3O62C

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62C00
3B0DC 3X1UD 5B33D 5GT0C 4WU9B 5AY8A 4NE5A 1KX5C 5GT3B 2F8NA 3B0CW 1TZYD 3REKA 3WA9A 2FJ7D 4WNNB 1HQ3D 3W96C 3REIB 3WTPE 2YFWA 5GXQA 3REJA 2F8NK 3C1BA 1M18A 5GT3D 4KHAA 1P3KC 4KGCD 3NQJB 5CPIC 1R4VA 1F66D 3W99D 4H9PA 3UTBC 5BO0A 5B2IB 1ZLAD 3W98C 4XUJD 1KX3D 3MNNB 3REHC 3KUYD 3AZLD 5GSUA 5CPKA 1P3KA 3AFAA 1ZLAB 3AV1B 5AV9C 2BYMA 1F1EA 5BNXA 3X1VD 4YM6D 3WAAA 5GT0B 5B24A 3AZFA 3X1SD 3MVDB 3VH6T 1P3FD 1ID3A 3WKJB 2YFWB 5AV8D 5B1LD 5B40C 3KXBD 2CV5D 3AZMB 3REKB 3MGSD 5E5AD 2NZDD 5DNNC 4H9PB 3WKJD 3AZEC 4NE6A 4HGAB 2CV5A 3VH5W 5C3IB 2NQBD 5E5AB 5B1LA 5DNNA 5DNNB 4YS3C 4Z5TD 3X1SA 1P3BB 1P3FA 1ID3D 2NZDC 1M1AB 1HTAA 1P3IB 3NQUB 5AY8C 4Z66C 3W97C 4WU9C 3LJAD 3UTAC 1P3OD 5AY8B 1KX5B 1P3GC 3B6FC 1P3IC 5B0YA 3X1SC 1P3FC 3AZMD 4J8VA 4H9QB 1U35C 5CPJA 3B0CT 3AZJC 3X1TA 3KXBB 1P3OB 5B32B 3WTPB 5B33A 5AV5C 3O62A 4J8VB 3C1BC 3UT9C 4XUJC 1KX3C 1U35D 4G92C 3AN2C 3WA9C 1P34B 4J8XC 2FJ7A 5AV5A 5AV5B 1M19B 1P3OC 3LJAC 5JRGB 1F66B 3AZLA 2CWEA 4H9RB 1HQ3C 3C1CA 4Z5TA 3AV2B 1ID3C 4YM6B 3W96D 3LELD 1AOIC 4QLCA 5JA4A 1P3OA 3AV1D 3AZFC 1KX4A 5B1MA 3KWQB 3C1BD 1B6WA 3MNNC 3REHB 3AV2D 5B2IC 3REID 4H9OB 5AV6B 2PYOB 1B67A 4ZUXC 4JJNA 1TZYB 5CP6D 2PYOC 3KXBA 4J8UC 5JRGA 5AV8A 3B6FD 3KWQC 3UTAD 1ZLAA 1P3MA 2HUEB 2L5AA 1EQZA 3AZHA 5E5AA 3MGSA 3X1TC 4WV4B 5BO0B 1KX4B 4Z5TC 4YS3D 2HIOD 5B40A 5B40B 4YM6C 3AZID 5JRGD 1M1AD 3VH6A 2F8NB 3MGPB 4CSRA 1M18B 4DRAA 4WU9A 1S32D 5AV9A 1BH8A 3REIA 3MVDD 5B31B 3X1TB 2BYKA 5B0YD 2BYKB 3LELC 3W99C 1ULYA 4YS3A 3LJAA 3W98A 2JSSA 1P3KD 5B1MD 1M18D 4H9SA 4LD9B 4M6BA 5B2JA 3R45B 4XZQB 5AV8C 3WA9D 4KGCA 3LELB 3MGSB 1TZYC 3X1SB 1P3FB 3TU4D 1TAFB 1Q9CA 2LY8A 2HIOB 3MNNA 3AZIA 3KUYB 4WZSB 4LD9D 5BS7C 5KDMA 3AZNB 3AZLC 1AOIA 4Z66B 4AWLC 1P34D 3V9RA 3AZJD 1P3AD 4X23C 4NFTA 1N1JB 3W98D 3UTBD 3NQUA 4AWLB 1P3LA 1F66C 3AZNC 4HGAC 4CAYA 1P3MC 3REHA 3WAAC 4J8WA 5C3IC 4WU9D 3RELC 4XZQA 2YFVB 5B2IA 3UTBA 3C1BB 4J8WC 3AZJA 3AV1A 3UT9A 5BNXB 5B0ZC 1EQZD 4ZBJC 5B33C 3WTPC 3AZED 3W99A 3B6FA 1HQ3B 1N1JA 4QLCC 4KGCB 4WU8C 4Z66A 3AZJB 1ID3B 1U35B 4WU8B 5JA4B 4QLCB 1P3IA 5B32D 1BFMA 3WTPA 4ZBJB 5B33B 4Z2MG 4J8VD 4R8PD 3AN2B 1HQ3A 3C1CC 3AYWB 5DNMA 4E45A 4ZUXD 3AZGD 4YS3B 1P34C 4E44A 4J8UA 1P3LB 1P3PB 3AN2A 1EQZC 2HUEC 5AV9D 3MGRB 2NQBB 3AZFD 3R45A 5CPJC 5AVBD 4J8UB 3A6NC 1P3LC 1M1AA 3AZKA 5AV6C 3MGQA 3AYWA 3B0DB 5B1MC 3W97A 1AOIB 1A7WA 4J8XD 3AN2D 2IO5B 5B0YC 5AV6A 3MVDC 3A6ND 2F8NH 5B0ZA 5GXQD 3REJD 4JJND 1M19C 5F99B 4KUDC 5AV8B 5JRGC 3MGQD 5FUGA 3AZIC 5B2JD 5DNMB 3AZGB 1EQZB 3X1UC 5AV9B 3MGRD 4LD9C 1ZLAC 1TZYA 3REKD 2AROB 3VH5T 3UTBB 3B6GC 3AZMC 3AZGC 3MGPD 5F99C 5DNMC 3X1VB 2BYMB 1F66A 4J8VC 3W97D 2PYOD 3AYWD 1M18C 4X23A 5B24D 1P3MB 5AVCC 1BH9A 1H3OB 2RVQC 3LZ0C 4YM6A 3AZNA 5B2ID 3REIC 3MVDA 3UTAB 5BS7A 1JFIA 1P3PD 3AZLB 1S32A 3KUYA 3KSYA 3AZHC 5B0ZD 4Z2MH 1P3GB 5B31A 3AV1C 3A6NA 1M1AC 3O62D 4J8WB 2HIOC 5FUGB 4DRBA 2RVQD 4WNNA 5E5AC 3AZEA 3MGSC 3TU4B 3X1TD 1P3BC 4ZUXA 2CV5C 3MGRA 3RELB 5DNMD 5B2JB 3RELA 3KWQD 3WAAD 1BH9B 3NQJA 3AZND 3AZEB 4UUZA 2AROC 3TU4A 1P3BA 3REKC 1KX4D 4X23D 5BNVA 1P3AC 3LELA 1P3GA 3AV2C 3MGPA 4KUDD 1M19D 1S32B 3KUYC 5GT3A 1P3AA 5AVCB 2AROD 1AOID 5GSUC 5CPKC 5BT1C 5CPID 5F99A 4KGCC 5B1MB 3KWQA 5B0ZB 1P3GD 3UT9B 1KU5A 1BH8B 1P3AB 2F8ND 1P3BD 3B6GB 1P3LD 5BT1D 5G49A 2NQBC 4ZUXB 1U35A 1KX5D 4EO5B 3UT9D 3AZHD 3AZKB 3WAAB 4R8PB 1P3KB 4R8PA 1P3PC 3B6FB 3LZ1D 5B1LB 5B0YB 4XZQD 5G49B 4Z5TB 2IO5C 3V9RB 3AFAD 1KX4C 5B24C 5AVCA 3AYWC 3LZ0A 4R8PC 1P3PA 5CHLB 5KDMB 3AZKC 5F99D 5B1LC 4KHAB 1WWIA 5GT0A 3A6NB 4J8UD 5CP6C 4EO5C 5CPJB 1JFIB 4H9QA 4QLCD 3B6GD 3AFAC 4CAYB 3MGRC 4XZQC 3WKJA 1WWSA 3X1VC 3O62C 5B32A 3LZ1C 2NQBA 3MNND 4LD9A 3O62B 5GXQC 5CP6A 4J8WD 3REJC 4H9SC 3REHD 3W99B 4UUZB 3WKJC 3X1UA 3X1UB 5AVBB 3AFAB 2FJ7B 3RELD 1P34A 1KX5A 5CP6B 4CSRB 1P3MD 3MGPC 5AV6D 4X23B 3W97B 4J8XA 2FJ7C 5GSUD 4NE3A 5CPKD 5AVBC 5CPJD 3W98B 4G91B 3B0BA 3AZMA 5B2JC 3MGQC 5CPIA 3X1VA 2CV5B 5AV5D 3B6GA 2AROA 3LZ1B 3TU4C 4JJNC 5B31G 3AZGA 2YFVA 1H3OA 2PYOA 4JJNB 4XUJA 1KX3A 1M19A 4H9NA 3W96A 3MGQB 3C1CD 1TAFA 2F8NG 1P3ID 5GT3C 5B32G 4Z66D 3AZHB 4G91C 5AY8D 3VH6W 4H9NB 5B31C 3AZFB 5B24B 4H9RA 3C1CB 3AV2A 3WTPD 2NZDB 1S32C 2NZDA 4WU8A 3LZ0B 3LJAB 4H9OA 5GT0D 3WA9B 4J8XB 5B31D 5DNND 3LZ0D 4G92B 5AVCD 4XUJB 1KX3B 4KUDB 3AZKD 5CPIB 3KXBC 5GXQB 3REJB 2HIOA 5B40D 3AZIB 5B32C 3LZ1A 5AVBA 5BNVB 5GSUB 3VH5A 4WU8D 5CPKB 4KUDA 3W96B 3UTAA
