3O62C

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62C00
1P3GC 4R8PD 2JSSA 3MGPC 4J8UC 5DNMC 1P3PA 1BH8B 3AN2A 1HQ3C 3AV1B 2YFWA 4H9OB 1P3LA 3UTAD 5B24D 3AZLC 3VH5W 5JA4A 1WWSA 1P3GD 3MGPD 4J8UD 5BT1C 5DNMD 5B0ZB 1F1EA 3AZHC 3B6FC 1HQ3D 1U35A 3AZNA 3MGRA 2YFVB 4QLCA 5CPIA 3AZLD 4H9NA 2NZDA 3KUYD 1P34C 5BT1D 5CP6C 5BO0B 3AZFA 3AZHD 3B6FD 3A6NB 5AVBA 5CPKC 2LY8A 2HIOC 2CWEA 5AY8A 5FUGB 3KUYB 1P34D 5CP6D 1P3LC 3LZ1C 1F66C 3AZMB 5CPKD 3MNNB 3MGSB 2NQBA 4ZUXB 3AYWC 1EQZB 5KDMB 2HIOD 5BS7C 1KX3A 1P3IA 3WTPE 1P3LD 4WV4B 3LZ1D 5CPIC 1F66D 5GT3A 3AFAA 3AYWD 1KX4B 4KGCA 1P3PB 3RELC 3LZ0A 4YM6A 3AN2B 3UTBA 5E5AA 2YFWB 5JRGB 5CPID 3WTPA 5JA4B 3B6GB 3RELD 5CPJC 1U35B 3AZNB 3MGRB 4H9QA 5B33C 4QLCB 4Z5TA 3C1BA 5F99C 4H9NB 2NZDB 1P3BA 3AZFB 4XUJA 5CPJD 5B0YA 4XZQA 5AVBB 3NQJB 5B33D 5AV6C 5AV9A 4DRAA 5F99D 4KGCC 5C3IB 5AY8B 5B2JC 5B1MC 1P3KB 3X1SB 3X1UA 3WA9A 2NQBB 5AV6D 4M6BA 4WU9A 3W97B 4KGCD 1KX3B 5AV8C 3MVDA 1P3IB 3REJC 5B2JD 5B1MD 5BNVA 3C1BC 5GT3B 3AFAB 5B40C 4R8PA 4KGCB 5AV8D 2HUEC 4XUJC 4G92C 3LZ0B 5GT0C 4YM6B 3REJD 3UTBB 3VH5T 1M19C 5E5AB 4E44A 4NE5A 3C1BD 3WTPB 3W99C 5B40D 1P3GA 3V9RA 1P3MC 4J8UA 3R45A 5DNMA 1P3OC 4XUJD 3WKJC 3X1UC 5GT0D 1HQ3A 3WA9C 1M19D 4H9QB 3WAAC 4JJNC 3AZLA 4Z5TB 4J8XB 3W96C 4HGAB 3W99D 1P3MD 1P3BB 4H9SC 1P3OD 2CV5C 3AZHA 3B6FA 3WKJD 3X1UD 4KUDA 5B0YB 4XZQB 4X23C 3WA9D 3X1VC 3WAAD 5AV9B 4JJND 3W96D 1ULYA 1P34A 5CP6A 1KX5B 2CV5D 3REIC 3X1TC 5B32C 5CPKA 4X23D 1H3OA 3X1VD 4WU9B 2HIOA 2IO5C 2L5AA 4J8WC 3MVDB 1TZYB 1M1AC 5BNVB 5AVCA 3REKA 3REID 3X1TD 5B32D 3LZ1A 1F66A 5GXQA 3AYWA 4R8PB 1P3FC 2F8NA 5BS7A 4EO5C 4KUDC 1M1AD 3UTAB 2PYOA 5B24B 1P3GB 3V9RB 1P3FD 3MGPB 4J8UB 3R45B 5DNMB 3RELA 1JFIA 4KUDD 1HQ3B 3AZLB 3NQUA 5AVCC 3REKC 5CPJA 3AZHB 3B6FB 3MGQC 5GXQC 4KHAA 1BFMA 5B33A 1BH9A 5F99A 1P34B 5CP6B 5GSUA 5AVCD 3REKD 1ZLAC 2PYOC 3MGQD 5GXQD 1A7WA 5CPKB 1ID3C 1H3OB 4J8VA 1P3AC 5AV6A 4LD9C 4H9RA 2HIOB 2F8ND 3VH5A 1M18C 5B2JA 5B1MA 1P3LB 5AVCB 3REKB 3LZ1B 1ZLAD 1F66B 2FJ7C 5B2IA 2PYOD 5GXQB 1ID3D 3W98C 1P3AD 3AYWB 4LD9D 4ZBJC 5DNNC 5B24C 5AV8A 1M18D 3REJA 2FJ7D 5CPIB 3W98D 5B40A 3KWQC 4YS3C 5DNND 5GSUC 3RELB 3AZKC 1JFIB 5GT0A 3C1CA 4J8VC 1M19A 4Z66C 2F8NH 5B1LC 3AZEC 4NFTA 3VH6T 3KWQD 3W99A 1P3MA 4YS3D 4Z2MH 3NQUB 1P3OA 5GSUD 3WKJA 3AZKD 5CPJB 5B2IC 5B32G 4J8VD 4Z66D 5B33B 3WAAA 1BH9B 4JJNA 3LJAC 5B1LD 3W96A 5F99B 3AZED 3O62A 4H9SA 5CHLB 2CV5A 1AOIA 3UT9C 4H9PA 4UUZA 5B2ID 4X23A 1S32C 5AV6B 3X1VA 4CSRA 3LJAD 4WU8C 4AWLC 1HTAA 3LELC 5B2JB 3UT9D 3C1CC 5B1MB 3AZGC 3REIA 3X1TA 5B32A 5AV5C 4NE6A 1S32D 4J8WA 4WU8D 5AV8B 5B31C 4E45A 3REJB 3LELD 3AZGD 1M1AA 3C1CD 3AZIC 5AV5D 3C1BB 5B40B 3KXBC 3O62C 1P3FA 1AOIC 2HUEB 5B31D 4XUJB 4G92B 3TU4C 5GT0B 3AV2C 4WNNA 1M19B 2AROC 3W99B 3KXBD 3REHC 3O62D 1P3MB 2F8NG 2BYMA 1AOID 1P3OB 3AZJC 3WKJB 3B0DC 3X1UB 3TU4D 3AV2D 4Z2MG 3WA9B 3WAAB 2AROD 4JJNB 3W96B 3REHD 1AOIB 2CV5B 3AZJD 1R4VA 3AV1C 3MGQA 4X23B 3AZMA 2F8NK 3MGSA 4ZUXA 3X1VB 4CSRB 4J8WD 5B0ZC 3AV1D 3REIB 3X1TB 5B32B 1ZLAA 1ID3A 1P3AA 4LD9A 3KSYA 2IO5B 5B0ZD 4J8WB 1KX4A 1M18A 3A6NC 1M1AB 3VH6A 2FJ7A 5JRGA 3W98A 5BNXA 5DNNA 1P3FB 3B6GA 3KUYC 4EO5B 4KUDB 3A6ND 4WNNB 3AZMC 3MNNC 3MGSC 4ZUXC 1EQZC 3KWQA 2BYKA 4YS3A 2BYMB 3AZKA 3AZMD 4Z66A 3NQJA 3MNND 3MGSD 4ZUXD 1EQZD 5B1LA 5G49A 3AZEA 1KX4C 1P3PC 3B0CW 3AN2C 1P3KA 3X1SA 5JRGC 3MGQB 3B6GC 3LJAA 2F8NB 3W97A 1KX4D 1P3PD 3UT9A 5B31G 3AN2D 1U35C 3AZNC 3MGRC 1ZLAB 5JRGD 2PYOB 4QLCC 1ID3B 1S32A 1P3AB 4LD9B 1N1JA 3B6GD 2NZDC 2RVQC 4WU8A 3AZFC 1M18B 3LELA 3AZGA 5AVBC 1U35D 3AZND 3MGRD 5AV5A 2FJ7B 3W98B 1B6WA 5BNXB 4QLCD 5C3IC 4ZBJB 5AY8C 5DNNB 2NZDD 2RVQD 5B31A 1P3KC 3AZFD 3X1SC 1TAFA 4KHAB 5AVBD 3AZIA 2NQBC 3B0BA 1KU5A 3KWQB 3KXBA 4J8XA 3W97C 2BYKB 5AY8D 4YS3B 4G91C 1P3IC 1KX3C 5GSUB 3AZKB 1P3KD 3X1SD 3TU4A 3AV2A 4J8VB 5GT3C 4CAYA 4Z66B 3AFAC 2NQBD 2AROA 4H9RB 5B1LB 5G49B 3AZEB 4DRBA 3W97D 3REHA 1KX3D 1P3ID 3LZ0C 4YM6C 3AZJA 1KX5A 3UTBC 5E5AC 5B2IB 5GT3D 3WTPC 3AFAD 1WWIA 3LJAB 1BH8A 4G91B 3LZ0D 1TZYA 4YM6D 3UT9B 3UTBD 3AV1A 4H9OA 5E5AD 4Z5TC 1S32B 4J8XC 4HGAC 3WTPD 1N1JB 4WZSB 1P3BC 5B0ZA 4WU8B 4AWLB 3LELB 3AZGB 5B0YC 4XZQC 3C1CB 2YFVA 3AZID 5AV5B 3UTAA 5AV9C 4Z5TD 5B24A 4J8XD 3MGPA 1P3BD 5BO0A 1KX5C 5B31B 1TAFB 3A6NA 5B0YD 4XZQD 3AZIB 5AV9D 4WU9C 3KXBB 3O62B 3MVDC 1B67A 5FUGA 3KUYA 1TZYC 1KX5D 3VH6W 4H9PB 4UUZB 3TU4B 3AV2B 3MNNA 4CAYB 1EQZA 3B0CT 4R8PC 2AROB 5KDMA 4WU9D 3REHB 3MVDD 1TZYD 3AZJB 1Q9CA 3B0DB 3UTAC 4NE3A
