5AV9A

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9A00
5B1MB 5JRGC 3LJAC 1TAFA 3AZEA 3LELC 2CV5D 3W97D 3UTAB 3W99C 3VH5A 5BNXA 3O62D 4H9OB 5E5AD 3O62A 5E5AA 5GT3C 2NQBD 1M1AA 5GXQB 3LZ1A 5BT1D 3X1UC 3WTPC 1S32B 4YS3A 2YFVB 3AZNB 5G49B 4AWLB 4G92B 3MGQB 3RELB 5B33C 4Z66B 1P3BD 1B67A 5B2IC 3AZKD 4XZQD 3AZIC 3X1VD 3AZMC 2HIOA 3AZJA 1P34D 1KX3B 5AVCD 3AZLD 3KWQB 4XUJD 5AV5B 5B0ZD 5B0ZA 4E44A 3AYWA 4EO5B 3NQUA 3AZEC 5B1MD 5B1LB 4R8PA 5B32B 4KUDB 5B31D 3W97C 5B31A 5DNMB 4WU9D 3MNNA 3LZ0B 4WU9A 1ID3B 3O62C 5E5AC 1P3LB 1M1AC 4ZBJC 4CAYA 1HQ3B 3LZ1C 1KX4B 3B6GA 5BT1C 1A7WA 5B2JA 1Q9CA 3MGPA 3MGRA 1TZYB 1WWSA 1P3AB 3VH6W 2RVQD 1P3MD 1P3BC 4G91B 1F66B 3REKA 1H3OB 4J8UA 4XZQC 3X1VC 5FUGB 1R4VA 2HIOC 3AFAD 3AZJC 5BO0A 3MGSD 3MGSA 3AZLC 3UTBA 1KX3D 4KGCA 5B0ZC 3REJD 3REJA 3AYWC 3W96B 3AZHD 5AV5D 1KX5B 3X1TA 4R8PC 1ZLAB 2YFWA 5B31C 1N1JB 1ULYA 2AROB 5B1LD 5B32D 1P3IB 4WU9C 4KUDD 5DNMD 2F8NK 1M19B 5B32G 3LZ0D 1ID3D 3B6GC 1P3LD 3WAAD 3AZGA 1P3GB 1HQ3D 4H9RA 5B2JC 3V9RB 5DNNA 3A6NB 4JJNA 2HUEC 5BNVA 4H9NA 5JRGA 5B40D 2RVQC 5B40A 3LJAA 1P3MC 3B6FB 1F1EA 2CWEA 3LELA 3NQJA 5AV9B 3AFAC 5AY8A 1F66D 1U35D 3AZFB 3MGSC 5B2IB 1P3PA 4HGAC 4DRBA 3UTBC 4KGCC 1M18A 3REJC 1WWIA 4J8WA 2BYMA 4WNNA 3X1TC 5AV8B 1KX5D 3R45A 1ZLAD 1AOIB 3MVDD 3MVDA 1BH8B 1P3ID 3B0BA 3TU4B 5BNXB 3WAAC 3UT9A 3AN2B 5F99D 4WU8D 1M1AB 4WU8A 5DNNC 2BYKA 3WA9B 5B24B 5GT0D 5CPJB 4YS3B 5AV6B 3A6ND 5B40C 5CPKB 4KHAA 4Z2MG 1P3KB 2CV5A 4LD9D 3W97A 5AY8C 3B6FD 1KU5A 4J8VD 4J8VA 4ZUXB 2PYOD 4UUZA 5AV9D 1P3PC 2NQBA 1M18C 1EQZB 5AVBD 5AVBA 3REHD 1HTAA 4J8WC 1P3FB 2NZDB 5C3IC 5AV8D 3MVDC 4J8XD 2LY8A 4R8PB 2F8ND 4H9PB 1P3BA 3W98B 3MNNB 5CPIB 2F8NG 3KUYB 5CP6D 3AZKA 4XZQA 4QLCD 3UT9C 3X1VA 3TU4D 4WU8C 4CAYB 1P34A 3C1BB 3AN2D 5AVCA 3X1SB 3AZLA 4XUJA 5GT0C 3B0DC 3C1CB 3WA9D 4NFTA 2IO5C 3AV2B 5CPJD 3MGPB 1BFMA 5B1MA 3MGRB 5AV6D 2CV5C 4LD9C 5B0YB 4J8VC 2PYOC 1P3KD 3REKB 3UTAD 4J8UB 3UTAA 2NQBC 4YM6B 4ZUXD 4H9OA 5AVBC 3WKJB 3AV1B 5GXQD 4KGCB 3REIB 1P3FD 2NZDD 3VH6T 1S32D 4J8XC 2YFWB 2YFVA 3AZND 1P3MA 4Z5TB 3MGQD 3RELD 5GSUB 5CP6C 4Z66D 3KXBB 4QLCC 3MGQA 3AZKC 3W98D 3AFAA 5CPID 3KUYD 1P34C 4H9QA 5AVCC 4DRAA 4X23B 3AZGB 4XUJC 1KX3A 3C1BD 3X1SD 4M6BA 3KWQD 3AZHA 5AV5A 1P3OB 2FJ7B 3C1CD 5B1MC 4JJNB 5BNVB 5JRGB 3LJAB 5B1LA 5B32A 4KUDA 5B0YD 3LELB 3UTAC 5DNMA 3W99B 3LZ0A 1ID3A 3KSYA 4YM6D 1P3LA 3WAAA 3VH5W 5GT3B 1KX4D 1HQ3A 3WKJD 5BS7A 3AV1D 