  1TZY D;  3AYW D;  1KX5 C;  4X23 A;  2RIQ A;  1KX4 B;  2YFW A;  5E5A A;  5CPI A;  1M18 A;  1P3O A;  3AZL D;  1EQZ D;  3H0R C;  5DNM C;  1P3K D;  3AZI D;  3TU4 C;  2ZY5 A;  3REK D;  5B40 C;  4KGC C;  4XZQ D;  4WU8 D;  1P3P C;  3B6G C;  4LD9 C;  3X1T C;  4R8P C;  3AZL B;  2F8N B;  2IO5 C;  2CV5 A;  3NQU B;  5BS7 C;  1P3K B;  3A6N B;  1P3I A;  3R45 B;  4KUD A;  2ZY4 A;  3AZJ B;  1KX4 C;  3W97 C;  5AVC B;  4NFT A;  4XZQ B;  4WU8 B;  3EPJ A;  1R4V A;  5GT0 C;  3EPK A;  1ZLA A;  5AY8 D;  5B24 A;  1TZY C;  3AYW C;  1HQ3 A;  3A1I A;  3MGP D;  3AZK A;  3AV1 C;  5AVB D;  5F99 B;  1EQZ C;  3C1B D;  1P3K C;  3KXB D;  5JRG D;  1M1A A;  3AZM D;  3AZI C;  3LZ1 D;  2FFF B;  3WKJ A;  4DRA A;  3WAA D;  1M18 D;  2JE5 A;  3REK C;  3AZE B;  3MGP B;  3C1C A;  3B6F B;  4XZQ C;  4WU8 C;  5AVB B;  3O62 D;  3KUY D;  3C1B B;  3KXB B;  4H9O A;  3WA9 A;  3AV2 B;  2Y2K A;  2VQR A;  1ID3 D;  3AFA C;  2YFV B;  5GSU B;  3REL D;  4Z5T C;  3KUY B;  5AY8 C;  5BNX B;  3X1U A;  3WTP E;  3MGP C;  4J8W D;  1P3L D;  3X1V A;  4WV4 B;  2F8N H;  3W99 A;  5AVB C;  4DRB A;  3X1S A;  5B2J D;  5G49 A;  3C1B C;  1P3F D;  3KXB C;  5JRG C;  3REL B;  3AZM C;  3LZ1 C;  1AOI D;  5GXQ D;  3WAA C;  4ZUX B;  5B32 G;  1M18 C;  2FJ7 A;  3W96 D;  3VH5 A;  4YS3 A;  2NZD A;  4H9P B;  4J8W B;  5B31 G;  3O62 C;  4E44 A;  5B2J B;  2Y2J A;  3P5J B;  5B0Y D;  1U35 A;  4XUJ A;  4J8U A;  3MNN A;  3W96 B;  1H3O B;  2RVQ D;  1KX3 A;  5B0Z A;  5B1M A;  2DF4 C;  1F66 A;  3LJA A;  1ID3 C;  3REL C;  5AV5 D;  5B0Y B;  1TAF B;  4J8W C;  1P3L C;  1B6W A;  3AZG A;  1T3U A;  5B2J C;  5C3I B;  1ZLA C;  4E45 A;  1P3F C;  5B1L A;  3WTP A;  5B24 C;  1P3B B;  3W98 B;  3UTB D;  5AV5 B;  3REJ A;  2LY8 A;  3MGR A;  1AOI C;  5GXQ C;  3AZK C;  3W96 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...