chains in the Genus database with same CATH superfamily
1P3GC 4R8PD 2DF4C 2JSSA 3MGPC 4J8UC 5DNMC 1P3PA 1BH8B 3H0LC 3AN2A 1HQ3C 3AV1B 2YFWA 4H9OB 1P3LA 3UTAD 5B24D 3AZLC 3VH5W 5JA4A 1WWSA 1P3GD 3MGPD 4J8UD 5BT1C 5DNMD 5B0ZB 3EPKA 1F1EA 3AZHC 3B6FC 1HQ3D 1U35A 3AZNA 2Y2GA 3MGRA 2YFVB 4QLCA 5CPIA 3AZLD 4H9NA 2NZDA 3KUYD 1P34C 5BT1D 5CP6C 5BO0B 3EPJA 3AZFA 3AZHD 3B6FD 3A6NB 5AVBA 5CPKC 2LY8A 2HIOC 2CWEA 5AY8A 5FUGB 3KUYB 1P34D 5CP6D 1P3LC 3LZ1C 1F66C 3AZMB 5CPKD 3MNNB 3MGSB 2NQBA 4ZUXB 3AYWC 1EQZB 5KDMB 2HIOD 5BS7C 1KX3A 1P3IA 4WJ3C 3WTPE 1P3LD 4WV4B 3LZ1D 5CPIC 1F66D 5GT3A 3AFAA 3AYWD 1KX4B 4KGCA 1P3PB 3RELC 3LZ0A 4YM6A 3H0MC 3UTBA 3AN2B 5E5AA 2YFWB 5JRGB 5CPID 3WTPA 2DQNC 5JA4B 3B6GB 3RELD 5CPJC 2XD1A 1U35B 3AZNB 3MGRB 4H9QA 5B33C 3EPLA 4QLCB 4Z5TA 3C1BA 5F99C 4H9NB 2NZDB 1P3BA 3AZFB 4XUJA 5CPJD 5B0YA 4XZQA 5AVBB 3NQJB 5B33D 5AV6C 5AV9A 4DRAA 5F99D 4KGCC 5C3IB 5AY8B 5B2JC 5B1MC 1P3KB 3X1SB 3IP4C 3X1UA 3WA9A 2NQBB 5AV6D 4M6BA 4WU9A 3W97B 4KGCD 1KX3B 5AV8C 3MVDA 1P3IB 3REJC 2ZY2A 5B2JD 5B1MD 5BNVA 3C1BC 5GT3B 2UWXA 3AFAB 5B40C 4R8PA 3A1IA 2W8SA 4KGCB 5AV8D 2HUEC 4XUJC 4G92C 2JCHA 3LZ0B 5GT0C 4YM6B 1PZRA 3REJD 3UTBB 3P5JB 3VH5T 1M19C 5E5AB 4E44A 4NE5A 3C1BD 3WTPB 3W99C 5B40D 1P3GA 3V9RA 1P3MC 4J8UA 3R45A 5DNMA 1P3OC 4XUJD 3WKJC 3EG5B 3X1UC 5GT0D 1HQ3A 3WA9C 1M19D 4H9QB 3WAAC 4JJNC 3AZLA 4Z5TB 2JE5A 4J8XB 3W96C 4HGAB 3W99D 1P3MD 1P3BB 4H9SC 1P3OD 2CV5C 3AZHA 3B6FA 3WKJD 3X1UD 4KUDA 5B0YB 4XZQB 4X23C 3WA9D 3X1VC 3WAAD 5AV9B 4JJND 3W96D 1ULYA 1P34A 2Y2HA 5CP6A 1KX5B 2CV5D 3REIC 3X1TC 5B32C 5CPKA 4X23D 1H3OA 3X1VD 2VQRA 4WU9B 2HIOA 2IO5C 2L5AA 4J8WC 3MVDB 1TZYB 1M1AC 5BNVB 2G5HC 5AVCA 3REID 3X1TD 5B32D 3LZ1A 3REKA 2J8PA 1F66A 5GXQA 3AYWA 4R8PB 1P3FC 2F8NA 5BS7A 4EO5C 4KUDC 1M1AD 3UTAB 2PYOA 5B24B 1P3GB 3V9RB 1P3FD 3MGPB 4J8UB 3R45B 5DNMB 3RELA 1JFIA 4KUDD 1HQ3B 3AZLB 3NQUA 5AVCC 3REKC 5CPJA 3AZHB 3B6FB 3MGQC 5GXQC 4KHAA 1BFMA 5B33A 1BH9A 5F99A 1P34B 5CP6B 5GSUA 5AVCD 3REKD 1ZLAC 2PYOC 3MGQD 5GXQD 1A7WA 5CPKB 1ID3C 1H3OB 4J8VA 1P3AC 5AV6A 4LD9C 4H9RA 3A1KA 2HIOB 2F8ND 3VH5A 1M18C 5B2JA 5B1MA 1P3LB 5AVCB 3REKB 3LZ1B 1ZLAD 1F66B 2FJ7C 5B2IA 2PYOD 5GXQB 1ID3D 3W98C 1P3AD 3AYWB 4LD9D 4ZBJC 5DNNC 5B24C 5AV8A 1M18D 3REJA 3H0RC 2FJ7D 5CPIB 3W98D 2BG1A 5B40A 3KWQC 4YS3C 5DNND 5GSUC 2Y2OA 2Y2MA 3RELB 3AZKC 1JFIB 5GT0A 3C1CA 4J8VC 1M19A 4Z66C 2F8NH 5B1LC 3AZEC 4NFTA 3VH6T 3KWQD 3W99A 1P3MA 4YS3D 4Z2MH 3NQUB 1P3OA 5GSUD 3WKJA 3AZKD 2Y2KA 5CPJB 5B2IC 5B32G 4J8VD 4Z66D 5B33B 3WAAA 1BH9B 4JJNA 3LJAC 5B1LD 3W96A 5F99B 3AZED 3O62A 4H9SA 5CHLB 2CV5A 1AOIA 3UT9C 4H9PA 4UUZA 1Z2CB 5B2ID 4X23A 1S32C 2F2AC 5AV6B 3X1VA 4CSRA 3LJAD 4WU8C 4AWLC 1HTAA 3F6TA 5B2JB 3LELC 3C1CC 3FDDA 5B1MB 3UT9D 3REIA 3AZGC 5B32A 3X1TA 5AV5C 4NE6A 2RIQA 1S32D 4J8WA 4WU8D 5AV8B 5B31C 4E45A 3REJB 3LELD 3AZGD 1M1AA 3C1CD 3AZIC 5AV5D 3C1BB 5B40B 3KXBC 3O62C 1P3FA 1AOIC 3AL0C 2HUEB 5B31D 4XUJB 4G92B 3TU4C 5GT0B 3AV2C 4WNNA 1M19B 2AROC 3W99B 3KXBD 3REHC 3O62D 1P3MB 2F8NG 2BYMA 1AOID 1P3OB 3AZJC 3WKJB 3B0DC 3X1UB 3TU4D 3AV2D 4Z2MG 3WA9B 3WAAB 2AROD 4JJNB 3W96B 3REHD 2Y2QA 1AOIB 2CV5B 3AZJD 1R4VA 3AV1C 3MGQA 4X23B 3AZMA 2F8NK 3MGSA 4ZUXA 3X1VB 4CSRB 2ZY4A 4J8WD 5B0ZC 3AV1D 3REIB 3X1TB 5B32B 1ZLAA 1ID3A 1P3AA 4LD9A 3KSYA 2IO5B 5B0ZD 4J8WB 1KX4A 1M18A 3A6NC 1M1AB 3VH6A 2FJ7A 5JRGA 3W98A 5BNXA 5DNNA 1P3FB 3B6GA 4UPKA 3KUYC 2Y2JA 4EO5B 4KUDB 3A6ND 4WNNB 2ZY3A 3AZMC 3MNNC 3MGSC 4ZUXC 1EQZC 2FFFB 3KWQA 2BYKA 4YS3A 2Y2NA 2Y2IA 2BYMB 3AZKA 3AZMD 4Z66A 3NQJA 3MNND 3MGSD 4ZUXD 1EQZD 5B1LA 5G49A 3AZEA 1KX4C 1W2EA 1P3PC 3B0CW 3AN2C 1P3KA 3X1SA 5JRGC 3MGQB 3B6GC 2ZY5A 3LJAA 2F8NB 3W97A 1KX4D 1P3PD 3UT9A 5B31G 3AN2D 1U35C 3AZNC 3MGRC 1ZLAB 5JRGD 2PYOB 4QLCC 1ID3B 1S32A 1P3AB 3KFUG 4LD9B 1N1JA 3B6GD 2NZDC 2RVQC 4WU8A 3AZFC 1M18B 3LELA 3AZGA 5AVBC 1U35D 3AZND 3MGRD 5AV5A 2FJ7B 3W98B 1B6WA 5BNXB 4QLCD 5C3IC 4ZBJB 5AY8C 5DNNB 2NZDD 2RVQD 5B31A 1P3KC 3AZFD 3X1SC 1TAFA 4KHAB 5AVBD 3AZIA 2NQBC 3B0BA 1KU5A 3KWQB 3KXBA 4J8XA 3W97C 2BYKB 5AY8D 4YS3B 4G91C 1P3IC 1KX3C 5GSUB 3AZKB 1P3KD 3X1SD 3TU4A 3AV2A 2Y2LA 4J8VB 5GT3C 4CAYA 2G5IC 4Z66B 3AFAC 2NQBD 2AROA 4H9RB 5B1LB 5G49B 3AZEB 4DRBA 3W97D 3REHA 1KX3D 1P3ID 3LZ0C 4YM6C 3AZJA 1T3UA 3UTBC 1KX5A 5E5AC 4DQYB 5B2IB 5GT3D 3WTPC 3AFAD 1WWIA 3LJAB 1BH8A 4G91B 3LZ0D 1TZYA 4YM6D 3UT9B 3UTBD 3AV1A 4H9OA 5E5AD 4Z5TC 1S32B 4J8XC 4HGAC 3WTPD 1N1JB 4WZSB 1P3BC 5B0ZA 4WU8B 4AWLB 2Y2PA 3LELB 3AZGB 5B0YC 4XZQC 3C1CB 2ZM5A 2YFVA 3AZID 5AV5B 3UTAA 5AV9C 4Z5TD 5B24A 4J8XD 3MGPA 1P3BD 5BO0A 1KX5C 3EPHA 5B31B 1TAFB 3A6NA 5B0YD 4XZQD 3AZIB 5AV9D 4WU9C 3KXBB 3O62B 3MVDC 1B67A 5FUGA 3KUYA 1TZYC 1KX5D 3VH6W 4H9PB 4UUZB 2XD5A 3TU4B 3AV2B 3MNNA 4CAYB 1EQZA 3B0CT 4R8PC 2AROB 5KDMA 4WU9D 3REHB 3MVDD 1TZYD 3AZJB 1Q9CA 3B0DB 3UTAC 4NE3A