3X1UB 3REID 2BYMB 4WNNB 1S32C 3WTPB 5JA4A 4E45A 4AWLC 3AZNC 1TZYD 1P3AD 1TZYA 4CSRB 1P3AA 4G92C 3MGQC 3RELC 4Z66C 4Z5TD 5B33B 1F66A 5GSUD 1H3OA 1U35A 5FUGA 3AZIB 3AZMB 1KX3C 3AZHC 3KWQC 5AV5C 5KDMB 1BH9B 3W96D 4EO5C 3B0DB 1P3OD 1KX5A 2FJ7D 5B1LC 1TAFB 5B32C 3AZEB 1ZLAA 4KUDC 4WZSB 1N1JA 5DNMC 2AROD 2AROA 3W97B 3LZ0C 1P3IA 1ID3C 1P3LC 1M19D 4NE3A 3W99D 3O62B 5E5AB 1HQ3C 5F99A 1KX4C 4ZBJB 5BS7C 3LZ1B 5GT3D 1P3GD 5GT0A 3VH6A 3A6NA 1JFIA 1TZYC 1P3AC 3WTPD 4LD9A 4G91C 1F66C 1P3BB 1U35C 3B6FA 2PYOA 5AV9A 5B33D 4XZQB 3X1VB 2HIOB 3AZFD 3AZJB 5B2ID 4NE5A 3AZID 3B0CW 3AZMD 3AZLB 3REHA 3W96C 1B6WA 5B0ZB 1KX5C 3AYWB 3NQUB 1ZLAC 5AV8A 4J8XA 2AROC 5B31B 1AOID 1P3IC 3AZED 1AOIA 2F8NA 1BH8A 1M19C 4WU9B 5CP6A 4QLCA 5F99C 3TU4A 3B6GB 3AN2A 1P3GC 1M1AD 5B2JB 3LZ1D 5B24D 3WA9A 5B24A 3A6NC 5CPJA 4YS3D 5AV6A 2HUEB 5CPKD 5CPKA 2JSSA 3B6FC 1P3MB 1P3KA 5AV9C 4ZUXA 3AFAB 3AZFC 4H9QB 5BO0B 3MGSB 3REHC 1EQZD 2HIOD 4HGAB 4H9SA 3UTBB 3AZJD 5GXQA 1EQZA 3REJB 5CHLB 3AZHB 1P3FA 2NZDA 5AV8C 3AYWD 3X1TB 1S32A 1AOIC 3AZNA 5G49A 4R8PD 3RELA 4Z66A 4H9PA 3TU4C 3MNND 5B31G 3W98A 5CPIA 3KUYA 3AN2C 3WAAB 4H9RB 3B6GD 3C1BA 4Z2MH 3WA9C 5B24C 3X1SA 5DNNB 3KWQA 5B2JD 3C1CA 5CPJC 4YS3C 5AV6C 5CPKC 4H9NB 5JA4B 3AV2D 5B40B 3MGPD 3AV2A 3MGRD 1P3KC 5B0YA 3NQJB 4ZUXC 5AY8B 3VH5T 3REKD 4J8UD 1U35B 4NE6A 4YM6A 1P3PB 1EQZC 3WTPE 4H9SC 5GXQC 1M18B 1KX4A 3WKJA 1P3FC 3UTBD 3AV1A 4KGCD 2NZDC 4J8WB 3REIA 2F8NH 3X1TD 3R45B 5C3IB 3MVDB 4WV4B 4Z5TA 3W98C 3MNNC 5CPIC 3KUYC 3KXBD 5GSUA 3KXBA 3UT9B 5F99B 4WU8B 3C1BC 3X1SC 4X23D 3AZGD 4X23A 2BYKB 3C1CC 5GT0B 3W96A 5DNND 1P3OA 2FJ7A 3AV2C 3MGPC 2IO5B 4JJND 1JFIB 3MGRC 5JRGD 4KHAB 5B0YC 3LJAD 2CV5B 4LD9B 3REKC 3LELD 4J8UC 4J8VB 2PYOB 4UUZB 4YM6C 1M19A 5AY8D 3W99A 2NQBB 1P3PD 3WKJC 3AV1C 5AVBB 5GT3A 1P3GA 3REHB 1M18D 3REIC 3V9RA 2L5AA 3X1UD 3X1UA 4J8WD 3WTPA 4J8XB 4Z5TC 2F8NB 4CSRA 5GSUC 3KXBC 3B0CT 5CP6B 5B33A 3AZKB 4QLCB 3AZFA 1P34B 5B2IA 4X23C 3UT9D 3AZGC 5AVCB 3AZIA 3AZMA 4XUJB 1P3OC 5KDMA 2FJ7C 1BH9A 4JJNC
chains in the Genus database with same CATH superfamily