chains in the Genus database with same CATH superfamily
2Y2OA 3B0DC 3X1UD 5B33D 5GT0C 4WU9B 5AY8A 4NE5A 1KX5C 5GT3B 2F8NA 3B0CW 1TZYD 3REKA 2ZY3A 2FFFB 3WA9A 2FJ7D 4WNNB 1HQ3D 3W96C 3REIB 3WTPE 2YFWA 2XD5A 5GXQA 3REJA 2F8NK 3C1BA 1M18A 5GT3D 4KHAA 1P3KC 4KGCD 3NQJB 5CPIC 1R4VA 1F66D 3W99D 4H9PA 3UTBC 5BO0A 5B2IB 1ZLAD 3W98C 4XUJD 4DQYB 1KX3D 3MNNB 3REHC 3KUYD 3AZLD 5GSUA 2BG1A 5CPKA 3AFAA 1P3KA 1ZLAB 3AV1B 5AV9C 2BYMA 1F1EA 5BNXA 2Y2IA 3X1VD 4YM6D 3WAAA 5GT0B 5B24A 3AZFA 3X1SD 3MVDB 3VH6T 1P3FD 1ID3A 3WKJB 2YFWB 5AV8D 5B1LD 5B40C 3KXBD 2CV5D 3AZMB 3REKB 3MGSD 5E5AD 2NZDD 5DNNC 4H9PB 3WKJD 3AZEC 2DF4C 4NE6A 4HGAB 2CV5A 3VH5W 5C3IB 2NQBD 5E5AB 5B1LA 5DNNA 5DNNB 3P5JB 4YS3C 4Z5TD 3X1SA 1P3BB 1P3FA 1ID3D 2NZDC 1M1AB 1HTAA 1P3IB 3NQUB 5AY8C 4Z66C 3W97C 4WU9C 3LJAD 3UTAC 1P3OD 5AY8B 1KX5B 1P3GC 3B6FC 1P3IC 5B0YA 3X1SC 1P3FC 3AZMD 4J8VA 4H9QB 1U35C 2G5IC 3F6TA 5CPJA 3B0CT 3A1IA 3AZJC 3X1TA 3KXBB 1P3OB 5B32B 3WTPB 5B33A 5AV5C 3O62A 4J8VB 3C1BC 3UT9C 4XUJC 1KX3C 1U35D 4G92C 3AN2C 3WA9C 1P34B 4J8XC 2FJ7A 5AV5A 5AV5B 1M19B 1P3OC 3LJAC 5JRGB 1F66B 3AZLA 2CWEA 3H0RC 2ZY2A 4H9RB 1HQ3C 3C1CA 4Z5TA 3AV2B 1ID3C 4YM6B 3W96D 3LELD 1AOIC 4QLCA 5JA4A 1P3OA 3AV1D 3AZFC 1KX4A 5B1MA 3KWQB 3C1BD 1B6WA 3MNNC 3REHB 3AV2D 5B2IC 3REID 4H9OB 5AV6B 2PYOB 1B67A 4ZUXC 4JJNA 1TZYB 5CP6D 2PYOC 3KXBA 4J8UC 5JRGA 5AV8A 3B6FD 3KWQC 3UTAD 1ZLAA 1P3MA 2HUEB 2L5AA 1EQZA 3AZHA 5E5AA 3MGSA 3X1TC 4WV4B 3H0MC 5BO0B 1KX4B 4Z5TC 4YS3D 2HIOD 5B40A 5B40B 4YM6C 3AZID 5JRGD 1M1AD 3VH6A 2F8NB 3MGPB 4CSRA 1M18B 4DRAA 4WU9A 1S32D 5AV9A 1BH8A 3REIA 3MVDD 5B31B 3X1TB 2BYKA 5B0YD 2BYKB 3LELC 3W99C 2Y2QA 1ULYA 4YS3A 3LJAA 3W98A 2JSSA 1P3KD 5B1MD 1M18D 4H9SA 4LD9B 4M6BA 5B2JA 3R45B 4XZQB 5AV8C 3WA9D 4KGCA 2Y2JA 3LELB 3MGSB 1TZYC 3X1SB 1P3FB 3TU4D 1TAFB 1T3UA 1Q9CA 2LY8A 2HIOB 3MNNA 3AZIA 3KUYB 4WZSB 4LD9D 2Y2KA 5BS7C 2JE5A 5KDMA 3KFUG 3IP4C 3AZNB 3AZLC 1AOIA 4Z66B 4AWLC 1P34D 3V9RA 3AZJD 1P3AD 4X23C 4NFTA 1N1JB 3W98D 3UTBD 3NQUA 4AWLB 1P3LA 1F66C 3AZNC 4HGAC 4CAYA 1P3MC 3REHA 3WAAC 4J8WA 5C3IC 4WU9D 3RELC 4XZQA 2YFVB 5B2IA 3UTBA 3C1BB 4J8WC 3AZJA 3AV1A 3UT9A 5BNXB 5B0ZC 1EQZD 4ZBJC 5B33C 3WTPC 3AZED 3W99A 3B6FA 1HQ3B 1N1JA 4QLCC 4KGCB 4WU8C 2J8PA 4Z66A 2ZY4A 3AZJB 1ID3B 1U35B 4WU8B 5JA4B 4QLCB 1P3IA 5B32D 1BFMA 4ZBJB 5B33B 4Z2MG 3WTPA 3EPLA 4R8PD 4J8VD 3AN2B 1HQ3A 3C1CC 3AYWB 5DNMA 2Y2PA 4E45A 4ZUXD 1Z2CB 3AZGD 4YS3B 4E44A 1P34C 4J8UA 1P3LB 1P3PB 3AN2A 1EQZC 2HUEC 5AV9D 3MGRB 2NQBB 3AZFD 3R45A 5CPJC 5AVBD 4J8UB 3A6NC 1P3LC 1M1AA 2ZY5A 3AZKA 5AV6C 3MGQA 2Y2MA 3H0LC 3AYWA 3B0DB 5B1MC 3W97A 1AOIB 4WJ3C 1A7WA 4J8XD 3AN2D 2IO5B 5B0YC 5AV6A 3MVDC 3A6ND 2F8NH 5B0ZA 5GXQD 3REJD 4JJND 2Y2LA 1M19C 5F99B 4KUDC 5AV8B 5JRGC 3MGQD 5FUGA 3AZIC 5B2JD 5DNMB 3AZGB 1EQZB 3X1UC 5AV9B 3MGRD 4LD9C 1ZLAC 1TZYA 3REKD 2AROB 3VH5T 3UTBB 3B6GC 3AZMC 3AZGC 3EPJA 3MGPD 5F99C 5DNMC 3X1VB 2BYMB 1F66A 4J8VC 3W97D 2PYOD 3AYWD 1M18C 4X23A 5B24D 1P3MB 5AVCC 1BH9A 1H3OB 2RVQC 3LZ0C 4YM6A 3AZNA 5B2ID 3REIC 2W8SA 3MVDA 3UTAB 5BS7A 1JFIA 1P3PD 3AZLB 1S32A 3KUYA 3KSYA 2G5HC 3AZHC 5B0ZD 4Z2MH 1P3GB 5B31A 3AV1C 3A6NA 1M1AC 3O62D 4J8WB 2HIOC 5FUGB 4DRBA 2RVQD 4WNNA 2RIQA 5E5AC 3AZEA 3MGSC 3TU4B 3X1TD 1P3BC 4ZUXA 2CV5C 3MGRA 3RELB 5DNMD 5B2JB 3RELA 2UWXA 3KWQD 3WAAD 1BH9B 3NQJA 3AZND 3AZEB 4UUZA 2AROC 3TU4A 1P3BA 3REKC 1KX4D 4X23D 5BNVA 1P3AC 2ZM5A 3LELA 1P3GA 3AV2C 3MGPA 4KUDD 1M19D 3FDDA 1S32B 3KUYC 5GT3A 1P3AA 5AVCB 2AROD 1AOID 5GSUC 5CPKC 5BT1C 5CPID 5F99A 4KGCC 5B1MB 3KWQA 5B0ZB 1P3GD 3UT9B 1KU5A 1BH8B 1P3AB 2F8ND 1P3BD 2XD1A 3B6GB 1P3LD 5BT1D 3AL0C 5G49A 2NQBC 4ZUXB 1U35A 1KX5D 4EO5B 3UT9D 3AZHD 3AZKB 3WAAB 4R8PB 1P3KB 4R8PA 1P3PC 3B6FB 3LZ1D 5B1LB 5B0YB 4XZQD 5G49B 4Z5TB 2IO5C 3V9RB 3AFAD 1KX4C 5B24C 5AVCA 3AYWC 3LZ0A 4R8PC 1P3PA 5CHLB 5KDMB 3AZKC 5F99D 5B1LC 4KHAB 1WWIA 2JCHA 5GT0A 3A6NB 4J8UD 5CP6C 4EO5C 5CPJB 1JFIB 4H9QA 4QLCD 3B6GD 3AFAC 4CAYB 3MGRC 4XZQC 3WKJA 1WWSA 3X1VC 3O62C 4UPKA 5B32A 3LZ1C 2NQBA 3MNND 4LD9A 2F2AC 3O62B 5GXQC 5CP6A 4J8WD 3REJC 2Y2HA 4H9SC 3REHD 3W99B 4UUZB 3WKJC 3X1UA 3X1UB 5AVBB 3AFAB 2FJ7B 3RELD 1P34A 1KX5A 5CP6B 4CSRB 1P3MD 3MGPC 5AV6D 4X23B 3W97B 4J8XA 2FJ7C 2VQRA 4NE3A 5GSUD 5AVBC 5CPKD 5CPJD 1PZRA 3W98B 4G91B 3B0BA 3AZMA 5B2JC 3MGQC 5CPIA 3X1VA 2CV5B 5AV5D 3B6GA 2AROA 3LZ1B 3TU4C 4JJNC 5B31G 3AZGA 2YFVA 1H3OA 2PYOA 4JJNB 4XUJA 1KX3A 1M19A 4H9NA 3W96A 3MGQB 3C1CD 1TAFA 2F8NG 1P3ID 5GT3C 5B32G 4Z66D 3AZHB 4G91C 5AY8D 3EPHA 3VH6W 5B31C 2DQNC 4H9NB 3AZFB 5B24B 3EG5B 4H9RA 3C1CB 3AV2A 3WTPD 2NZDB 1S32C 2NZDA 4WU8A 3LZ0B 3LJAB 4H9OA 5GT0D 3WA9B 2Y2GA 4J8XB 5B31D 5DNND 3LZ0D 4G92B 5AVCD 4XUJB 1KX3B 2Y2NA 4KUDB 3AZKD 5CPIB 3KXBC 5GXQB 3REJB 2HIOA 5B40D 3A1KA 3AZIB 5B32C 3LZ1A 5AVBA 5BNVB 1W2EA 3EPKA 5GSUB 3VH5A 4WU8D 5CPKB 4KUDA 3W96B 3UTAA