chains in the Genus database with same CATH topology
1P3GC 4R8PD 2DF4C 2JSSA 3MGPC 4J8UC 5DNMC 1P3PA 1BH8B 3H0LC 3AN2A 1HQ3C 3AV1B 2YFWA 4H9OB 1P3LA 3UTAD 5B24D 3AZLC 3VH5W 5JA4A 1WWSA 1P3GD 3MGPD 4J8UD 5BT1C 5DNMD 5B0ZB 3EPKA 1F1EA 3AZHC 3B6FC 1HQ3D 1U35A 3AZNA 2Y2GA 3MGRA 2YFVB 4QLCA 5CPIA 3AZLD 4H9NA 2NZDA 3KUYD 1P34C 5BT1D 5CP6C 5BO0B 3EPJA 3AZFA 3AZHD 3B6FD 3A6NB 5AVBA 5CPKC 2LY8A 2HIOC 2CWEA 5AY8A 5FUGB 3KUYB 1P34D 5CP6D 1P3LC 3LZ1C 1F66C 3AZMB 5CPKD 3MNNB 3MGSB 2NQBA 4ZUXB 3AYWC 1EQZB 5KDMB 2HIOD 5BS7C 1KX3A 1P3IA 4WJ3C 3WTPE 1P3LD 4WV4B 3LZ1D 5CPIC 1F66D 5GT3A 3AFAA 3AYWD 1KX4B 4KGCA 1P3PB 3RELC 3LZ0A 4YM6A 3H0MC 3UTBA 3AN2B 5E5AA 2YFWB 5JRGB 5CPID 3WTPA 2DQNC 5JA4B 3B6GB 3RELD 5CPJC 2XD1A 1U35B 3AZNB 3MGRB 4H9QA 5B33C 3EPLA 4QLCB 4Z5TA 3C1BA 5F99C 4H9NB 2NZDB 1P3BA 3AZFB 4XUJA 5CPJD 5B0YA 4XZQA 5AVBB 3NQJB 5B33D 5AV6C 5AV9A 4DRAA 5F99D 4KGCC 5C3IB 5AY8B 5B2JC 5B1MC 1P3KB 3X1SB 3IP4C 3X1UA 3WA9A 2NQBB 5AV6D 4M6BA 4WU9A 3W97B 4KGCD 1KX3B 5AV8C 3MVDA 1P3IB 3REJC 2ZY2A 5B2JD 5B1MD 5BNVA 3C1BC 5GT3B 2UWXA 3AFAB 5B40C 4R8PA 3A1IA 2W8SA 4KGCB 5AV8D 2HUEC 4XUJC 4G92C 2JCHA 3LZ0B 5GT0C 4YM6B 1PZRA 3REJD 3UTBB 3P5JB 3VH5T 1M19C 5E5AB 4E44A 4NE5A 3C1BD 3WTPB 3W99C 5B40D 1P3GA 3V9RA 1P3MC 4J8UA 3R45A 5DNMA 1P3OC 4XUJD 3WKJC 3EG5B 3X1UC 5GT0D 1HQ3A 3WA9C 1M19D 4H9QB 3WAAC 4JJNC 3AZLA 4Z5TB 2JE5A 4J8XB 3W96C 4HGAB 3W99D 1P3MD 1P3BB 4H9SC 1P3OD 2CV5C 3AZHA 3B6FA 3WKJD 3X1UD 4KUDA 5B0YB 4XZQB 4X23C 3WA9D 3X1VC 3WAAD 5AV9B 4JJND 3W96D 1ULYA 1P34A 2Y2HA 5CP6A 1KX5B 2CV5D 3REIC 3X1TC 5B32C 5CPKA 4X23D 1H3OA 3X1VD 2VQRA 4WU9B 2HIOA 2IO5C 2L5AA 4J8WC 3MVDB 1TZYB 1M1AC 5BNVB 2G5HC 5AVCA 3REID 3X1TD 5B32D 3LZ1A 3REKA 2J8PA 1F66A 5GXQA 3AYWA 4R8PB 1P3FC 2F8NA 5BS7A 4EO5C 4KUDC 1M1AD 3UTAB 2PYOA 5B24B 1P3GB 3V9RB 1P3FD 3MGPB 4J8UB 3R45B 5DNMB 3RELA 1JFIA 4KUDD 1HQ3B 3AZLB 3NQUA 5AVCC 3REKC 5CPJA 3AZHB 3B6FB 3MGQC 5GXQC 4KHAA 1BFMA 5B33A 1BH9A 5F99A 1P34B 5CP6B 5GSUA 5AVCD 3REKD 1ZLAC 2PYOC 3MGQD 5GXQD 1A7WA 5CPKB 1ID3C 1H3OB 4J8VA 1P3AC 5AV6A 4LD9C 4H9RA 3A1KA 2HIOB 2F8ND 3VH5A 1M18C 5B2JA 5B1MA 1P3LB 5AVCB 3REKB 3LZ1B 1ZLAD 1F66B 2FJ7C 5B2IA 2PYOD 5GXQB 1ID3D 3W98C 1P3AD 3AYWB 4LD9D 4ZBJC 5DNNC 5B24C 5AV8A 1M18D 3REJA 3H0RC 2FJ7D 5CPIB 3W98D 2BG1A 5B40A 3KWQC 4YS3C 5DNND 5GSUC 2Y2OA 2Y2MA 3RELB 3AZKC 1JFIB 5GT0A 3C1CA 4J8VC 1M19A 4Z66C 2F8NH 5B1LC 3AZEC 4NFTA 3VH6T 3KWQD 3W99A 1P3MA 4YS3D 4Z2MH 3NQUB 1P3OA 5GSUD 3WKJA 3AZKD 2Y2KA 5CPJB 5B2IC 5B32G 4J8VD 4Z66D 5B33B 3WAAA 1BH9B 4JJNA 3LJAC 5B1LD 3W96A 5F99B 3AZED 3O62A 4H9SA 5CHLB 2CV5A 1AOIA 3UT9C 4H9PA 4UUZA 1Z2CB 5B2ID 4X23A 1S32C 2F2AC 5AV6B 3X1VA 4CSRA 3LJAD 4WU8C 4AWLC 1HTAA 3F6TA 5B2JB 3LELC 3C1CC 3FDDA 5B1MB 3UT9D 3REIA 3AZGC 5B32A 3X1TA 5AV5C 4NE6A 2RIQA 1S32D 4J8WA 4WU8D 5AV8B 5B31C 4E45A 3REJB 3LELD 3AZGD 1M1AA 3C1CD 3AZIC 5AV5D 3C1BB 5B40B 3KXBC 3O62C 1P3FA 1AOIC 3AL0C 2HUEB 5B31D 4XUJB 4G92B 3TU4C 5GT0B 3AV2C 4WNNA 1M19B 2AROC 3W99B 3KXBD 3REHC 3O62D 1P3MB 2F8NG 2BYMA 1AOID 1P3OB 3AZJC 3WKJB 3B0DC 3X1UB 3TU4D 3AV2D 4Z2MG 3WA9B 3WAAB 2AROD 4JJNB 3W96B 3REHD 2Y2QA 1AOIB 2CV5B 3AZJD 1R4VA 3AV1C 3MGQA 4X23B 3AZMA 2F8NK 3MGSA 4ZUXA 3X1VB 4CSRB 2ZY4A 4J8WD 5B0ZC 3AV1D 3REIB 3X1TB 5B32B 1ZLAA 1ID3A 1P3AA 4LD9A 3KSYA 2IO5B 5B0ZD 4J8WB 1KX4A 1M18A 3A6NC 1M1AB 3VH6A 2FJ7A 5JRGA 3W98A 5BNXA 5DNNA 1P3FB 3B6GA 4UPKA 3KUYC 2Y2JA 4EO5B 4KUDB 3A6ND 4WNNB 2ZY3A 3AZMC 3MNNC 3MGSC 4ZUXC 1EQZC 2FFFB 3KWQA 2BYKA 4YS3A 2Y2NA 2Y2IA 2BYMB 3AZKA 3AZMD 4Z66A 3NQJA 3MNND 3MGSD 4ZUXD 1EQZD 5B1LA 5G49A 3AZEA 1KX4C 1W2EA 1P3PC 3B0CW 3AN2C 1P3KA 3X1SA 5JRGC 3MGQB 3B6GC 2ZY5A 3LJAA 2F8NB 3W97A 1KX4D 1P3PD 3UT9A 5B31G 3AN2D 1U35C 3AZNC 3MGRC 1ZLAB 5JRGD 2PYOB 4QLCC 1ID3B 1S32A 1P3AB 3KFUG 4LD9B 1N1JA 3B6GD 2NZDC 2RVQC 4WU8A 3AZFC 1M18B 3LELA 3AZGA 5AVBC 1U35D 3AZND 3MGRD 5AV5A 2FJ7B 3W98B 1B6WA 5BNXB 4QLCD 5C3IC 