5B1MB 5JRGC 2JE5A 3LJAC 1TAFA 3AZEA 3LELC 2CV5D 3W97D 3UTAB 3W99C 3VH5A 5BNXA 3O62D 4H9OB 2UWXA 3H0MC 5E5AA 5E5AD 5GT3C 3O62A 2NQBD 1M1AA 5GXQB 3LZ1A 5BT1D 2Y2NA 3X1UC 1T3UA 3WTPC 1S32B 4YS3A 2YFVB 3AZNB 5G49B 4AWLB 4G92B 3MGQB 3RELB 5B33C 4Z66B 1P3BD 1B67A 5B2IC 3AZKD 4XZQD 2DQNC 3AZIC 3X1VD 3AZMC 2HIOA 3AZJA 1P34D 1KX3B 5AVCD 3AZLD 3KWQB 4XUJD 5AV5B 5B0ZD 5B0ZA 4E44A 3AYWA 4EO5B 3NQUA 3AZEC 5B1MD 5B1LB 4R8PA 5B32B 4KUDB 5B31D 3W97C 5B31A 5DNMB 4WU9D 3MNNA 3LZ0B 4WU9A 1ID3B 3O62C 5E5AC 1P3LB 1M1AC 4ZBJC 4CAYA 1HQ3B 3LZ1C 1KX4B 3B6GA 5BT1C 1A7WA 2Y2OA 5B2JA 2XD5A 1Q9CA 3MGPA 3MGRA 1TZYB 1WWSA 1P3AB 3VH6W 2RVQD 1P3MD 1P3BC 4G91B 1F66B 3REKA 1H3OB 3EG5B 4XZQC 4J8UA 3X1VC 5FUGB 1R4VA 2HIOC 3AFAD 3AZJC 5BO0A 3MGSD 3MGSA 3AZLC 3UTBA 1KX3D 4KGCA 5B0ZC 3REJD 3REJA 3AYWC 3W96B 3AZHD 5AV5D 1KX5B 3X1TA 4R8PC 1ZLAB 2YFWA 5B31C 1N1JB 1ULYA 2AROB 5B1LD 5B32D 1P3IB 4WU9C 4KUDD 5DNMD 2F8NK 1M19B 5B32G 3LZ0D 1ID3D 3B6GC 1P3LD 3WAAD 2BG1A 3AZGA 3IP4C 1HQ3D 4H9RA 5B2JC 1P3GB 3V9RB 5DNNA 3A6NB 4JJNA 2HUEC 5BNVA 4H9NA 3EPJA 5JRGA 5B40D 2RVQC 5B40A 3LJAA 2JCHA 1P3MC 3B6FB 1F1EA 2CWEA 3LELA 3NQJA 5AV9B 3AFAC 5AY8A 1F66D 1U35D 3AZFB 3MGSC 5B2IB 1P3PA 4HGAC 4DRBA 3UTBC 4KGCC 1M18A 3REJC 2Y2MA 1WWIA 4J8WA 2BYMA 4WNNA 3X1TC 5AV8B 1KX5D 2Y2HA 3R45A 1ZLAD 1AOIB 3MVDD 3MVDA 1BH8B 1P3ID 3B0BA 3TU4B 5BNXB 3WAAC 3UT9A 3AN2B 5F99D 4WU8D 1M1AB 4WU8A 5DNNC 2BYKA 3WA9B 5B24B 5GT0D 5CPJB 4YS3B 5AV6B 3A6ND 5B40C 5CPKB 1PZRA 4KHAA 4Z2MG 1P3KB 2CV5A 4LD9D 3W97A 5AY8C 3B6FD 1KU5A 4J8VD 4J8VA 4UPKA 4ZUXB 4UUZA 2PYOD 5AV9D 1P3PC 2NQBA 1M18C 1EQZB 5AVBD 5AVBA 3REHD 1HTAA 4J8WC 1P3FB 2NZDB 5C3IC 5AV8D 3MVDC 4J8XD 2LY8A 4R8PB 2F8ND 4H9PB 1P3BA 3W98B 3MNNB 5CPIB 2F8NG 3KUYB 5CP6D 3AZKA 4XZQA 4QLCD 3UT9C 3X1VA 3TU4D 4WU8C 4CAYB 1P34A 3C1BB 3AN2D 5AVCA 3X1SB 3AZLA 4XUJA 5GT0C 3B0DC 3C1CB 3WA9D 4NFTA 2IO5C 3AV2B 5CPJD 3MGPB 1BFMA 5B1MA 3MGRB 5AV6D 2CV5C 4LD9C 5B0YB 3EPLA 4J8VC 2PYOC 1P3KD 3REKB 3UTAD 4J8UB 3UTAA 4WJ3C 2NQBC 2XD1A 4YM6B 4ZUXD 3KFUG 2Y2JA 4H9OA 5AVBC 3WKJB 2W8SA 3AV1B 5GXQD 4KGCB 3REIB 1P3FD 2NZDD 3VH6T 1S32D 4J8XC 2YFWB 2YFVA 3AZND 1P3MA 4Z5TB 3MGQD 3RELD 5GSUB 5CP6C 4Z66D 3KXBB 4QLCC 3MGQA 3AZKC 3W98D 3AFAA 5CPID 3KUYD 1P34C 4H9QA 5AVCC 4DRAA 4X23B 3AZGB 4XUJC 1KX3A 4DQYB 3C1BD 3X1SD 4M6BA 3KWQD 3AZHA 5AV5A 3A1IA 1P3OB 2FJ7B 3C1CD 5B1MC 4JJNB 5BNVB 5JRGB 3LJAB 5B1LA 5B32A 4KUDA 5B0YD 3LELB 3UTAC 5DNMA 3W99B 3LZ0A 1ID3A 3KSYA 4YM6D 1P3LA 1Z2CB 3WAAA 3VH5W 5GT3B 1KX4D 1HQ3A 2G5IC 3WKJD 5BS7A 3AV1D 3X1UB 3REID 2BYMB 4WNNB 1S32C 3WTPB 5JA4A 4E45A 4AWLC 3AZNC 3EPHA 1TZYD 1P3AD 1TZYA 4CSRB 1P3AA 4G92C 3MGQC 3RELC 4Z66C 4Z5TD 2RIQA 5B33B 1F66A 5GSUD 1H3OA 1U35A 5FUGA 3AZIB 3AZMB 1KX3C 3AZHC 2G5HC 3KWQC 5AV5C 5KDMB 1BH9B 3W96D 4EO5C 