chains in the Genus database with same CATH topology
2Y2OA 3B0DC 3X1UD 5B33D 5GT0C 4WU9B 5AY8A 4NE5A 1KX5C 5GT3B 2F8NA 3B0CW 1TZYD 3REKA 2ZY3A 2FFFB 3WA9A 2FJ7D 4WNNB 1HQ3D 3W96C 3REIB 3WTPE 2YFWA 2XD5A 5GXQA 3REJA 2F8NK 3C1BA 1M18A 5GT3D 4KHAA 1P3KC 4KGCD 3NQJB 5CPIC 1R4VA 1F66D 3W99D 4H9PA 3UTBC 5BO0A 5B2IB 1ZLAD 3W98C 4XUJD 4DQYB 1KX3D 3MNNB 3REHC 3KUYD 3AZLD 5GSUA 2BG1A 5CPKA 3AFAA 1P3KA 1ZLAB 3AV1B 5AV9C 2BYMA 1F1EA 5BNXA 2Y2IA 3X1VD 4YM6D 3WAAA 5GT0B 5B24A 3AZFA 3X1SD 3MVDB 3VH6T 1P3FD 1ID3A 3WKJB 2YFWB 5AV8D 5B1LD 5B40C 3KXBD 2CV5D 3AZMB 3REKB 3MGSD 5E5AD 2NZDD 5DNNC 4H9PB 3WKJD 3AZEC 2DF4C 4NE6A 4HGAB 2CV5A 3VH5W 5C3IB 2NQBD 5E5AB 5B1LA 5DNNA 5DNNB 3P5JB 4YS3C 4Z5TD 3X1SA 1P3BB 1P3FA 1ID3D 2NZDC 1M1AB 1HTAA 1P3IB 3NQUB 5AY8C 4Z66C 3W97C 4WU9C 3LJAD 3UTAC 1P3OD 5AY8B 1KX5B 1P3GC 3B6FC 1P3IC 5B0YA 3X1SC 1P3FC 3AZMD 4J8VA 4H9QB 1U35C 2G5IC 3F6TA 5CPJA 3B0CT 3A1IA 3AZJC 3X1TA 3KXBB 1P3OB 5B32B 3WTPB 5B33A 5AV5C 3O62A 4J8VB 3C1BC 3UT9C 4XUJC 1KX3C 1U35D 4G92C 3AN2C 3WA9C 1P34B 4J8XC 2FJ7A 5AV5A 5AV5B 1M19B 1P3OC 3LJAC 5JRGB 1F66B 3AZLA 2CWEA 3H0RC 2ZY2A 4H9RB 1HQ3C 3C1CA 4Z5TA 3AV2B 1ID3C 4YM6B 3W96D 3LELD 1AOIC 4QLCA 5JA4A 1P3OA 3AV1D 3AZFC 1KX4A 5B1MA 3KWQB 3C1BD 1B6WA 3MNNC 3REHB 3AV2D 5B2IC 3REID 4H9OB 5AV6B 2PYOB 1B67A 4ZUXC 4JJNA 1TZYB 5CP6D 2PYOC 3KXBA 4J8UC 5JRGA 5AV8A 3B6FD 3KWQC 3UTAD 1ZLAA 1P3MA 2HUEB 2L5AA 1EQZA 3AZHA 5E5AA 3MGSA 3X1TC 4WV4B 3H0MC 5BO0B 1KX4B 4Z5TC 4YS3D 2HIOD 5B40A 5B40B 4YM6C 3AZID 5JRGD 1M1AD 3VH6A 2F8NB 3MGPB 4CSRA 1M18B 4DRAA 4WU9A 1S32D 5AV9A 1BH8A 3REIA 3MVDD 5B31B 3X1TB 2BYKA 5B0YD 2BYKB 3LELC 3W99C 2Y2QA 1ULYA 4YS3A 3LJAA 3W98A 2JSSA 1P3KD 5B1MD 1M18D 4H9SA 4LD9B 4M6BA 5B2JA 3R45B 4XZQB 5AV8C 3WA9D 4KGCA 2Y2JA 3LELB 3MGSB 1TZYC 3X1SB 1P3FB 3TU4D 1TAFB 1T3UA 1Q9CA 2LY8A 2HIOB 3MNNA 3AZIA 3KUYB 4WZSB 4LD9D 2Y2KA 5BS7C 2JE5A 5KDMA 3KFUG 3IP4C 3AZNB 3AZLC 1AOIA 4Z66B 4AWLC 1P34D 3V9RA 3AZJD 1P3AD 4X23C 4NFTA 1N1JB 3W98D 3UTBD 3NQUA 4AWLB 1P3LA 1F66C 3AZNC 4HGAC 4CAYA 1P3MC 3REHA 3WAAC 4J8WA 5C3IC 4WU9D 3RELC 4XZQA 2YFVB 5B2IA 3UTBA 3C1BB 4J8WC 3AZJA 3AV1A 3UT9A 5BNXB 5B0ZC 1EQZD 4ZBJC 5B33C 3WTPC 3AZED 3W99A 3B6FA 1HQ3B 1N1JA 4QLCC 4KGCB 4WU8C 2J8PA 4Z66A 2ZY4A 3AZJB 1ID3B 1U35B 4WU8B 5JA4B 4QLCB 1P3IA 5B32D 1BFMA 4ZBJB 5B33B 4Z2MG 3WTPA 3EPLA 4R8PD 4J8VD 3AN2B 1HQ3A 3C1CC 3AYWB 5DNMA 2Y2PA 4E45A 4ZUXD 1Z2CB 3AZGD 4YS3B 4E44A 1P34C 4J8UA 1P3LB 1P3PB 3AN2A 1EQZC 2HUEC 5AV9D 3MGRB 2NQBB 3AZFD 3R45A 5CPJC 5AVBD 4J8UB 3A6NC 1P3LC 1M1AA 2ZY5A 3AZKA 5AV6C 3MGQA 2Y2MA 3H0LC 3AYWA 3B0DB 5B1MC 3W97A 1AOIB 4WJ3C 1A7WA 4J8XD 3AN2D 2IO5B 5B0YC 5AV6A 3MVDC 3A6ND 2F8NH 5B0ZA 5GXQD 3REJD 4JJND 2Y2LA 1M19C 5F99B 4KUDC 5AV8B 5JRGC 3MGQD 5FUGA 3AZIC 5B2JD 5DNMB 3AZGB 1EQZB 3X1UC 5AV9B 3MGRD 4LD9C 1ZLAC 1TZYA 3REKD 2AROB 3VH5T 3UTBB 3B6GC 3AZMC 3AZGC 3EPJA 3MGPD 5F99C 5DNMC 3X1VB 2BYMB 1F66A 4J8VC 3W97D 2PYOD 3AYWD 1M18C 4X23A 5B24D 1P3MB 5AVCC 1BH9A 1H3OB 2RVQC 3LZ0C 4YM6A 3AZNA 5B2ID 3REIC 2W8SA 3MVDA 3UTAB 5BS7A 1JFIA 1P3PD 3AZLB 1S32A 3KUYA 3KSYA 2G5HC 3AZHC 5B0ZD 4Z2MH 1P3GB 5B31A 3AV1C 3A6NA 1M1AC 3O62D 4J8WB 2HIOC 5FUGB 4DRBA 2RVQD 4WNNA 2RIQA 5E5AC 3AZEA 3MGSC 3TU4B 3X1TD 1P3BC 4ZUXA 2CV5C 3MGRA 3RELB 5DNMD 5B2JB 3RELA 2UWXA 3KWQD 3WAAD 1BH9B 3NQJA 3AZND 3AZEB 4UUZA 2AROC 3TU4A 1P3BA 3REKC 1KX4D 4X23D 5BNVA 1P3AC 2ZM5A 3LELA 1P3GA 3AV2C 3MGPA 4KUDD 1M19D 3FDDA 1S32B 3KUYC 5GT3A 1P3AA 5AVCB 2AROD 1AOID 5GSUC 5CPKC 5BT1C 5CPID 5F99A 4KGCC 5B1MB 3KWQA 5B0ZB 1P3GD 3UT9B 1KU5A 1BH8B 1P3AB 2F8ND 1P3BD 2XD1A 3B6GB 1P3LD 5BT1D 3AL0C 5G49A 2NQBC 4ZUXB 1U35A 1KX5D 4EO5B 3UT9D 3AZHD 3AZKB 3WAAB 4R8PB 1P3KB 4R8PA 1P3PC 3B6FB 3LZ1D 5B1LB 5B0YB 4XZQD 5G49B 4Z5TB 2IO5C 3V9RB 3AFAD 1KX4C 5B24C 5AVCA 3AYWC 3LZ0A 4R8PC 1P3PA 5CHLB 5KDMB 3AZKC 5F99D 5B1LC 4KHAB 1WWIA 2JCHA 5GT0A 3A6NB 4J8UD 5CP6C 4EO5C 5CPJB 1JFIB 4H9QA 