4ZBJB 5AY8C 5DNNB 2NZDD 2RVQD 5B31A 1P3KC 3AZFD 3X1SC 1TAFA 4KHAB 5AVBD 3AZIA 2NQBC 3B0BA 1KU5A 3KWQB 3KXBA 4J8XA 3W97C 2BYKB 5AY8D 4YS3B 4G91C 1P3IC 1KX3C 5GSUB 3AZKB 1P3KD 3X1SD 3TU4A 3AV2A 2Y2LA 4J8VB 5GT3C 4CAYA 2G5IC 4Z66B 3AFAC 2NQBD 2AROA 4H9RB 5B1LB 5G49B 3AZEB 4DRBA 3W97D 3REHA 1KX3D 1P3ID 3LZ0C 4YM6C 3AZJA 1T3UA 3UTBC 1KX5A 5E5AC 4DQYB 5B2IB 5GT3D 3WTPC 3AFAD 1WWIA 3LJAB 1BH8A 4G91B 3LZ0D 1TZYA 4YM6D 3UT9B 3UTBD 3AV1A 4H9OA 5E5AD 4Z5TC 1S32B 4J8XC 4HGAC 3WTPD 1N1JB 4WZSB 1P3BC 5B0ZA 4WU8B 4AWLB 2Y2PA 3LELB 3AZGB 5B0YC 4XZQC 3C1CB 2ZM5A 2YFVA 3AZID 5AV5B 3UTAA 5AV9C 4Z5TD 5B24A 4J8XD 3MGPA 1P3BD 5BO0A 1KX5C 3EPHA 5B31B 1TAFB 3A6NA 5B0YD 4XZQD 3AZIB 5AV9D 4WU9C 3KXBB 3O62B 3MVDC 1B67A 5FUGA 3KUYA 1TZYC 1KX5D 3VH6W 4H9PB 4UUZB 2XD5A 3TU4B 3AV2B 3MNNA 4CAYB 1EQZA 3B0CT 4R8PC 2AROB 5KDMA 4WU9D 3REHB 3MVDD 1TZYD 3AZJB 1Q9CA 3B0DB 3UTAC 4NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3G C;  4R8P D;  2JSS A;  3MGP C;  4J8U C;  5DNM C;  1P3P A;  1BH8 B;  3AN2 A;  1HQ3 C;  3AV1 B;  2YFW A;  4H9O B;  1P3L A;  3UTA D;  5B24 D;  3AZL C;  3VH5 W;  5JA4 A;  1WWS A;  1P3G D;  3MGP D;  4J8U D;  5BT1 C;  5DNM D;  5B0Z B;  1F1E A;  3AZH C;  3B6F C;  1HQ3 D;  1U35 A;  3AZN A;  3MGR A;  2YFV B;  4QLC A;  5CPI A;  3AZL D;  4H9N A;  2NZD A;  3KUY D;  1P34 C;  5BT1 D;  5CP6 C;  5BO0 B;  3AZF A;  3AZH D;  3B6F D;  3A6N B;  5AVB A;  5CPK C;  2LY8 A;  2HIO C;  2CWE A;  5AY8 A;  5FUG B;  3KUY B;  1P34 D;  5CP6 D;  1P3L C;  3LZ1 C;  1F66 C;  3AZM B;  5CPK D;  3MNN B;  3MGS B;  2NQB A;  4ZUX B;  3AYW C;  1EQZ B;  5KDM B;  2HIO D;  5BS7 C;  1KX3 A;  1P3I A;  3WTP E;  1P3L D;  4WV4 B;  3LZ1 D;  5CPI C;  1F66 D;  5GT3 A;  3AFA A;  3AYW D;  1KX4 B;  4KGC A;  1P3P B;  3REL C;  3LZ0 A;  4YM6 A;  3AN2 B;  3UTB A;  5E5A A;  2YFW B;  5JRG B;  5CPI D;  3WTP A;  5JA4 B;  3B6G B;  3REL D;  5CPJ C;  1U35 B;  3AZN B;  3MGR B;  4H9Q A;  5B33 C;  4QLC B;  4Z5T A;  3C1B A;  5F99 C;  4H9N B;  2NZD B;  1P3B A;  3AZF B;  4XUJ A;  5CPJ D;  5B0Y A;  4XZQ A;  5AVB B;  3NQJ B;  5B33 D;  5AV6 C;  5AV9 A;  4DRA A;  5F99 D;  4KGC C;  5C3I B;  5AY8 B;  5B2J C;  5B1M C;  1P3K B;  3X1S B;  3X1U A;  3WA9 A;  2NQB B;  5AV6 D;  4M6B A;  4WU9 A;  3W97 B;  4KGC D;  1KX3 B;  5AV8 C;  3MVD A;  1P3I B;  3REJ C;  5B2J D;  5B1M D;  5BNV A;  3C1B C;  5GT3 B;  3AFA B;  5B40 C;  4R8P A;  4KGC B;  5AV8 D;  2HUE C;  4XUJ C;  4G92 C;  3LZ0 B;  5GT0 C;  4YM6 B;  3REJ D;  3UTB B;  3VH5 T;  1M19 C;  5E5A B;  4E44 A;  4NE5 A;  3C1B D;  3WTP B;  3W99 C;  5B40 D;  1P3G A;  3V9R A;  1P3M C;  4J8U A;  3R45 A;  5DNM A;  1P3O C;  4XUJ D;  3WKJ C;  3X1U C;  5GT0 D;  1HQ3 A;  3WA9 C;  1M19 D;  4H9Q B;  3WAA C;  4JJN C;  3AZL A;  4Z5T B;  4J8X B;  3W96 C;  4HGA B;  3W99 D;  1P3M D;  1P3B B;  4H9S C;  1P3O D;  2CV5 C;  3AZH A;  3B6F A;  3WKJ D;  3X1U D;  4KUD A;  5B0Y B;  4XZQ B;  4X23 C;  3WA9 D;  3X1V C;  3WAA D;  5AV9 B;  4JJN D;  3W96 D;  1ULY A;  1P34 A;  5CP6 A;  1KX5 B;  2CV5 D;  3REI C;  3X1T C;  5B32 C;  5CPK A;  4X23 D;  1H3O A;  3X1V D;  4WU9 B;  2HIO A;  2IO5 C;  2L5A A;  4J8W C;  3MVD B;  1TZY B;  1M1A C;  5BNV B;  5AVC A;  3REK A;  3REI D;  3X1T D;  5B32 D;  3LZ1 A;  1F66 A;  5GXQ A;  3AYW A;  4R8P B;  1P3F C;  2F8N A;  5BS7 A;  4EO5 C;  4KUD C;  1M1A D;  3UTA B;  2PYO A;  5B24 B;  1P3G B;  3V9R B;  1P3F D;  3MGP B;  4J8U B;  3R45 B;  5DNM B;  3REL A;  1JFI A;  4KUD D;  1HQ3 B;  3AZL B;  3NQU A;  5AVC C;  3REK C;  5CPJ A;  3AZH B;  3B6F B;  3MGQ C;  5GXQ C;  4KHA A;  1BFM A;  5B33 A;  1BH9 A;  5F99 A;  1P34 B;  5CP6 B;  5GSU A;  5AVC D;  3REK D;  1ZLA C;  2PYO C;  3MGQ D;  5GXQ D;  1A7W A;  5CPK B;  1ID3 C;  1H3O B;  4J8V A;  1P3A C;  5AV6 A;  4LD9 C;  4H9R A;  2HIO B;  2F8N D;  3VH5 A;  1M18 C;  5B2J A;  5B1M A;  1P3L B;  5AVC B;  3REK B;  3LZ1 B;  1ZLA D;  1F66 B;  2FJ7 C;  5B2I A;  2PYO D;  5GXQ B;  1ID3 D;  3W98 C;  1P3A D;  3AYW B;  4LD9 D;  4ZBJ C;  5DNN C;  5B24 C;  5AV8 A;  1M18 D;  3REJ A;  2FJ7 D;  5CPI B;  3W98 D;  5B40 A;  3KWQ C;  4YS3 C;  5DNN D;  5GSU C;  3REL B;  3AZK C;  1JFI B;  5GT0 A;  3C1C A;  4J8V C;  1M19 A;  4Z66 C;  2F8N H;  5B1L C;  3AZE C;  4NFT A;  3VH6 T;  3KWQ D;  3W99 A;  1P3M A;  4YS3 D;  4Z2M H;  3NQU B;  1P3O A;  5GSU D;  3WKJ A;  3AZK D;  5CPJ B;  5B2I C;  5B32 G;  4J8V D;  4Z66 D;  5B33 B;  3WAA A;  1BH9 B;  4JJN