3B0DB 1P3OD 1KX5A 2FJ7D 5B1LC 1TAFB 5B32C 3AZEB 1ZLAA 4KUDC 4WZSB 1N1JA 5DNMC 2AROD 2AROA 3W97B 3LZ0C 1P3IA 1ID3C 3EPKA 1P3LC 1M19D 2Y2LA 4NE3A 3W99D 3O62B 5E5AB 1HQ3C 5F99A 1KX4C 3H0LC 4ZBJB 5BS7C 3LZ1B 5GT3D 1P3GD 5GT0A 3VH6A 3A6NA 1JFIA 1TZYC 1P3AC 3WTPD 4LD9A 4G91C 1F66C 1P3BB 1U35C 3B6FA 2PYOA 2Y2QA 5AV9A 5B33D 4XZQB 3X1VB 2HIOB 3AZFD 3AZJB 5B2ID 4NE5A 3AZID 3B0CW 3AZMD 3AZLB 3REHA 3W96C 1B6WA 5B0ZB 1KX5C 3AYWB 3NQUB 1ZLAC 5AV8A 4J8XA 2AROC 5B31B 1AOID 1P3IC 3AZED 1AOIA 2ZY2A 2F8NA 1BH8A 1M19C 2FFFB 4WU9B 5CP6A 4QLCA 5F99C 3TU4A 3B6GB 3H0RC 3AN2A 1P3GC 1M1AD 2Y2KA 5B2JB 3LZ1D 5B24D 3WA9A 5B24A 3A6NC 5CPJA 4YS3D 5AV6A 2HUEB 5CPKD 5CPKA 2JSSA 2ZM5A 3B6FC 1P3MB 3A1KA 1P3KA 5AV9C 4ZUXA 3AFAB 3AZFC 4H9QB 2ZY5A 5BO0B 3MGSB 3REHC 1EQZD 2HIOD 4HGAB 4H9SA 3UTBB 3AZJD 5GXQA 1EQZA 2DF4C 3REJB 5CHLB 3AZHB 1P3FA 2NZDA 5AV8C 3AYWD 3X1TB 1S32A 1AOIC 3AZNA 5G49A 4R8PD 3RELA 4Z66A 4H9PA 3TU4C 3MNND 5B31G 3W98A 5CPIA 3KUYA 3AN2C 3WAAB 4H9RB 3B6GD 3C1BA 4Z2MH 3WA9C 5B24C 3X1SA 5DNNB 3KWQA 5B2JD 3C1CA 5CPJC 4YS3C 5AV6C 5CPKC 4H9NB 5JA4B 3AV2D 5B40B 3MGPD 3AV2A 3MGRD 1P3KC 5B0YA 3NQJB 4ZUXC 5AY8B 3VH5T 3REKD 4J8UD 1U35B 4NE6A 4YM6A 1P3PB 1EQZC 3WTPE 4H9SC 5GXQC 1M18B 1KX4A 2ZY4A 3WKJA 1P3FC 3UTBD 3AV1A 4KGCD 2NZDC 4J8WB 3REIA 2F8NH 3AL0C 3R45B 5C3IB 3X1TD 3MVDB 4WV4B 4Z5TA 3W98C 3MNNC 5CPIC 3KUYC 3KXBD 5GSUA 3KXBA 3UT9B 2F2AC 5F99B 4WU8B 3C1BC 3X1SC 4X23D 3AZGD 4X23A 2BYKB 3C1CC 5GT0B 3W96A 5DNND 1P3OA 2FJ7A 3AV2C 3MGPC 2IO5B 4JJND 1JFIB 3MGRC 5JRGD 4KHAB 5B0YC 3LJAD 2Y2PA 2CV5B 4LD9B 3REKC 2Y2IA 3LELD 2ZY3A 3F6TA 4UUZB 4J8UC 4J8VB 4YM6C 1M19A 2PYOB 5AY8D 2Y2GA 3W99A 2NQBB 1P3PD 3WKJC 3AV1C 3P5JB 5AVBB 5GT3A 1P3GA 3REHB 1M18D 3REIC 3V9RA 2L5AA 3X1UD 3X1UA 4J8WD 1W2EA 3WTPA 4J8XB 2VQRA 3FDDA 2J8PA 4Z5TC 2F8NB 4CSRA 5GSUC 3KXBC 3B0CT 5CP6B 5B33A 3AZKB 4QLCB 3AZFA 1P34B 5B2IA 4X23C 3UT9D 3AZGC 5AVCB 3AZIA 3AZMA 4XUJB 1P3OC 5KDMA 2FJ7C 1BH9A 4JJNC
chains in the Genus database with same CATH topology
5B1MB 5JRGC 2JE5A 3LJAC 1TAFA 3AZEA 3LELC 2CV5D 3W97D 3UTAB 3W99C 3VH5A 5BNXA 3O62D 4H9OB 2UWXA 3H0MC 5E5AA 5E5AD 5GT3C 3O62A 2NQBD 1M1AA 5GXQB 3LZ1A 5BT1D 2Y2NA 3X1UC 1T3UA 3WTPC 1S32B 4YS3A 2YFVB 3AZNB 5G49B 4AWLB 4G92B 3MGQB 3RELB 5B33C 4Z66B 1P3BD 1B67A 5B2IC 3AZKD 4XZQD 2DQNC 3AZIC 3X1VD 3AZMC 2HIOA 3AZJA 1P34D 1KX3B 5AVCD 3AZLD 3KWQB 4XUJD 5AV5B 5B0ZD 5B0ZA 4E44A 3AYWA 4EO5B 3NQUA 3AZEC 