4QLCD 3B6GD 3AFAC 4CAYB 3MGRC 4XZQC 3WKJA 1WWSA 3X1VC 3O62C 4UPKA 5B32A 3LZ1C 2NQBA 3MNND 4LD9A 2F2AC 3O62B 5GXQC 5CP6A 4J8WD 3REJC 2Y2HA 4H9SC 3REHD 3W99B 4UUZB 3WKJC 3X1UA 3X1UB 5AVBB 3AFAB 2FJ7B 3RELD 1P34A 1KX5A 5CP6B 4CSRB 1P3MD 3MGPC 5AV6D 4X23B 3W97B 4J8XA 2FJ7C 2VQRA 4NE3A 5GSUD 5AVBC 5CPKD 5CPJD 1PZRA 3W98B 4G91B 3B0BA 3AZMA 5B2JC 3MGQC 5CPIA 3X1VA 2CV5B 5AV5D 3B6GA 2AROA 3LZ1B 3TU4C 4JJNC 5B31G 3AZGA 2YFVA 1H3OA 2PYOA 4JJNB 4XUJA 1KX3A 1M19A 4H9NA 3W96A 3MGQB 3C1CD 1TAFA 2F8NG 1P3ID 5GT3C 5B32G 4Z66D 3AZHB 4G91C 5AY8D 3EPHA 3VH6W 5B31C 2DQNC 4H9NB 3AZFB 5B24B 3EG5B 4H9RA 3C1CB 3AV2A 3WTPD 2NZDB 1S32C 2NZDA 4WU8A 3LZ0B 3LJAB 4H9OA 5GT0D 3WA9B 2Y2GA 4J8XB 5B31D 5DNND 3LZ0D 4G92B 5AVCD 4XUJB 1KX3B 2Y2NA 4KUDB 3AZKD 5CPIB 3KXBC 5GXQB 3REJB 2HIOA 5B40D 3A1KA 3AZIB 5B32C 3LZ1A 5AVBA 5BNVB 1W2EA 3EPKA 5GSUB 3VH5A 4WU8D 5CPKB 4KUDA 3W96B 3UTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0D C;  3X1U D;  5B33 D;  5GT0 C;  4WU9 B;  5AY8 A;  4NE5 A;  1KX5 C;  5GT3 B;  2F8N A;  3B0C W;  1TZY D;  3REK A;  3WA9 A;  2FJ7 D;  4WNN B;  1HQ3 D;  3W96 C;  3REI B;  3WTP E;  2YFW A;  5GXQ A;  3REJ A;  2F8N K;  3C1B A;  1M18 A;  5GT3 D;  4KHA A;  1P3K C;  4KGC D;  3NQJ B;  5CPI C;  1R4V A;  1F66 D;  3W99 D;  4H9P A;  3UTB C;  5BO0 A;  5B2I B;  1ZLA D;  3W98 C;  4XUJ D;  1KX3 D;  3MNN B;  3REH C;  3KUY D;  3AZL D;  5GSU A;  5CPK A;  1P3K A;  3AFA A;  1ZLA B;  3AV1 B;  5AV9 C;  2BYM A;  1F1E A;  5BNX A;  3X1V D;  4YM6 D;  3WAA A;  5GT0 B;  5B24 A;  3AZF A;  3X1S D;  3MVD B;  3VH6 T;  1P3F D;  1ID3 A;  3WKJ B;  2YFW B;  5AV8 D;  5B1L D;  5B40 C;  3KXB D;  2CV5 D;  3AZM B;  3REK B;  3MGS D;  5E5A D;  2NZD D;  5DNN C;  4H9P B;  3WKJ D;  3AZE C;  4NE6 A;  4HGA B;  2CV5 A;  3VH5 W;  5C3I B;  2NQB D;  5E5A B;  5B1L A;  5DNN A;  5DNN B;  4YS3 C;  4Z5T D;  3X1S A;  1P3B B;  1P3F A;  1ID3 D;  2NZD C;  1M1A B;  1HTA A;  1P3I B;  3NQU B;  5AY8 C;  4Z66 C;  3W97 C;  4WU9 C;  3LJA D;  3UTA C;  1P3O D;  5AY8 B;  1KX5 B;  1P3G C;  3B6F C;  1P3I C;  5B0Y A;  3X1S C;  1P3F C;  3AZM D;  4J8V A;  4H9Q B;  1U35 C;  5CPJ A;  3B0C T;  3AZJ C;  3X1T A;  3KXB B;  1P3O B;  5B32 B;  3WTP B;  5B33 A;  5AV5 C;  3O62 A;  4J8V B;  3C1B C;  3UT9 C;  4XUJ C;  1KX3 C;  1U35 D;  4G92 C;  3AN2 C;  3WA9 C;  1P34 B;  4J8X C;  2FJ7 A;  5AV5 A;  5AV5 B;  1M19 B;  1P3O C;  3LJA C;  5JRG B;  1F66 B;  3AZL A;  2CWE A;  4H9R B;  1HQ3 C;  3C1C A;  4Z5T A;  3AV2 B;  1ID3 C;  4YM6 B;  3W96 D;  3LEL D;  1AOI C;  4QLC A;  5JA4 A;  1P3O A;  3AV1 D;  3AZF C;  1KX4 A;  5B1M A;  3KWQ B;  3C1B D;  1B6W A;  3MNN C;  3REH B;  3AV2 D;  5B2I C;  3REI D;  4H9O B;  5AV6 B;  2PYO B;  1B67 A;  4ZUX C;  4JJN A;  1TZY B;  5CP6 D;  2PYO C;  3KXB A;  4J8U C;  5JRG A;  5AV8 A;  3B6F D;  3KWQ C;  3UTA D;  1ZLA A;  1P3M A;  2HUE B;  2L5A A;  1EQZ A;  3AZH A;  5E5A A;  3MGS A;  3X1T C;  4WV4 B;  5BO0 B;  1KX4 B;  4Z5T C;  4YS3 D;  2HIO D;  5B40 A;  5B40 B;  4YM6 C;  3AZI D;  5JRG D;  1M1A D;  3VH6 A;  2F8N B;  3MGP B;  4CSR A;  1M18 B;  4DRA A;  4WU9 A;  1S32 D;  5AV9 A;  1BH8 A;  3REI A;  3MVD D;  5B31 B;  3X1T B;  2BYK A;  5B0Y D;  2BYK B;  3LEL C;  3W99 C;  1ULY A;  4YS3 A;  3LJA A;  3W98 A;  2JSS A;  1P3K D;  5B1M D;  1M18 D;  4H9S A;  4LD9 B;  4M6B A;  5B2J A;  3R45 B;  4XZQ B;  5AV8 C;  3WA9 D;  4KGC A;  3LEL B;  3MGS B;  1TZY C;  3X1S B;  1P3F B;  3TU4 D;  1TAF B;  1Q9C A;  2LY8 A;  2HIO B;  3MNN A;  3AZI A;  3KUY B;  4WZS B;  4LD9 D;  5BS7 C;  5KDM A;  3AZN B;  3AZL C;  1AOI A;  4Z66 B;  4AWL C;  1P34 D;  3V9R A;  3AZJ D;  1P3A D;  4X23 C;  4NFT A;  1N1J B;  3W98 D;  3UTB D;  3NQU A;  4AWL B;  1P3L A;  1F66 C;  3AZN C;  4HGA C;  4CAY A;  1P3M C;  3REH A;  3WAA C;  4J8W A;  5C3I C;  4WU9 D;  3REL C;  4XZQ A;  2YFV B;  5B2I A;  3UTB A;  3C1B B;  4J8W C;  3AZJ A;  3AV1 A;  3UT9 A;  5BNX B;  5B0Z C;  1EQZ D;  4ZBJ C;  5B33 C;  3WTP C;  3AZE D;  3W99 A;  3B6F A;  1HQ3 B;  1N1J A;  4QLC C;  4KGC B;  4WU8 C;  4Z66 A;  3AZJ B;  1ID3 B;  1U35 B;  4WU8 B;  5JA4 B;  4QLC B;  1P3I A;  5B32 D;  1BFM A;  3WTP A;  4ZBJ B;  5B33 B;  4Z2M G;  4J8V D;  4R8P D;  3AN2 B;  1HQ3 A;  3C1C C;  3AYW B;  5DNM A;  4E45 A;  4ZUX D;  3AZG D;  4YS3 B;  1P34 C;  4E44 A;  4J8U A;  1P3L B;  1P3P B;  3AN2 A;  1EQZ C;  2HUE C;  5AV9 D;  3MGR B;  2NQB B;  3AZF D;  3R45 A;  5CPJ C;  5AVB