A;  3LJA C;  5B1L D;  3W96 A;  5F99 B;  3AZE D;  3O62 A;  4H9S A;  5CHL B;  2CV5 A;  1AOI A;  3UT9 C;  4H9P A;  4UUZ A;  5B2I D;  4X23 A;  1S32 C;  5AV6 B;  3X1V A;  4CSR A;  3LJA D;  4WU8 C;  4AWL C;  1HTA A;  3LEL C;  5B2J B;  3UT9 D;  3C1C C;  5B1M B;  3AZG C;  3REI A;  3X1T A;  5B32 A;  5AV5 C;  4NE6 A;  1S32 D;  4J8W A;  4WU8 D;  5AV8 B;  5B31 C;  4E45 A;  3REJ B;  3LEL D;  3AZG D;  1M1A A;  3C1C D;  3AZI C;  5AV5 D;  3C1B B;  5B40 B;  3KXB C;  3O62 C;  1P3F A;  1AOI C;  2HUE B;  5B31 D;  4XUJ B;  4G92 B;  3TU4 C;  5GT0 B;  3AV2 C;  4WNN A;  1M19 B;  2ARO C;  3W99 B;  3KXB D;  3REH C;  3O62 D;  1P3M B;  2F8N G;  2BYM A;  1AOI D;  1P3O B;  3AZJ C;  3WKJ B;  3B0D C;  3X1U B;  3TU4 D;  3AV2 D;  4Z2M G;  3WA9 B;  3WAA B;  2ARO D;  4JJN B;  3W96 B;  3REH D;  1AOI B;  2CV5 B;  3AZJ D;  1R4V A;  3AV1 C;  3MGQ A;  4X23 B;  3AZM A;  2F8N K;  3MGS A;  4ZUX A;  3X1V B;  4CSR B;  4J8W D;  5B0Z C;  3AV1 D;  3REI B;  3X1T B;  5B32 B;  1ZLA A;  1ID3 A;  1P3A A;  4LD9 A;  3KSY A;  2IO5 B;  5B0Z D;  4J8W B;  1KX4 A;  1M18 A;  3A6N C;  1M1A B;  3VH6 A;  2FJ7 A;  5JRG A;  3W98 A;  5BNX A;  5DNN A;  1P3F B;  3B6G A;  3KUY C;  4EO5 B;  4KUD B;  3A6N D;  4WNN B;  3AZM C;  3MNN C;  3MGS C;  4ZUX C;  1EQZ C;  3KWQ A;  2BYK A;  4YS3 A;  2BYM B;  3AZK A;  3AZM D;  4Z66 A;  3NQJ A;  3MNN D;  3MGS D;  4ZUX D;  1EQZ D;  5B1L A;  5G49 A;  3AZE A;  1KX4 C;  1P3P C;  3B0C W;  3AN2 C;  1P3K A;  3X1S A;  5JRG C;  3MGQ B;  3B6G C;  3LJA A;  2F8N B;  3W97 A;  1KX4 D;  1P3P D;  3UT9 A;  5B31 G;  3AN2 D;  1U35 C;  3AZN C;  3MGR C;  1ZLA B;  5JRG D;  2PYO B;  4QLC C;  1ID3 B;  1S32 A;  1P3A B;  4LD9 B;  1N1J A;  3B6G D;  2NZD C;  2RVQ C;  4WU8 A;  3AZF C;  1M18 B;  3LEL A;  3AZG A;  5AVB C;  1U35 D;  3AZN D;  3MGR D;  5AV5 A;  2FJ7 B;  3W98 B;  1B6W A;  5BNX B;  4QLC D;  5C3I C;  4ZBJ B;  5AY8 C;  5DNN B;  2NZD D;  2RVQ D;  5B31 A;  1P3K C;  3AZF D;  3X1S C;  1TAF A;  4KHA B;  5AVB D;  3AZI A;  2NQB C;  3B0B A;  1KU5 A;  3KWQ B;  3KXB A;  4J8X A;  3W97 C;  2BYK B;  5AY8 D;  4YS3 B;  4G91 C;  1P3I C;  1KX3 C;  5GSU B;  3AZK B;  1P3K D;  3X1S D;  3TU4 A;  3AV2 A;  4J8V B;  5GT3 C;  4CAY A;  4Z66 B;  3AFA C;  2NQB D;  2ARO A;  4H9R B;  5B1L B;  5G49 B;  3AZE B;  4DRB A;  3W97 D;  3REH A;  1KX3 D;  1P3I D;  3LZ0 C;  4YM6 C;  3AZJ A;  1KX5 A;  3UTB C;  5E5A C;  5B2I B;  5GT3 D;  3WTP C;  3AFA D;  1WWI A;  3LJA B;  1BH8 A;  4G91 B;  3LZ0 D;  1TZY A;  4YM6 D;  3UT9 B;  3UTB D;  3AV1 A;  4H9O A;  5E5A D;  4Z5T C;  1S32 B;  4J8X C;  4HGA C;  3WTP D;  1N1J B;  4WZS B;  1P3B C;  5B0Z A;  4WU8 B;  4AWL B;  3LEL B;  3AZG B;  5B0Y C;  4XZQ C;  3C1C B;  2YFV A;  3AZI D;  5AV5 B;  3UTA A;  5AV9 C;  4Z5T D;  5B24 A;  4J8X D;  3MGP A;  1P3B D;  5BO0 A;  1KX5 C;  5B31 B;  1TAF B;  3A6N A;  5B0Y D;  4XZQ D;  3AZI B;  5AV9 D;  4WU9 C;  3KXB B;  3O62 B;  3MVD C;  1B67 A;  5FUG A;  3KUY A;  1TZY C;  1KX5 D;  3VH6 W;  4H9P B;  4UUZ B;  3TU4 B;  3AV2 B;  3MNN A;  4CAY B;  1EQZ A;  3B0C T;  4R8P C;  2ARO B;  5KDM A;  4WU9 D;  3REH B;  3MVD D;  1TZY D;  3AZJ B;  1Q9C A;  3B0D B;  3UTA C;  4NE3 A; 
#chains in the Genus database with same CATH topology
 1P3G C;  4R8P D;  2DF4 C;  2JSS A;  3MGP C;  4J8U C;  5DNM C;  1P3P A;  1BH8 B;  3H0L C;  3AN2 A;  1HQ3 C;  3AV1 B;  2YFW A;  4H9O B;  1P3L A;  3UTA D;  5B24 D;  3AZL C;  3VH5 W;  5JA4 A;  1WWS A;  1P3G D;  3MGP D;  4J8U D;  5BT1 C;  5DNM D;  5B0Z B;  3EPK A;  1F1E A;  3AZH C;  3B6F C;  1HQ3 D;  1U35 A;  3AZN A;  2Y2G A;  3MGR A;  2YFV B;  4QLC A;  5CPI A;  3AZL D;  4H9N A;  2NZD A;  3KUY D;  1P34 C;  5BT1 D;  5CP6 C;  5BO0 B;  3EPJ A;  3AZF A;  3AZH D;  3B6F D;  3A6N B;  5AVB A;  5CPK C;  2LY8 A;  2HIO C;  2CWE A;  5AY8 A;  5FUG B;  3KUY B;  1P34 D;  5CP6 D;  1P3L C;  3LZ1 C;  1F66 C;  3AZM B;  5CPK D;  3MNN B;  3MGS B;  2NQB A;  4ZUX B;  3AYW C;  1EQZ B;  5KDM B;  2HIO D;  5BS7 C;  1KX3 A;  1P3I A;  4WJ3 C;  3WTP E;  1P3L D;  4WV4 B;  3LZ1 D;  5CPI C;  1F66 D;  5GT3 A;  3AFA A;  3AYW D;  1KX4 B;  4KGC A;  1P3P B;  3REL C;  3LZ0 A;  4YM6 A;  3H0M C;  3UTB A;  3AN2 B;  5E5A A;  2YFW B;  5JRG B;  5CPI D;  3WTP A;  2DQN C;  5JA4 B;  3B6G B;  3REL D;  5CPJ C;  2XD1 A;  1U35 B;  3AZN B;  3MGR B;  4H9Q A;  5B33 C;  3EPL A;  4QLC B;  4Z5T A;  3C1B A;  5F99 C;  4H9N B;  2NZD B;  1P3B A;  3AZF B;  4XUJ A;  