5B1MD 5B1LB 4R8PA 5B32B 4KUDB 5B31D 3W97C 5B31A 5DNMB 4WU9D 3MNNA 3LZ0B 4WU9A 1ID3B 3O62C 5E5AC 1P3LB 1M1AC 4ZBJC 4CAYA 1HQ3B 3LZ1C 1KX4B 3B6GA 5BT1C 1A7WA 2Y2OA 5B2JA 2XD5A 1Q9CA 3MGPA 3MGRA 1TZYB 1WWSA 1P3AB 3VH6W 2RVQD 1P3MD 1P3BC 4G91B 1F66B 3REKA 1H3OB 3EG5B 4XZQC 4J8UA 3X1VC 5FUGB 1R4VA 2HIOC 3AFAD 3AZJC 5BO0A 3MGSD 3MGSA 3AZLC 3UTBA 1KX3D 4KGCA 5B0ZC 3REJD 3REJA 3AYWC 3W96B 3AZHD 5AV5D 1KX5B 3X1TA 4R8PC 1ZLAB 2YFWA 5B31C 1N1JB 1ULYA 2AROB 5B1LD 5B32D 1P3IB 4WU9C 4KUDD 5DNMD 2F8NK 1M19B 5B32G 3LZ0D 1ID3D 3B6GC 1P3LD 3WAAD 2BG1A 3AZGA 3IP4C 1HQ3D 4H9RA 5B2JC 1P3GB 3V9RB 5DNNA 3A6NB 4JJNA 2HUEC 5BNVA 4H9NA 3EPJA 5JRGA 5B40D 2RVQC 5B40A 3LJAA 2JCHA 1P3MC 3B6FB 1F1EA 2CWEA 3LELA 3NQJA 5AV9B 3AFAC 5AY8A 1F66D 1U35D 3AZFB 3MGSC 5B2IB 1P3PA 4HGAC 4DRBA 3UTBC 4KGCC 1M18A 3REJC 2Y2MA 1WWIA 4J8WA 2BYMA 4WNNA 3X1TC 5AV8B 1KX5D 2Y2HA 3R45A 1ZLAD 1AOIB 3MVDD 3MVDA 1BH8B 1P3ID 3B0BA 3TU4B 5BNXB 3WAAC 3UT9A 3AN2B 5F99D 4WU8D 1M1AB 4WU8A 5DNNC 2BYKA 3WA9B 5B24B 5GT0D 5CPJB 4YS3B 5AV6B 3A6ND 5B40C 5CPKB 1PZRA 4KHAA 4Z2MG 1P3KB 2CV5A 4LD9D 3W97A 5AY8C 3B6FD 1KU5A 4J8VD 4J8VA 4UPKA 4ZUXB 4UUZA 2PYOD 5AV9D 1P3PC 2NQBA 1M18C 1EQZB 5AVBD 5AVBA 3REHD 1HTAA 4J8WC 1P3FB 2NZDB 5C3IC 5AV8D 3MVDC 4J8XD 2LY8A 4R8PB 2F8ND 4H9PB 1P3BA 3W98B 3MNNB 5CPIB 2F8NG 3KUYB 5CP6D 3AZKA 4XZQA 4QLCD 3UT9C 3X1VA 3TU4D 4WU8C 4CAYB 1P34A 3C1BB 3AN2D 5AVCA 3X1SB 3AZLA 4XUJA 5GT0C 3B0DC 3C1CB 3WA9D 4NFTA 2IO5C 3AV2B 5CPJD 3MGPB 1BFMA 5B1MA 3MGRB 5AV6D 2CV5C 4LD9C 5B0YB 3EPLA 4J8VC 2PYOC 1P3KD 3REKB 3UTAD 4J8UB 3UTAA 4WJ3C 2NQBC 2XD1A 4YM6B 4ZUXD 3KFUG 2Y2JA 4H9OA 5AVBC 3WKJB 2W8SA 3AV1B 5GXQD 4KGCB 3REIB 1P3FD 2NZDD 3VH6T 1S32D 4J8XC 2YFWB 2YFVA 3AZND 1P3MA 4Z5TB 3MGQD 3RELD 5GSUB 5CP6C 4Z66D 3KXBB 4QLCC 3MGQA 3AZKC 3W98D 3AFAA 5CPID 3KUYD 1P34C 4H9QA 5AVCC 4DRAA 4X23B 3AZGB 4XUJC 1KX3A 4DQYB 3C1BD 3X1SD 4M6BA 3KWQD 3AZHA 5AV5A 3A1IA 1P3OB 2FJ7B 3C1CD 5B1MC 4JJNB 5BNVB 5JRGB 3LJAB 5B1LA 5B32A 4KUDA 5B0YD 3LELB 3UTAC 5DNMA 3W99B 3LZ0A 1ID3A 3KSYA 4YM6D 1P3LA 1Z2CB 3WAAA 3VH5W 5GT3B 1KX4D 1HQ3A 2G5IC 3WKJD 5BS7A 3AV1D 3X1UB 3REID 2BYMB 4WNNB 1S32C 3WTPB 5JA4A 4E45A 4AWLC 3AZNC 3EPHA 1TZYD 1P3AD 1TZYA 4CSRB 1P3AA 4G92C 3MGQC 3RELC 4Z66C 4Z5TD 2RIQA 5B33B 1F66A 5GSUD 1H3OA 1U35A 5FUGA 3AZIB 3AZMB 1KX3C 3AZHC 2G5HC 3KWQC 5AV5C 5KDMB 1BH9B 3W96D 4EO5C 3B0DB 1P3OD 1KX5A 2FJ7D 5B1LC 1TAFB 5B32C 3AZEB 1ZLAA 4KUDC 4WZSB 