D;  4J8U B;  3A6N C;  1P3L C;  1M1A A;  3AZK A;  5AV6 C;  3MGQ A;  3AYW A;  3B0D B;  5B1M C;  3W97 A;  1AOI B;  1A7W A;  4J8X D;  3AN2 D;  2IO5 B;  5B0Y C;  5AV6 A;  3MVD C;  3A6N D;  2F8N H;  5B0Z A;  5GXQ D;  3REJ D;  4JJN D;  1M19 C;  5F99 B;  4KUD C;  5AV8 B;  5JRG C;  3MGQ D;  5FUG A;  3AZI C;  5B2J D;  5DNM B;  3AZG B;  1EQZ B;  3X1U C;  5AV9 B;  3MGR D;  4LD9 C;  1ZLA C;  1TZY A;  3REK D;  2ARO B;  3VH5 T;  3UTB B;  3B6G C;  3AZM C;  3AZG C;  3MGP D;  5F99 C;  5DNM C;  3X1V B;  2BYM B;  1F66 A;  4J8V C;  3W97 D;  2PYO D;  3AYW D;  1M18 C;  4X23 A;  5B24 D;  1P3M B;  5AVC C;  1BH9 A;  1H3O B;  2RVQ C;  3LZ0 C;  4YM6 A;  3AZN A;  5B2I D;  3REI C;  3MVD A;  3UTA B;  5BS7 A;  1JFI A;  1P3P D;  3AZL B;  1S32 A;  3KUY A;  3KSY A;  3AZH C;  5B0Z D;  4Z2M H;  1P3G B;  5B31 A;  3AV1 C;  3A6N A;  1M1A C;  3O62 D;  4J8W B;  2HIO C;  5FUG B;  4DRB A;  2RVQ D;  4WNN A;  5E5A C;  3AZE A;  3MGS C;  3TU4 B;  3X1T D;  1P3B C;  4ZUX A;  2CV5 C;  3MGR A;  3REL B;  5DNM D;  5B2J B;  3REL A;  3KWQ D;  3WAA D;  1BH9 B;  3NQJ A;  3AZN D;  3AZE B;  4UUZ A;  2ARO C;  3TU4 A;  1P3B A;  3REK C;  1KX4 D;  4X23 D;  5BNV A;  1P3A C;  3LEL A;  1P3G A;  3AV2 C;  3MGP A;  4KUD D;  1M19 D;  1S32 B;  3KUY C;  5GT3 A;  1P3A A;  5AVC B;  2ARO D;  1AOI D;  5GSU C;  5CPK C;  5BT1 C;  5CPI D;  5F99 A;  4KGC C;  5B1M B;  3KWQ A;  5B0Z B;  1P3G D;  3UT9 B;  1KU5 A;  1BH8 B;  1P3A B;  2F8N D;  1P3B D;  3B6G B;  1P3L D;  5BT1 D;  5G49 A;  2NQB C;  4ZUX B;  1U35 A;  1KX5 D;  4EO5 B;  3UT9 D;  3AZH D;  3AZK B;  3WAA B;  4R8P B;  1P3K B;  4R8P A;  1P3P C;  3B6F B;  3LZ1 D;  5B1L B;  5B0Y B;  4XZQ D;  5G49 B;  4Z5T B;  2IO5 C;  3V9R B;  3AFA D;  1KX4 C;  5B24 C;  5AVC A;  3AYW C;  3LZ0 A;  4R8P C;  1P3P A;  5CHL B;  5KDM B;  3AZK C;  5F99 D;  5B1L C;  4KHA B;  1WWI A;  5GT0 A;  3A6N B;  4J8U D;  5CP6 C;  4EO5 C;  5CPJ B;  1JFI B;  4H9Q A;  4QLC D;  3B6G D;  3AFA C;  4CAY B;  3MGR C;  4XZQ C;  3WKJ A;  1WWS A;  3X1V C;  3O62 C;  5B32 A;  3LZ1 C;  2NQB A;  3MNN D;  4LD9 A;  3O62 B;  5GXQ C;  5CP6 A;  4J8W D;  3REJ C;  4H9S C;  3REH D;  3W99 B;  4UUZ B;  3WKJ C;  3X1U A;  3X1U B;  5AVB B;  3AFA B;  2FJ7 B;  3REL D;  1P34 A;  1KX5 A;  5CP6 B;  4CSR B;  1P3M D;  3MGP C;  5AV6 D;  4X23 B;  3W97 B;  4J8X A;  2FJ7 C;  5GSU D;  4NE3 A;  5CPK D;  5AVB C;  5CPJ D;  3W98 B;  4G91 B;  3B0B A;  3AZM A;  5B2J C;  3MGQ C;  5CPI A;  3X1V A;  2CV5 B;  5AV5 D;  3B6G A;  2ARO A;  3LZ1 B;  3TU4 C;  4JJN C;  5B31 G;  3AZG A;  2YFV A;  1H3O A;  2PYO A;  4JJN B;  4XUJ A;  1KX3 A;  1M19 A;  4H9N A;  3W96 A;  3MGQ B;  3C1C D;  1TAF A;  2F8N G;  1P3I D;  5GT3 C;  5B32 G;  4Z66 D;  3AZH B;  4G91 C;  5AY8 D;  3VH6 W;  4H9N B;  5B31 C;  3AZF B;  5B24 B;  4H9R A;  3C1C B;  3AV2 A;  3WTP D;  2NZD B;  1S32 C;  2NZD A;  4WU8 A;  3LZ0 B;  3LJA B;  4H9O A;  5GT0 D;  3WA9 B;  4J8X B;  5B31 D;  5DNN D;  3LZ0 D;  4G92 B;  5AVC D;  4XUJ B;  1KX3 B;  4KUD B;  3AZK D;  5CPI B;  3KXB C;  5GXQ B;  3REJ B;  2HIO A;  5B40 D;  3AZI B;  5B32 C;  3LZ1 A;  5AVB A;  5BNV B;  5GSU B;  3VH5 A;  4WU8 D;  5CPK B;  4KUD A;  3W96 B;  3UTA A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  3B0D C;  3X1U D;  5B33 D;  5GT0 C;  4WU9 B;  5AY8 A;  4NE5 A;  1KX5 C;  5GT3 B;  2F8N A;  3B0C W;  1TZY D;  3REK A;  2ZY3 A;  2FFF B;  3WA9 A;  2FJ7 D;  4WNN B;  1HQ3 D;  3W96 C;  3REI B;  3WTP E;  2YFW A;  2XD5 A;  5GXQ A;  3REJ A;  2F8N K;  3C1B A;  1M18 A;  5GT3 D;  4KHA A;  1P3K C;  4KGC D;  3NQJ B;  5CPI C;  1R4V A;  1F66 D;  3W99 D;  4H9P A;  3UTB C;  5BO0 A;  5B2I B;  1ZLA D;  3W98 C;  4XUJ D;  4DQY B;  1KX3 D;  3MNN B;  3REH C;  3KUY D;  3AZL D;  5GSU A;  2BG1 A;  5CPK A;  3AFA A;  1P3K A;  1ZLA B;  3AV1 B;  5AV9 C;  2BYM A;  1F1E A;  5BNX A;  2Y2I A;  3X1V D;  4YM6 D;  3WAA A;  5GT0 B;  5B24 A;  3AZF A;  3X1S D;  3MVD B;  3VH6 T;  1P3F D;  1ID3 A;  3WKJ B;  2YFW B;  5AV8 D;  5B1L D;  5B40 C;  3KXB D;  2CV5 D;  3AZM B;  3REK B;  3MGS D;  5E5A D;  2NZD D;  5DNN C;  4H9P B;  3WKJ D;  3AZE C;  2DF4 C;  4NE6 A;  4HGA B;  2CV5 A;  3VH5 W;  5C3I B;  2NQB D;  5E5A B;  5B1L A;  5DNN A;  5DNN B;  3P5J B;  4YS3 C;  4Z5T D;  3X1S A;  1P3B B;  1P3F A;  1ID3 D;  2NZD C;  1M1A B;  1HTA A;  1P3I B;  3NQU B;  5AY8 C;  4Z66 C;  3W97 C;  4WU9 C;  3LJA D;  3UTA C;  1P3O D;  5AY8 B;  1KX5 B;  1P3G C;  3B6F