5CPJ D;  5B0Y A;  4XZQ A;  5AVB B;  3NQJ B;  5B33 D;  5AV6 C;  5AV9 A;  4DRA A;  5F99 D;  4KGC C;  5C3I B;  5AY8 B;  5B2J C;  5B1M C;  1P3K B;  3X1S B;  3IP4 C;  3X1U A;  3WA9 A;  2NQB B;  5AV6 D;  4M6B A;  4WU9 A;  3W97 B;  4KGC D;  1KX3 B;  5AV8 C;  3MVD A;  1P3I B;  3REJ C;  2ZY2 A;  5B2J D;  5B1M D;  5BNV A;  3C1B C;  5GT3 B;  2UWX A;  3AFA B;  5B40 C;  4R8P A;  3A1I A;  2W8S A;  4KGC B;  5AV8 D;  2HUE C;  4XUJ C;  4G92 C;  2JCH A;  3LZ0 B;  5GT0 C;  4YM6 B;  1PZR A;  3REJ D;  3UTB B;  3P5J B;  3VH5 T;  1M19 C;  5E5A B;  4E44 A;  4NE5 A;  3C1B D;  3WTP B;  3W99 C;  5B40 D;  1P3G A;  3V9R A;  1P3M C;  4J8U A;  3R45 A;  5DNM A;  1P3O C;  4XUJ D;  3WKJ C;  3EG5 B;  3X1U C;  5GT0 D;  1HQ3 A;  3WA9 C;  1M19 D;  4H9Q B;  3WAA C;  4JJN C;  3AZL A;  4Z5T B;  2JE5 A;  4J8X B;  3W96 C;  4HGA B;  3W99 D;  1P3M D;  1P3B B;  4H9S C;  1P3O D;  2CV5 C;  3AZH A;  3B6F A;  3WKJ D;  3X1U D;  4KUD A;  5B0Y B;  4XZQ B;  4X23 C;  3WA9 D;  3X1V C;  3WAA D;  5AV9 B;  4JJN D;  3W96 D;  1ULY A;  1P34 A;  2Y2H A;  5CP6 A;  1KX5 B;  2CV5 D;  3REI C;  3X1T C;  5B32 C;  5CPK A;  4X23 D;  1H3O A;  3X1V D;  2VQR A;  4WU9 B;  2HIO A;  2IO5 C;  2L5A A;  4J8W C;  3MVD B;  1TZY B;  1M1A C;  5BNV B;  2G5H C;  5AVC A;  3REI D;  3X1T D;  5B32 D;  3LZ1 A;  3REK A;  2J8P A;  1F66 A;  5GXQ A;  3AYW A;  4R8P B;  1P3F C;  2F8N A;  5BS7 A;  4EO5 C;  4KUD C;  1M1A D;  3UTA B;  2PYO A;  5B24 B;  1P3G B;  3V9R B;  1P3F D;  3MGP B;  4J8U B;  3R45 B;  5DNM B;  3REL A;  1JFI A;  4KUD D;  1HQ3 B;  3AZL B;  3NQU A;  5AVC C;  3REK C;  5CPJ A;  3AZH B;  3B6F B;  3MGQ C;  5GXQ C;  4KHA A;  1BFM A;  5B33 A;  1BH9 A;  5F99 A;  1P34 B;  5CP6 B;  5GSU A;  5AVC D;  3REK D;  1ZLA C;  2PYO C;  3MGQ D;  5GXQ D;  1A7W A;  5CPK B;  1ID3 C;  1H3O B;  4J8V A;  1P3A C;  5AV6 A;  4LD9 C;  4H9R A;  3A1K A;  2HIO B;  2F8N D;  3VH5 A;  1M18 C;  5B2J A;  5B1M A;  1P3L B;  5AVC B;  3REK B;  3LZ1 B;  1ZLA D;  1F66 B;  2FJ7 C;  5B2I A;  2PYO D;  5GXQ B;  1ID3 D;  3W98 C;  1P3A D;  3AYW B;  4LD9 D;  4ZBJ C;  5DNN C;  5B24 C;  5AV8 A;  1M18 D;  3REJ A;  3H0R C;  2FJ7 D;  5CPI B;  3W98 D;  2BG1 A;  5B40 A;  3KWQ C;  4YS3 C;  5DNN D;  5GSU C;  2Y2O A;  2Y2M A;  3REL B;  3AZK C;  1JFI B;  5GT0 A;  3C1C A;  4J8V C;  1M19 A;  4Z66 C;  2F8N H;  5B1L C;  3AZE C;  4NFT A;  3VH6 T;  3KWQ D;  3W99 A;  1P3M A;  4YS3 D;  4Z2M H;  3NQU B;  1P3O A;  5GSU D;  3WKJ A;  3AZK D;  2Y2K A;  5CPJ B;  5B2I C;  5B32 G;  4J8V D;  4Z66 D;  5B33 B;  3WAA A;  1BH9 B;  4JJN A;  3LJA C;  5B1L D;  3W96 A;  5F99 B;  3AZE D;  3O62 A;  4H9S A;  5CHL B;  2CV5 A;  1AOI A;  3UT9 C;  4H9P A;  4UUZ A;  1Z2C B;  5B2I D;  4X23 A;  1S32 C;  2F2A C;  5AV6 B;  3X1V A;  4CSR A;  3LJA D;  4WU8 C;  4AWL C;  1HTA A;  3F6T A;  5B2J B;  3LEL C;  3C1C C;  3FDD A;  5B1M B;  3UT9 D;  3REI A;  3AZG C;  5B32 A;  3X1T A;  5AV5 C;  4NE6 A;  2RIQ A;  1S32 D;  4J8W A;  4WU8 D;  5AV8 B;  5B31 C;  4E45 A;  3REJ B;  3LEL D;  3AZG D;  1M1A A;  3C1C D;  3AZI C;  5AV5 D;  3C1B B;  5B40 B;  3KXB C;  3O62 C;  1P3F A;  1AOI C;  3AL0 C;  2HUE B;  5B31 D;  4XUJ B;  4G92 B;  3TU4 C;  5GT0 B;  3AV2 C;  4WNN A;  1M19 B;  2ARO C;  3W99 B;  3KXB D;  3REH C;  3O62 D;  1P3M B;  2F8N G;  2BYM A;  1AOI D;  1P3O B;  3AZJ C;  3WKJ B;  3B0D C;  3X1U B;  3TU4 D;  3AV2 D;  4Z2M G;  3WA9 B;  3WAA B;  2ARO D;  4JJN B;  3W96 B;  3REH D;  2Y2Q A;  1AOI B;  2CV5 B;  3AZJ D;  1R4V A;  3AV1 C;  3MGQ A;  4X23 B;  3AZM A;  2F8N K;  3MGS A;  4ZUX A;  3X1V B;  4CSR B;  2ZY4 A;  4J8W D;  5B0Z C;  3AV1 D;  3REI B;  3X1T B;  5B32 B;  1ZLA A;  1ID3 A;  1P3A A;  4LD9 A;  3KSY A;  2IO5 B;  5B0Z D;  4J8W B;  1KX4 A;  1M18 A;  3A6N C;  1M1A B;  3VH6 A;  2FJ7 A;  5JRG A;  3W98 A;  5BNX A;  5DNN A;  1P3F B;  3B6G A;  4UPK A;  3KUY C;  2Y2J A;  4EO5 B;  4KUD B;  3A6N D;  4WNN B;  2ZY3 A;  3AZM C;  3MNN C;  3MGS C;  4ZUX C;  1EQZ C;  2FFF B;  3KWQ A;  2BYK A;  4YS3 A;  2Y2N A;  2Y2I A;  2BYM B;  3AZK A;  3AZM D;  4Z66 A;  3NQJ A;  3MNN D;  3MGS D;  4ZUX D;  1EQZ D;  5B1L A;  5G49 A;  3AZE A;  1KX4 C;  1W2E A;  1P3P C;  3B0C W;  3AN2 C;  1P3K A;  3X1S A;  5JRG C;  3MGQ B;  3B6G C;  2ZY5 A;  3LJA A;  2F8N B;  3W97 A;  1KX4 D;  1P3P D;  3UT9 A;  5B31 G;  3AN2 D;  1U35 C;  3AZN C;  3MGR C;  1ZLA B;  5JRG D;  2PYO B;  4QLC C;  1ID3 B;  1S32 A;  1P3A B;  3KFU G;  4LD9 