1N1JA 5DNMC 2AROD 2AROA 3W97B 3LZ0C 1P3IA 1ID3C 3EPKA 1P3LC 1M19D 2Y2LA 4NE3A 3W99D 3O62B 5E5AB 1HQ3C 5F99A 1KX4C 3H0LC 4ZBJB 5BS7C 3LZ1B 5GT3D 1P3GD 5GT0A 3VH6A 3A6NA 1JFIA 1TZYC 1P3AC 3WTPD 4LD9A 4G91C 1F66C 1P3BB 1U35C 3B6FA 2PYOA 2Y2QA 5AV9A 5B33D 4XZQB 3X1VB 2HIOB 3AZFD 3AZJB 5B2ID 4NE5A 3AZID 3B0CW 3AZMD 3AZLB 3REHA 3W96C 1B6WA 5B0ZB 1KX5C 3AYWB 3NQUB 1ZLAC 5AV8A 4J8XA 2AROC 5B31B 1AOID 1P3IC 3AZED 1AOIA 2ZY2A 2F8NA 1BH8A 1M19C 2FFFB 4WU9B 5CP6A 4QLCA 5F99C 3TU4A 3B6GB 3H0RC 3AN2A 1P3GC 1M1AD 2Y2KA 5B2JB 3LZ1D 5B24D 3WA9A 5B24A 3A6NC 5CPJA 4YS3D 5AV6A 2HUEB 5CPKD 5CPKA 2JSSA 2ZM5A 3B6FC 1P3MB 3A1KA 1P3KA 5AV9C 4ZUXA 3AFAB 3AZFC 4H9QB 2ZY5A 5BO0B 3MGSB 3REHC 1EQZD 2HIOD 4HGAB 4H9SA 3UTBB 3AZJD 5GXQA 1EQZA 2DF4C 3REJB 5CHLB 3AZHB 1P3FA 2NZDA 5AV8C 3AYWD 3X1TB 1S32A 1AOIC 3AZNA 5G49A 4R8PD 3RELA 4Z66A 4H9PA 3TU4C 3MNND 5B31G 3W98A 5CPIA 3KUYA 3AN2C 3WAAB 4H9RB 3B6GD 3C1BA 4Z2MH 3WA9C 5B24C 3X1SA 5DNNB 3KWQA 5B2JD 3C1CA 5CPJC 4YS3C 5AV6C 5CPKC 4H9NB 5JA4B 3AV2D 5B40B 3MGPD 3AV2A 3MGRD 1P3KC 5B0YA 3NQJB 4ZUXC 5AY8B 3VH5T 3REKD 4J8UD 1U35B 4NE6A 4YM6A 1P3PB 1EQZC 3WTPE 4H9SC 5GXQC 1M18B 1KX4A 2ZY4A 3WKJA 1P3FC 3UTBD 3AV1A 4KGCD 2NZDC 4J8WB 3REIA 2F8NH 3AL0C 3R45B 5C3IB 3X1TD 3MVDB 4WV4B 4Z5TA 3W98C 3MNNC 5CPIC 3KUYC 3KXBD 5GSUA 3KXBA 3UT9B 2F2AC 5F99B 4WU8B 3C1BC 3X1SC 4X23D 3AZGD 4X23A 2BYKB 3C1CC 5GT0B 3W96A 5DNND 1P3OA 2FJ7A 3AV2C 3MGPC 2IO5B 4JJND 1JFIB 3MGRC 5JRGD 4KHAB 5B0YC 3LJAD 2Y2PA 2CV5B 4LD9B 3REKC 2Y2IA 3LELD 2ZY3A 3F6TA 4UUZB 4J8UC 4J8VB 4YM6C 1M19A 2PYOB 5AY8D 2Y2GA 3W99A 2NQBB 1P3PD 3WKJC 3AV1C 3P5JB 5AVBB 5GT3A 1P3GA 3REHB 1M18D 3REIC 3V9RA 2L5AA 3X1UD 3X1UA 4J8WD 1W2EA 3WTPA 4J8XB 2VQRA 3FDDA 2J8PA 4Z5TC 2F8NB 4CSRA 5GSUC 3KXBC 3B0CT 5CP6B 5B33A 3AZKB 4QLCB 3AZFA 1P34B 5B2IA 4X23C 3UT9D 3AZGC 5AVCB 3AZIA 3AZMA 4XUJB 1P3OC 5KDMA 2FJ7C 1BH9A 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M B;  5JRG C;  3LJA C;  1TAF A;  3AZE A;  3LEL C;  2CV5 D;  3W97 D;  3UTA B;  3W99 C;  3VH5 A;  5BNX A;  3O62 D;  4H9O B;  5E5A D;  3O62 A;  5E5A A;  5GT3 C;  2NQB D;  1M1A A;  5GXQ B;  3LZ1 A;  5BT1 D;  3X1U C;  3WTP C;  1S32 B;  4YS3 A;  2YFV B;  3AZN B;  5G49 B;  4AWL B;  4G92 B;  3MGQ B;  3REL B;  5B33 C;  4Z66 B;  1P3B D;  1B67 A;  5B2I C;  3AZK D;  4XZQ D;  3AZI C;  3X1V D;  3AZM C;  2HIO A;  3AZJ A;  1P34 D;  1KX3 B;  5AVC D;  3AZL D;  3KWQ B;  4XUJ D;  5AV5 