C;  1P3I C;  5B0Y A;  3X1S C;  1P3F C;  3AZM D;  4J8V A;  4H9Q B;  1U35 C;  2G5I C;  3F6T A;  5CPJ A;  3B0C T;  3A1I A;  3AZJ C;  3X1T A;  3KXB B;  1P3O B;  5B32 B;  3WTP B;  5B33 A;  5AV5 C;  3O62 A;  4J8V B;  3C1B C;  3UT9 C;  4XUJ C;  1KX3 C;  1U35 D;  4G92 C;  3AN2 C;  3WA9 C;  1P34 B;  4J8X C;  2FJ7 A;  5AV5 A;  5AV5 B;  1M19 B;  1P3O C;  3LJA C;  5JRG B;  1F66 B;  3AZL A;  2CWE A;  3H0R C;  2ZY2 A;  4H9R B;  1HQ3 C;  3C1C A;  4Z5T A;  3AV2 B;  1ID3 C;  4YM6 B;  3W96 D;  3LEL D;  1AOI C;  4QLC A;  5JA4 A;  1P3O A;  3AV1 D;  3AZF C;  1KX4 A;  5B1M A;  3KWQ B;  3C1B D;  1B6W A;  3MNN C;  3REH B;  3AV2 D;  5B2I C;  3REI D;  4H9O B;  5AV6 B;  2PYO B;  1B67 A;  4ZUX C;  4JJN A;  1TZY B;  5CP6 D;  2PYO C;  3KXB A;  4J8U C;  5JRG A;  5AV8 A;  3B6F D;  3KWQ C;  3UTA D;  1ZLA A;  1P3M A;  2HUE B;  2L5A A;  1EQZ A;  3AZH A;  5E5A A;  3MGS A;  3X1T C;  4WV4 B;  3H0M C;  5BO0 B;  1KX4 B;  4Z5T C;  4YS3 D;  2HIO D;  5B40 A;  5B40 B;  4YM6 C;  3AZI D;  5JRG D;  1M1A D;  3VH6 A;  2F8N B;  3MGP B;  4CSR A;  1M18 B;  4DRA A;  4WU9 A;  1S32 D;  5AV9 A;  1BH8 A;  3REI A;  3MVD D;  5B31 B;  3X1T B;  2BYK A;  5B0Y D;  2BYK B;  3LEL C;  3W99 C;  2Y2Q A;  1ULY A;  4YS3 A;  3LJA A;  3W98 A;  2JSS A;  1P3K D;  5B1M D;  1M18 D;  4H9S A;  4LD9 B;  4M6B A;  5B2J A;  3R45 B;  4XZQ B;  5AV8 C;  3WA9 D;  4KGC A;  2Y2J A;  3LEL B;  3MGS B;  1TZY C;  3X1S B;  1P3F B;  3TU4 D;  1TAF B;  1T3U A;  1Q9C A;  2LY8 A;  2HIO B;  3MNN A;  3AZI A;  3KUY B;  4WZS B;  4LD9 D;  2Y2K A;  5BS7 C;  2JE5 A;  5KDM A;  3KFU G;  3IP4 C;  3AZN B;  3AZL C;  1AOI A;  4Z66 B;  4AWL C;  1P34 D;  3V9R A;  3AZJ D;  1P3A D;  4X23 C;  4NFT A;  1N1J B;  3W98 D;  3UTB D;  3NQU A;  4AWL B;  1P3L A;  1F66 C;  3AZN C;  4HGA C;  4CAY A;  1P3M C;  3REH A;  3WAA C;  4J8W A;  5C3I C;  4WU9 D;  3REL C;  4XZQ A;  2YFV B;  5B2I A;  3UTB A;  3C1B B;  4J8W C;  3AZJ A;  3AV1 A;  3UT9 A;  5BNX B;  5B0Z C;  1EQZ D;  4ZBJ C;  5B33 C;  3WTP C;  3AZE D;  3W99 A;  3B6F A;  1HQ3 B;  1N1J A;  4QLC C;  4KGC B;  4WU8 C;  2J8P A;  4Z66 A;  2ZY4 A;  3AZJ B;  1ID3 B;  1U35 B;  4WU8 B;  5JA4 B;  4QLC B;  1P3I A;  5B32 D;  1BFM A;  4ZBJ B;  5B33 B;  4Z2M G;  3WTP A;  3EPL A;  4R8P D;  4J8V D;  3AN2 B;  1HQ3 A;  3C1C C;  3AYW B;  5DNM A;  2Y2P A;  4E45 A;  4ZUX D;  1Z2C B;  3AZG D;  4YS3 B;  4E44 A;  1P34 C;  4J8U A;  1P3L B;  1P3P B;  3AN2 A;  1EQZ C;  2HUE C;  5AV9 D;  3MGR B;  2NQB B;  3AZF D;  3R45 A;  5CPJ C;  5AVB D;  4J8U B;  3A6N C;  1P3L C;  1M1A A;  2ZY5 A;  3AZK A;  5AV6 C;  3MGQ A;  2Y2M A;  3H0L C;  3AYW A;  3B0D B;  5B1M C;  3W97 A;  1AOI B;  4WJ3 C;  1A7W A;  4J8X D;  3AN2 D;  2IO5 B;  5B0Y C;  5AV6 A;  3MVD C;  3A6N D;  2F8N H;  5B0Z A;  5GXQ D;  3REJ D;  4JJN D;  2Y2L A;  1M19 C;  5F99 B;  4KUD C;  5AV8 B;  5JRG C;  3MGQ D;  5FUG A;  3AZI C;  5B2J D;  5DNM B;  3AZG B;  1EQZ B;  3X1U C;  5AV9 B;  3MGR D;  4LD9 C;  1ZLA C;  1TZY A;  3REK D;  2ARO B;  3VH5 T;  3UTB B;  3B6G C;  3AZM C;  3AZG C;  3EPJ A;  3MGP D;  5F99 C;  5DNM C;  3X1V B;  2BYM B;  1F66 A;  4J8V C;  3W97 D;  2PYO D;  3AYW D;  1M18 C;  4X23 A;  5B24 D;  1P3M B;  5AVC C;  1BH9 A;  1H3O B;  2RVQ C;  3LZ0 C;  4YM6 A;  3AZN A;  5B2I D;  3REI C;  2W8S A;  3MVD A;  3UTA B;  5BS7 A;  1JFI A;  1P3P D;  3AZL B;  1S32 A;  3KUY A;  3KSY A;  2G5H C;  3AZH C;  5B0Z D;  4Z2M H;  1P3G B;  5B31 A;  3AV1 C;  3A6N A;  1M1A C;  3O62 D;  4J8W B;  2HIO C;  5FUG B;  4DRB A;  2RVQ D;  4WNN A;  2RIQ A;  5E5A C;  3AZE A;  3MGS C;  3TU4 B;  3X1T D;  1P3B C;  4ZUX A;  2CV5 C;  3MGR A;  3REL B;  5DNM D;  5B2J B;  3REL A;  2UWX A;  3KWQ D;  3WAA D;  1BH9 B;  3NQJ A;  3AZN D;  3AZE B;  4UUZ A;  2ARO C;  3TU4 A;  1P3B A;  3REK C;  1KX4 D;  4X23 D;  5BNV A;  1P3A C;  2ZM5 A;  3LEL A;  1P3G A;  3AV2 C;  3MGP A;  4KUD D;  1M19 D;  3FDD A;  1S32 B;  3KUY C;  5GT3 A;  1P3A A;  5AVC B;  2ARO D;  1AOI D;  5GSU C;  5CPK C;  5BT1 C;  5CPI D;  5F99 A;  4KGC C;  5B1M B;  3KWQ A;  5B0Z B;  1P3G D;  3UT9 B;  1KU5 A;  1BH8 B;  1P3A B;  2F8N D;  1P3B D;  2XD1 A;  3B6G B;  1P3L D;  5BT1 D;  3AL0 C;  5G49 A;  2NQB C;  4ZUX B;  1U35 A;  1KX5 D;  4EO5 B;  3UT9 D;  3AZH D;  3AZK B;  3WAA B;  4R8P B;  1P3K B;  4R8P A;  1P3P C;  3B6F B;  3LZ1 D;  5B1L B;  5B0Y B;  4XZQ D;  5G49 B;  4Z5T B;  2IO5 C;  3V9R B;  3AFA D;  1KX4 C;  5B24 C;  5AVC