B;  1N1J A;  3B6G D;  2NZD C;  2RVQ C;  4WU8 A;  3AZF C;  1M18 B;  3LEL A;  3AZG A;  5AVB C;  1U35 D;  3AZN D;  3MGR D;  5AV5 A;  2FJ7 B;  3W98 B;  1B6W A;  5BNX B;  4QLC D;  5C3I C;  4ZBJ B;  5AY8 C;  5DNN B;  2NZD D;  2RVQ D;  5B31 A;  1P3K C;  3AZF D;  3X1S C;  1TAF A;  4KHA B;  5AVB D;  3AZI A;  2NQB C;  3B0B A;  1KU5 A;  3KWQ B;  3KXB A;  4J8X A;  3W97 C;  2BYK B;  5AY8 D;  4YS3 B;  4G91 C;  1P3I C;  1KX3 C;  5GSU B;  3AZK B;  1P3K D;  3X1S D;  3TU4 A;  3AV2 A;  2Y2L A;  4J8V B;  5GT3 C;  4CAY A;  2G5I C;  4Z66 B;  3AFA C;  2NQB D;  2ARO A;  4H9R B;  5B1L B;  5G49 B;  3AZE B;  4DRB A;  3W97 D;  3REH A;  1KX3 D;  1P3I D;  3LZ0 C;  4YM6 C;  3AZJ A;  1T3U A;  3UTB C;  1KX5 A;  5E5A C;  4DQY B;  5B2I B;  5GT3 D;  3WTP C;  3AFA D;  1WWI A;  3LJA B;  1BH8 A;  4G91 B;  3LZ0 D;  1TZY A;  4YM6 D;  3UT9 B;  3UTB D;  3AV1 A;  4H9O A;  5E5A D;  4Z5T C;  1S32 B;  4J8X C;  4HGA C;  3WTP D;  1N1J B;  4WZS B;  1P3B C;  5B0Z A;  4WU8 B;  4AWL B;  2Y2P A;  3LEL B;  3AZG B;  5B0Y C;  4XZQ C;  3C1C B;  2ZM5 A;  2YFV A;  3AZI D;  5AV5 B;  3UTA A;  5AV9 C;  4Z5T D;  5B24 A;  4J8X D;  3MGP A;  1P3B D;  5BO0 A;  1KX5 C;  3EPH A;  5B31 B;  1TAF B;  3A6N A;  5B0Y D;  4XZQ D;  3AZI B;  5AV9 D;  4WU9 C;  3KXB B;  3O62 B;  3MVD C;  1B67 A;  5FUG A;  3KUY A;  1TZY C;  1KX5 D;  3VH6 W;  4H9P B;  4UUZ B;  2XD5 A;  3TU4 B;  3AV2 B;  3MNN A;  4CAY B;  1EQZ A;  3B0C T;  4R8P C;  2ARO B;  5KDM A;  4WU9 D;  3REH B;  3MVD D;  1TZY D;  3AZJ B;  1Q9C A;  3B0D B;  3UTA C;  4NE3 A; 
#chains in the Genus database with same CATH homology
 1P3G C;  4R8P D;  2DF4 C;  2JSS A;  3MGP C;  4J8U C;  5DNM C;  1P3P A;  1BH8 B;  3H0L C;  3AN2 A;  1HQ3 C;  3AV1 B;  2YFW A;  4H9O B;  1P3L A;  3UTA D;  5B24 D;  3AZL C;  3VH5 W;  5JA4 A;  1WWS A;  1P3G D;  3MGP D;  4J8U D;  5BT1 C;  5DNM D;  5B0Z B;  3EPK A;  1F1E A;  3AZH C;  3B6F C;  1HQ3 D;  1U35 A;  3AZN A;  2Y2G A;  3MGR A;  2YFV B;  4QLC A;  5CPI A;  3AZL D;  4H9N A;  2NZD A;  3KUY D;  1P34 C;  5BT1 D;  5CP6 C;  5BO0 B;  3EPJ A;  3AZF A;  3AZH D;  3B6F D;  3A6N B;  5AVB A;  5CPK C;  2LY8 A;  2HIO C;  2CWE A;  5AY8 A;  5FUG B;  3KUY B;  1P34 D;  5CP6 D;  1P3L C;  3LZ1 C;  1F66 C;  3AZM B;  5CPK D;  3MNN B;  3MGS B;  2NQB A;  4ZUX B;  3AYW C;  1EQZ B;  5KDM B;  2HIO D;  5BS7 C;  1KX3 A;  1P3I A;  4WJ3 C;  3WTP E;  1P3L D;  4WV4 B;  3LZ1 D;  5CPI C;  1F66 D;  5GT3 A;  3AFA A;  3AYW D;  1KX4 B;  4KGC A;  1P3P B;  3REL C;  3LZ0 A;  4YM6 A;  3H0M C;  3UTB A;  3AN2 B;  5E5A A;  2YFW B;  5JRG B;  5CPI D;  3WTP A;  2DQN C;  5JA4 B;  3B6G B;  3REL D;  5CPJ C;  2XD1 A;  1U35 B;  3AZN B;  3MGR B;  4H9Q A;  5B33 C;  3EPL A;  4QLC B;  4Z5T A;  3C1B A;  5F99 C;  4H9N B;  2NZD B;  1P3B A;  3AZF B;  4XUJ A;  5CPJ D;  5B0Y A;  4XZQ A;  5AVB B;  3NQJ B;  5B33 D;  5AV6 C;  5AV9 A;  4DRA A;  5F99 D;  4KGC C;  5C3I B;  5AY8 B;  5B2J C;  5B1M C;  1P3K B;  3X1S B;  3IP4 C;  3X1U A;  3WA9 A;  2NQB B;  5AV6 D;  4M6B A;  4WU9 A;  3W97 B;  4KGC D;  1KX3 B;  5AV8 C;  3MVD A;  1P3I B;  3REJ C;  2ZY2 A;  5B2J D;  5B1M D;  5BNV A;  3C1B C;  5GT3 B;  2UWX A;  3AFA B;  5B40 C;  4R8P A;  3A1I A;  2W8S A;  4KGC B;  5AV8 D;  2HUE C;  4XUJ C;  4G92 C;  2JCH A;  3LZ0 B;  5GT0 C;  4YM6 B;  1PZR A;  3REJ D;  3UTB B;  3P5J B;  3VH5 T;  1M19 C;  5E5A B;  4E44 A;  4NE5 A;  3C1B D;  3WTP B;  3W99 C;  5B40 D;  1P3G A;  3V9R A;  1P3M C;  4J8U A;  3R45 A;  5DNM A;  1P3O C;  4XUJ D;  3WKJ C;  3EG5 B;  3X1U C;  5GT0 D;  1HQ3 A;  3WA9 C;  1M19 D;  4H9Q B;  3WAA C;  4JJN C;  3AZL A;  4Z5T B;  2JE5 A;  4J8X B;  3W96 C;  4HGA B;  3W99 D;  1P3M D;  1P3B B;  4H9S C;  1P3O D;  2CV5 C;  3AZH A;  3B6F A;  3WKJ D;  3X1U D;  4KUD A;  5B0Y B;  4XZQ B;  4X23 C;  3WA9 D;  3X1V C;  3WAA D;  5AV9 B;  4JJN D;  3W96 D;  1ULY A;  1P34 A;  2Y2H A;  5CP6 A;  1KX5 B;  2CV5 D;  3REI C;  3X1T C;  5B32 C;  5CPK A;  4X23 D;  1H3O A;  3X1V D;  2VQR A;  4WU9 B;  2HIO A;  2IO5 C;  2L5A A;  4J8W C;  3MVD B;  1TZY B;  1M1A C;  5BNV B;  2G5H C;  5AVC A;  3REI D;  3X1T D;  5B32 D;  3LZ1 A;  3REK A;  2J8P A;  1F66 A;  5GXQ A;  3AYW A;  4R8P B;  1P3F C;  2F8N A;  5BS7 A;  4EO5 C;  4KUD C;  1M1A D;  3UTA B;  2PYO A;  5B24 B;  1P3G B;  3V9R B;  1P3F D;  3MGP B;  4J8U B;  3R45 B;  5DNM B;  3REL A;  1JFI A;  4KUD D;  1HQ3 B;  3AZL B;  3NQU A;  5AVC C;  3REK C;  5CPJ A;  