B;  5B0Z D;  5B0Z A;  4E44 A;  3AYW A;  4EO5 B;  3NQU A;  3AZE C;  5B1M D;  5B1L B;  4R8P A;  5B32 B;  4KUD B;  5B31 D;  3W97 C;  5B31 A;  5DNM B;  4WU9 D;  3MNN A;  3LZ0 B;  4WU9 A;  1ID3 B;  3O62 C;  5E5A C;  1P3L B;  1M1A C;  4ZBJ C;  4CAY A;  1HQ3 B;  3LZ1 C;  1KX4 B;  3B6G A;  5BT1 C;  1A7W A;  5B2J A;  1Q9C A;  3MGP A;  3MGR A;  1TZY B;  1WWS A;  1P3A B;  3VH6 W;  2RVQ D;  1P3M D;  1P3B C;  4G91 B;  1F66 B;  3REK A;  1H3O B;  4J8U A;  4XZQ C;  3X1V C;  5FUG B;  1R4V A;  2HIO C;  3AFA D;  3AZJ C;  5BO0 A;  3MGS D;  3MGS A;  3AZL C;  3UTB A;  1KX3 D;  4KGC A;  5B0Z C;  3REJ D;  3REJ A;  3AYW C;  3W96 B;  3AZH D;  5AV5 D;  1KX5 B;  3X1T A;  4R8P C;  1ZLA B;  2YFW A;  5B31 C;  1N1J B;  1ULY A;  2ARO B;  5B1L D;  5B32 D;  1P3I B;  4WU9 C;  4KUD D;  5DNM D;  2F8N K;  1M19 B;  5B32 G;  3LZ0 D;  1ID3 D;  3B6G C;  1P3L D;  3WAA D;  3AZG A;  1P3G B;  1HQ3 D;  4H9R A;  5B2J C;  3V9R B;  5DNN A;  3A6N B;  4JJN A;  2HUE C;  5BNV A;  4H9N A;  5JRG A;  5B40 D;  2RVQ C;  5B40 A;  3LJA A;  1P3M C;  3B6F B;  1F1E A;  2CWE A;  3LEL A;  3NQJ A;  5AV9 B;  3AFA C;  5AY8 A;  1F66 D;  1U35 D;  3AZF B;  3MGS C;  5B2I B;  1P3P A;  4HGA C;  4DRB A;  3UTB C;  4KGC C;  1M18 A;  3REJ C;  1WWI A;  4J8W A;  2BYM A;  4WNN A;  3X1T C;  5AV8 B;  1KX5 D;  3R45 A;  1ZLA D;  1AOI B;  3MVD D;  3MVD A;  1BH8 B;  1P3I D;  3B0B A;  3TU4 B;  5BNX B;  3WAA C;  3UT9 A;  3AN2 B;  5F99 D;  4WU8 D;  1M1A B;  4WU8 A;  5DNN C;  2BYK A;  3WA9 B;  5B24 B;  5GT0 D;  5CPJ B;  4YS3 B;  5AV6 B;  3A6N D;  5B40 C;  5CPK B;  4KHA A;  4Z2M G;  1P3K B;  2CV5 A;  4LD9 D;  3W97 A;  5AY8 C;  3B6F D;  1KU5 A;  4J8V D;  4J8V A;  4ZUX B;  2PYO D;  4UUZ A;  5AV9 D;  1P3P C;  2NQB A;  1M18 C;  1EQZ B;  5AVB D;  5AVB A;  3REH D;  1HTA A;  4J8W C;  1P3F B;  2NZD B;  5C3I C;  5AV8 D;  3MVD C;  4J8X D;  2LY8 A;  4R8P B;  2F8N D;  4H9P B;  1P3B A;  3W98 B;  3MNN B;  5CPI B;  2F8N G;  3KUY B;  5CP6 D;  3AZK A;  4XZQ A;  4QLC D;  3UT9 C;  3X1V A;  3TU4 D;  4WU8 C;  4CAY B;  1P34 A;  3C1B B;  3AN2 D;  5AVC A;  3X1S B;  3AZL A;  4XUJ A;  5GT0 C;  3B0D C;  3C1C B;  3WA9 D;  4NFT A;  2IO5 C;  3AV2 B;  5CPJ D;  3MGP B;  1BFM A;  5B1M A;  3MGR B;  5AV6 D;  2CV5 C;  4LD9 C;  5B0Y B;  4J8V C;  2PYO C;  1P3K D;  3REK B;  3UTA D;  4J8U B;  3UTA A;  2NQB C;  4YM6 B;  4ZUX D;  4H9O A;  5AVB C;  3WKJ B;  3AV1 B;  5GXQ D;  4KGC B;  3REI B;  1P3F D;  