A;  3AYW C;  3LZ0 A;  4R8P C;  1P3P A;  5CHL B;  5KDM B;  3AZK C;  5F99 D;  5B1L C;  4KHA B;  1WWI A;  2JCH A;  5GT0 A;  3A6N B;  4J8U D;  5CP6 C;  4EO5 C;  5CPJ B;  1JFI B;  4H9Q A;  4QLC D;  3B6G D;  3AFA C;  4CAY B;  3MGR C;  4XZQ C;  3WKJ A;  1WWS A;  3X1V C;  3O62 C;  4UPK A;  5B32 A;  3LZ1 C;  2NQB A;  3MNN D;  4LD9 A;  2F2A C;  3O62 B;  5GXQ C;  5CP6 A;  4J8W D;  3REJ C;  2Y2H A;  4H9S C;  3REH D;  3W99 B;  4UUZ B;  3WKJ C;  3X1U A;  3X1U B;  5AVB B;  3AFA B;  2FJ7 B;  3REL D;  1P34 A;  1KX5 A;  5CP6 B;  4CSR B;  1P3M D;  3MGP C;  5AV6 D;  4X23 B;  3W97 B;  4J8X A;  2FJ7 C;  2VQR A;  4NE3 A;  5GSU D;  5AVB C;  5CPK D;  5CPJ D;  1PZR A;  3W98 B;  4G91 B;  3B0B A;  3AZM A;  5B2J C;  3MGQ C;  5CPI A;  3X1V A;  2CV5 B;  5AV5 D;  3B6G A;  2ARO A;  3LZ1 B;  3TU4 C;  4JJN C;  5B31 G;  3AZG A;  2YFV A;  1H3O A;  2PYO A;  4JJN B;  4XUJ A;  1KX3 A;  1M19 A;  4H9N A;  3W96 A;  3MGQ B;  3C1C D;  1TAF A;  2F8N G;  1P3I D;  5GT3 C;  5B32 G;  4Z66 D;  3AZH B;  4G91 C;  5AY8 D;  3EPH A;  3VH6 W;  5B31 C;  2DQN C;  4H9N B;  3AZF B;  5B24 B;  3EG5 B;  4H9R A;  3C1C B;  3AV2 A;  3WTP D;  2NZD B;  1S32 C;  2NZD A;  4WU8 A;  3LZ0 B;  3LJA B;  4H9O A;  5GT0 D;  3WA9 B;  2Y2G A;  4J8X B;  5B31 D;  5DNN D;  3LZ0 D;  4G92 B;  5AVC D;  4XUJ B;  1KX3 B;  2Y2N A;  4KUD B;  3AZK D;  5CPI B;  3KXB C;  5GXQ B;  3REJ B;  2HIO A;  5B40 D;  3A1K A;  3AZI B;  5B32 C;  3LZ1 A;  5AVB A;  5BNV B;  1W2E A;  3EPK A;  5GSU B;  3VH5 A;  4WU8 D;  5CPK B;  4KUD A;  3W96 B;  3UTA A; 
#chains in the Genus database with same CATH homology
 2Y2O A;  3B0D C;  3X1U D;  5B33 D;  5GT0 C;  4WU9 B;  5AY8 A;  4NE5 A;  1KX5 C;  5GT3 B;  2F8N A;  3B0C W;  1TZY D;  3REK A;  2ZY3 A;  2FFF B;  3WA9 A;  2FJ7 D;  4WNN B;  1HQ3 D;  3W96 C;  3REI B;  3WTP E;  2YFW A;  2XD5 A;  5GXQ A;  3REJ A;  2F8N K;  3C1B A;  1M18 A;  5GT3 D;  4KHA A;  1P3K C;  4KGC D;  3NQJ B;  5CPI C;  1R4V A;  1F66 D;  3W99 D;  4H9P A;  3UTB C;  5BO0 A;  5B2I B;  1ZLA D;  3W98 C;  4XUJ D;  4DQY B;  1KX3 D;  3MNN B;  3REH C;  3KUY D;  3AZL D;  5GSU A;  2BG1 A;  5CPK A;  3AFA A;  1P3K A;  1ZLA B;  3AV1 B;  5AV9 C;  2BYM A;  1F1E A;  5BNX A;  2Y2I A;  3X1V D;  4YM6 D;  3WAA A;  5GT0 B;  5B24 A;  3AZF A;  3X1S D;  3MVD B;  3VH6 T;  1P3F D;  1ID3 A;  3WKJ B;  2YFW B;  5AV8 D;  5B1L D;  5B40 C;  3KXB D;  2CV5 D;  3AZM B;  3REK B;  3MGS D;  5E5A D;  2NZD D;  5DNN C;  4H9P B;  3WKJ D;  3AZE C;  2DF4 C;  4NE6 A;  4HGA B;  2CV5 A;  3VH5 W;  5C3I B;  2NQB D;  5E5A B;  5B1L A;  5DNN A;  5DNN B;  3P5J B;  4YS3 C;  4Z5T D;  3X1S A;  1P3B B;  1P3F A;  1ID3 D;  2NZD C;  1M1A B;  1HTA A;  1P3I B;  3NQU B;  5AY8 C;  4Z66 C;  3W97 C;  4WU9 C;  3LJA D;  3UTA C;  1P3O D;  5AY8 B;  1KX5 B;  1P3G C;  3B6F C;  1P3I C;  5B0Y A;  3X1S C;  1P3F C;  3AZM D;  4J8V A;  4H9Q B;  1U35 C;  2G5I C;  3F6T A;  5CPJ A;  3B0C T;  3A1I A;  3AZJ C;  3X1T A;  3KXB B;  1P3O B;  5B32 B;  3WTP B;  5B33 A;  5AV5 C;  3O62 A;  4J8V B;  3C1B C;  3UT9 C;  4XUJ C;  1KX3 C;  1U35 D;  4G92 C;  3AN2 C;  3WA9 C;  1P34 B;  4J8X C;  2FJ7 A;  5AV5 A;  5AV5 B;  1M19 B;  1P3O C;  3LJA C;  5JRG B;  1F66 B;  3AZL A;  2CWE A;  3H0R C;  2ZY2 A;  4H9R B;  1HQ3 C;  3C1C A;  4Z5T A;  3AV2 B;  1ID3 C;  4YM6 B;  3W96 D;  3LEL D;  1AOI C;  4QLC A;  5JA4 A;  1P3O A;  3AV1 D;  3AZF C;  1KX4 A;  5B1M A;  3KWQ B;  3C1B D;  1B6W A;  3MNN C;  3REH B;  3AV2 D;  5B2I C;  3REI D;  4H9O B;  5AV6 B;  2PYO B;  1B67 A;  4ZUX C;  4JJN A;  1TZY B;  5CP6 D;  2PYO C;  3KXB A;  4J8U C;  5JRG A;  5AV8 A;  3B6F D;  3KWQ C;  3UTA D;  1ZLA A;  1P3M A;  2HUE B;  2L5A A;  1EQZ A;  3AZH A;  5E5A A;  3MGS A;  3X1T C;  4WV4 B;  3H0M C;  5BO0 B;  1KX4 B;  4Z5T C;  4YS3 D;  2HIO D;  5B40 A;  5B40 B;  4YM6 C;  3AZI D;  5JRG D;  1M1A D;  3VH6 A;  2F8N B;  3MGP B;  4CSR A;  1M18 B;  4DRA A;  4WU9 A;  1S32 D;  5AV9 A;  1BH8 A;  3REI A;  3MVD D;  5B31 B;  3X1T B;  2BYK A;  5B0Y D;  2BYK B;  3LEL C;  3W99 C;  2Y2Q A;  1ULY A;  4YS3 A;  3LJA A;  3W98 A;  2JSS A;  1P3K D;  5B1M D;  1M18 D;  4H9S A;  4LD9 B;  4M6B A;  5B2J A;  3R45 B;  4XZQ B;  5AV8 C;  3WA9 D;  4KGC A;  2Y2J A;  3LEL B;  3MGS B;  1TZY C;  3X1S B;  1P3F B;  3TU4 D;  1TAF B;  1T3U A;  1Q9C A;  2LY8 A;  2HIO B;  3MNN A;  3AZI A;  3KUY B;  4WZS B;  4LD9 D;  2Y2K A;  5BS7 C;  2JE5 A;  5KDM A;  3KFU G;  3IP4 C;  