3AZH B;  3B6F B;  3MGQ C;  5GXQ C;  4KHA A;  1BFM A;  5B33 A;  1BH9 A;  5F99 A;  1P34 B;  5CP6 B;  5GSU A;  5AVC D;  3REK D;  1ZLA C;  2PYO C;  3MGQ D;  5GXQ D;  1A7W A;  5CPK B;  1ID3 C;  1H3O B;  4J8V A;  1P3A C;  5AV6 A;  4LD9 C;  4H9R A;  3A1K A;  2HIO B;  2F8N D;  3VH5 A;  1M18 C;  5B2J A;  5B1M A;  1P3L B;  5AVC B;  3REK B;  3LZ1 B;  1ZLA D;  1F66 B;  2FJ7 C;  5B2I A;  2PYO D;  5GXQ B;  1ID3 D;  3W98 C;  1P3A D;  3AYW B;  4LD9 D;  4ZBJ C;  5DNN C;  5B24 C;  5AV8 A;  1M18 D;  3REJ A;  3H0R C;  2FJ7 D;  5CPI B;  3W98 D;  2BG1 A;  5B40 A;  3KWQ C;  4YS3 C;  5DNN D;  5GSU C;  2Y2O A;  2Y2M A;  3REL B;  3AZK C;  1JFI B;  5GT0 A;  3C1C A;  4J8V C;  1M19 A;  4Z66 C;  2F8N H;  5B1L C;  3AZE C;  4NFT A;  3VH6 T;  3KWQ D;  3W99 A;  1P3M A;  4YS3 D;  4Z2M H;  3NQU B;  1P3O A;  5GSU D;  3WKJ A;  3AZK D;  2Y2K A;  5CPJ B;  5B2I C;  5B32 G;  4J8V D;  4Z66 D;  5B33 B;  3WAA A;  1BH9 B;  4JJN A;  3LJA C;  5B1L D;  3W96 A;  5F99 B;  3AZE D;  3O62 A;  4H9S A;  5CHL B;  2CV5 A;  1AOI A;  3UT9 C;  4H9P A;  4UUZ A;  1Z2C B;  5B2I D;  4X23 A;  1S32 C;  2F2A C;  5AV6 B;  3X1V A;  4CSR A;  3LJA D;  4WU8 C;  4AWL C;  1HTA A;  3F6T A;  5B2J B;  3LEL C;  3C1C C;  3FDD A;  5B1M B;  3UT9 D;  3REI A;  3AZG C;  5B32 A;  3X1T A;  5AV5 C;  4NE6 A;  2RIQ A;  1S32 D;  4J8W A;  4WU8 D;  5AV8 B;  5B31 C;  4E45 A;  3REJ B;  3LEL D;  3AZG D;  1M1A A;  3C1C D;  3AZI C;  5AV5 D;  3C1B B;  5B40 B;  3KXB C;  3O62 C;  1P3F A;  1AOI C;  3AL0 C;  2HUE B;  5B31 D;  4XUJ B;  4G92 B;  3TU4 C;  5GT0 B;  3AV2 C;  4WNN A;  1M19 B;  2ARO C;  3W99 B;  3KXB D;  3REH C;  3O62 D;  1P3M B;  2F8N G;  2BYM A;  1AOI D;  1P3O B;  3AZJ C;  3WKJ B;  3B0D C;  3X1U B;  3TU4 D;  3AV2 D;  4Z2M G;  3WA9 B;  3WAA B;  2ARO D;  4JJN B;  3W96 B;  3REH D;  2Y2Q A;  1AOI B;  2CV5 B;  3AZJ D;  1R4V A;  3AV1 C;  3MGQ A;  4X23 B;  3AZM A;  2F8N K;  3MGS A;  4ZUX A;  3X1V B;  4CSR B;  2ZY4 A;  4J8W D;  5B0Z C;  3AV1 D;  3REI B;  3X1T B;  5B32 B;  1ZLA A;  1ID3 A;  1P3A A;  4LD9 A;  3KSY A;  2IO5 B;  5B0Z D;  4J8W B;  1KX4 A;  1M18 A;  3A6N C;  1M1A B;  3VH6 A;  2FJ7 A;  5JRG A;  3W98 A;  5BNX A;  5DNN A;  1P3F B;  3B6G A;  4UPK A;  3KUY C;  2Y2J A;  4EO5 B;  4KUD B;  3A6N D;  4WNN B;  2ZY3 A;  3AZM C;  3MNN C;  3MGS C;  4ZUX C;  1EQZ C;  2FFF B;  3KWQ A;  2BYK A;  4YS3 A;  2Y2N A;  2Y2I A;  2BYM B;  3AZK A;  3AZM D;  4Z66 A;  3NQJ A;  3MNN D;  3MGS D;  4ZUX D;  1EQZ D;  5B1L A;  5G49 A;  3AZE A;  1KX4 C;  1W2E A;  1P3P C;  3B0C W;  3AN2 C;  1P3K A;  3X1S A;  5JRG C;  3MGQ B;  3B6G C;  2ZY5 A;  3LJA A;  2F8N B;  3W97 A;  1KX4 D;  1P3P D;  3UT9 A;  5B31 G;  3AN2 D;  1U35 C;  3AZN C;  3MGR C;  1ZLA B;  5JRG D;  2PYO B;  4QLC C;  1ID3 B;  1S32 A;  1P3A B;  3KFU G;  4LD9 B;  1N1J A;  3B6G D;  2NZD C;  2RVQ C;  4WU8 A;  3AZF C;  1M18 B;  3LEL A;  3AZG A;  5AVB C;  1U35 D;  3AZN D;  3MGR D;  5AV5 A;  2FJ7 B;  3W98 B;  1B6W A;  5BNX B;  4QLC D;  5C3I C;  4ZBJ B;  5AY8 C;  5DNN B;  2NZD D;  2RVQ D;  5B31 A;  1P3K C;  3AZF D;  3X1S C;  1TAF A;  4KHA B;  5AVB D;  3AZI A;  2NQB C;  3B0B A;  1KU5 A;  3KWQ B;  3KXB A;  4J8X A;  3W97 C;  2BYK B;  5AY8 D;  4YS3 B;  4G91 C;  1P3I C;  1KX3 C;  5GSU B;  3AZK B;  1P3K D;  3X1S D;  3TU4 A;  3AV2 A;  2Y2L A;  4J8V B;  5GT3 C;  4CAY A;  2G5I C;  4Z66 B;  3AFA C;  2NQB D;  2ARO A;  4H9R B;  5B1L B;  5G49 B;  3AZE B;  4DRB A;  3W97 D;  3REH A;  1KX3 D;  1P3I D;  3LZ0 C;  4YM6 C;  3AZJ A;  1T3U A;  3UTB C;  1KX5 A;  5E5A C;  4DQY B;  5B2I B;  5GT3 D;  3WTP C;  3AFA D;  1WWI A;  3LJA B;  1BH8 A;  4G91 B;  3LZ0 D;  1TZY A;  4YM6 D;  3UT9 B;  3UTB D;  3AV1 A;  4H9O A;  5E5A D;  4Z5T C;  1S32 B;  4J8X C;  4HGA C;  3WTP D;  1N1J B;  4WZS B;  1P3B C;  5B0Z A;  4WU8 B;  4AWL B;  2Y2P A;  3LEL B;  3AZG B;  5B0Y C;  4XZQ C;  3C1C B;  2ZM5 A;  2YFV A;  3AZI D;  5AV5 B;  3UTA A;  5AV9 C;  4Z5T D;  5B24 A;  4J8X D;  3MGP A;  1P3B D;  5BO0 A;  1KX5 C;  3EPH A;  5B31 B;  1TAF B;  3A6N A;  5B0Y D;  4XZQ D;  3AZI B;  5AV9 D;  4WU9 C;  3KXB B;  3O62 B;  3MVD C;  1B67 A;  5FUG A;  3KUY A;  1TZY C;  1KX5 D;  3VH6 W;  4H9P B;  4UUZ B;  2XD5 A;  3TU4 B;  3AV2 B;  3MNN A;  4CAY B;  1EQZ A;  3B0C T;  4R8P C;  2ARO B;  5KDM A;  4WU9 D;  3REH B;  3MVD D;  1TZY D;  3AZJ B;  1Q9C A;  3B0D B;  3UTA C;  4NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...