3AZN B;  3AZL C;  1AOI A;  4Z66 B;  4AWL C;  1P34 D;  3V9R A;  3AZJ D;  1P3A D;  4X23 C;  4NFT A;  1N1J B;  3W98 D;  3UTB D;  3NQU A;  4AWL B;  1P3L A;  1F66 C;  3AZN C;  4HGA C;  4CAY A;  1P3M C;  3REH A;  3WAA C;  4J8W A;  5C3I C;  4WU9 D;  3REL C;  4XZQ A;  2YFV B;  5B2I A;  3UTB A;  3C1B B;  4J8W C;  3AZJ A;  3AV1 A;  3UT9 A;  5BNX B;  5B0Z C;  1EQZ D;  4ZBJ C;  5B33 C;  3WTP C;  3AZE D;  3W99 A;  3B6F A;  1HQ3 B;  1N1J A;  4QLC C;  4KGC B;  4WU8 C;  2J8P A;  4Z66 A;  2ZY4 A;  3AZJ B;  1ID3 B;  1U35 B;  4WU8 B;  5JA4 B;  4QLC B;  1P3I A;  5B32 D;  1BFM A;  4ZBJ B;  5B33 B;  4Z2M G;  3WTP A;  3EPL A;  4R8P D;  4J8V D;  3AN2 B;  1HQ3 A;  3C1C C;  3AYW B;  5DNM A;  2Y2P A;  4E45 A;  4ZUX D;  1Z2C B;  3AZG D;  4YS3 B;  4E44 A;  1P34 C;  4J8U A;  1P3L B;  1P3P B;  3AN2 A;  1EQZ C;  2HUE C;  5AV9 D;  3MGR B;  2NQB B;  3AZF D;  3R45 A;  5CPJ C;  5AVB D;  4J8U B;  3A6N C;  1P3L C;  1M1A A;  2ZY5 A;  3AZK A;  5AV6 C;  3MGQ A;  2Y2M A;  3H0L C;  3AYW A;  3B0D B;  5B1M C;  3W97 A;  1AOI B;  4WJ3 C;  1A7W A;  4J8X D;  3AN2 D;  2IO5 B;  5B0Y C;  5AV6 A;  3MVD C;  3A6N D;  2F8N H;  5B0Z A;  5GXQ D;  3REJ D;  4JJN D;  2Y2L A;  1M19 C;  5F99 B;  4KUD C;  5AV8 B;  5JRG C;  3MGQ D;  5FUG A;  3AZI C;  5B2J D;  5DNM B;  3AZG B;  1EQZ B;  3X1U C;  5AV9 B;  3MGR D;  4LD9 C;  1ZLA C;  1TZY A;  3REK D;  2ARO B;  3VH5 T;  3UTB B;  3B6G C;  3AZM C;  3AZG C;  3EPJ A;  3MGP D;  5F99 C;  5DNM C;  3X1V B;  2BYM B;  1F66 A;  4J8V C;  3W97 D;  2PYO D;  3AYW D;  1M18 C;  4X23 A;  5B24 D;  1P3M B;  5AVC C;  1BH9 A;  1H3O B;  2RVQ C;  3LZ0 C;  4YM6 A;  3AZN A;  5B2I D;  3REI C;  2W8S A;  3MVD A;  3UTA B;  5BS7 A;  1JFI A;  1P3P D;  3AZL B;  1S32 A;  3KUY A;  3KSY A;  2G5H C;  3AZH C;  5B0Z D;  4Z2M H;  1P3G B;  5B31 A;  3AV1 C;  3A6N A;  1M1A C;  3O62 D;  4J8W B;  2HIO C;  5FUG B;  4DRB A;  2RVQ D;  4WNN A;  2RIQ A;  5E5A C;  3AZE A;  3MGS C;  3TU4 B;  3X1T D;  1P3B C;  4ZUX A;  2CV5 C;  3MGR A;  3REL B;  5DNM D;  5B2J B;  3REL A;  2UWX A;  3KWQ D;  3WAA D;  1BH9 B;  3NQJ A;  3AZN D;  3AZE B;  4UUZ A;  2ARO C;  3TU4 A;  1P3B A;  3REK C;  1KX4 D;  4X23 D;  5BNV A;  1P3A C;  2ZM5 A;  3LEL A;  1P3G A;  3AV2 C;  3MGP A;  4KUD D;  1M19 D;  3FDD A;  1S32 B;  3KUY C;  5GT3 A;  1P3A A;  5AVC B;  2ARO D;  1AOI D;  5GSU C;  5CPK C;  5BT1 C;  5CPI D;  5F99 A;  4KGC C;  5B1M B;  3KWQ A;  5B0Z B;  1P3G D;  3UT9 B;  1KU5 A;  1BH8 B;  1P3A B;  2F8N D;  1P3B D;  2XD1 A;  3B6G B;  1P3L D;  5BT1 D;  3AL0 C;  5G49 A;  2NQB C;  4ZUX B;  1U35 A;  1KX5 D;  4EO5 B;  3UT9 D;  3AZH D;  3AZK B;  3WAA B;  4R8P B;  1P3K B;  4R8P A;  1P3P C;  3B6F B;  3LZ1 D;  5B1L B;  5B0Y B;  4XZQ D;  5G49 B;  4Z5T B;  2IO5 C;  3V9R B;  3AFA D;  1KX4 C;  5B24 C;  5AVC A;  3AYW C;  3LZ0 A;  4R8P C;  1P3P A;  5CHL B;  5KDM B;  3AZK C;  5F99 D;  5B1L C;  4KHA B;  1WWI A;  2JCH A;  5GT0 A;  3A6N B;  4J8U D;  5CP6 C;  4EO5 C;  5CPJ B;  1JFI B;  4H9Q A;  4QLC D;  3B6G D;  3AFA C;  4CAY B;  3MGR C;  4XZQ C;  3WKJ A;  1WWS A;  3X1V C;  3O62 C;  4UPK A;  5B32 A;  3LZ1 C;  2NQB A;  3MNN D;  4LD9 A;  2F2A C;  3O62 B;  5GXQ C;  5CP6 A;  4J8W D;  3REJ C;  2Y2H A;  4H9S C;  3REH D;  3W99 B;  4UUZ B;  3WKJ C;  3X1U A;  3X1U B;  5AVB B;  3AFA B;  2FJ7 B;  3REL D;  1P34 A;  1KX5 A;  5CP6 B;  4CSR B;  1P3M D;  3MGP C;  5AV6 D;  4X23 B;  3W97 B;  4J8X A;  2FJ7 C;  2VQR A;  4NE3 A;  5GSU D;  5AVB C;  5CPK D;  5CPJ D;  1PZR A;  3W98 B;  4G91 B;  3B0B A;  3AZM A;  5B2J C;  3MGQ C;  5CPI A;  3X1V A;  2CV5 B;  5AV5 D;  3B6G A;  2ARO A;  3LZ1 B;  3TU4 C;  4JJN C;  5B31 G;  3AZG A;  2YFV A;  1H3O A;  2PYO A;  4JJN B;  4XUJ A;  1KX3 A;  1M19 A;  4H9N A;  3W96 A;  3MGQ B;  3C1C D;  1TAF A;  2F8N G;  1P3I D;  5GT3 C;  5B32 G;  4Z66 D;  3AZH B;  4G91 C;  5AY8 D;  3EPH A;  3VH6 W;  5B31 C;  2DQN C;  4H9N B;  3AZF B;  5B24 B;  3EG5 B;  4H9R A;  3C1C B;  3AV2 A;  3WTP D;  2NZD B;  1S32 C;  2NZD A;  4WU8 A;  3LZ0 B;  3LJA B;  4H9O A;  5GT0 D;  3WA9 B;  2Y2G A;  4J8X B;  5B31 D;  5DNN D;  3LZ0 D;  4G92 B;  5AVC D;  4XUJ B;  1KX3 B;  2Y2N A;  4KUD B;  3AZK D;  5CPI B;  3KXB C;  5GXQ B;  3REJ B;  2HIO A;  5B40 D;  3A1K A;  3AZI B;  5B32 C;  3LZ1 A;  5AVB A;  5BNV B;  1W2E A;  3EPK A;  5GSU B;  3VH5 A;  4WU8 D;  5CPK B;  4KUD A;  3W96 B;  3UTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...