2NZD D;  3VH6 T;  1S32 D;  4J8X C;  2YFW B;  2YFV A;  3AZN D;  1P3M A;  4Z5T B;  3MGQ D;  3REL D;  5GSU B;  5CP6 C;  4Z66 D;  3KXB B;  4QLC C;  3MGQ A;  3AZK C;  3W98 D;  3AFA A;  5CPI D;  3KUY D;  1P34 C;  4H9Q A;  5AVC C;  4DRA A;  4X23 B;  3AZG B;  4XUJ C;  1KX3 A;  3C1B D;  3X1S D;  4M6B A;  3KWQ D;  3AZH A;  5AV5 A;  1P3O B;  2FJ7 B;  3C1C D;  5B1M C;  4JJN B;  5BNV B;  5JRG B;  3LJA B;  5B1L A;  5B32 A;  4KUD A;  5B0Y D;  3LEL B;  3UTA C;  5DNM A;  3W99 B;  3LZ0 A;  1ID3 A;  3KSY A;  4YM6 D;  1P3L A;  3WAA A;  3VH5 W;  5GT3 B;  1KX4 D;  1HQ3 A;  3WKJ D;  5BS7 A;  3AV1 D;  3X1U B;  3REI D;  2BYM B;  4WNN B;  1S32 C;  3WTP B;  5JA4 A;  4E45 A;  4AWL C;  3AZN C;  1TZY D;  1P3A D;  1TZY A;  4CSR B;  1P3A A;  4G92 C;  3MGQ C;  3REL C;  4Z66 C;  4Z5T D;  5B33 B;  1F66 A;  5GSU D;  1H3O A;  1U35 A;  5FUG A;  3AZI B;  3AZM B;  1KX3 C;  3AZH C;  3KWQ C;  5AV5 C;  5KDM B;  1BH9 B;  3W96 D;  4EO5 C;  3B0D B;  1P3O D;  1KX5 A;  2FJ7 D;  5B1L C;  1TAF B;  5B32 C;  3AZE B;  1ZLA A;  4KUD C;  4WZS B;  1N1J A;  5DNM C;  2ARO D;  2ARO A;  3W97 B;  3LZ0 C;  1P3I A;  1ID3 C;  1P3L C;  1M19 D;  4NE3 A;  3W99 D;  3O62 B;  5E5A B;  1HQ3 C;  5F99 A;  1KX4 C;  4ZBJ B;  5BS7 C;  3LZ1 B;  5GT3 D;  1P3G D;  5GT0 A;  3VH6 A;  3A6N A;  1JFI A;  1TZY C;  1P3A C;  3WTP D;  4LD9 A;  4G91 C;  1F66 C;  1P3B B;  1U35 C;  3B6F A;  2PYO A;  5AV9 A;  5B33 D;  4XZQ B;  3X1V B;  2HIO B;  3AZF D;  3AZJ B;  5B2I D;  4NE5 A;  3AZI D;  3B0C W;  3AZM D;  3AZL B;  3REH A;  3W96 C;  1B6W A;  5B0Z B;  1KX5 C;  3AYW B;  3NQU B;  1ZLA C;  5AV8 A;  4J8X A;  2ARO C;  5B31 B;  1AOI D;  1P3I C;  3AZE D;  1AOI A;  2F8N A;  1BH8 A;  1M19 C;  4WU9 B;  5CP6 A;  4QLC A;  5F99 C;  3TU4 A;  3B6G B;  3AN2 A;  1P3G C;  1M1A D;  5B2J B;  3LZ1 D;  5B24 D;  3WA9 A;  5B24 A;  3A6N C;  5CPJ A;  4YS3 D;  5AV6 A;  2HUE B;  5CPK D;  5CPK A;  2JSS A;  3B6F C;  1P3M B;  1P3K A;  5AV9 C;  4ZUX A;  3AFA B;  3AZF C;  4H9Q B;  5BO0 B;  3MGS B;  3REH C;  1EQZ D;  2HIO D;  4HGA B;  4H9S A;  3UTB B;  3AZJ D;  5GXQ A;  1EQZ A;  3REJ B;  5CHL B;  3AZH B;  1P3F A;  2NZD A;  5AV8 C;  3AYW D;  3X1T B;  1S32 A;  1AOI C;  3AZN A;  5G49 A;  4R8P D;  3REL A;  4Z66 A;  4H9P A;  3TU4 C;  3MNN D;  5B31 G;  3W98 A;  5CPI A;  3KUY A;  3AN2 C;  3WAA B;  4H9R B;  3B6G D;  3C1B A;  4Z2M H;  3WA9 C;  5B24 C;  3X1S A;  5DNN B;  3KWQ A;  5B2J D;  3C1C A;  5CPJ C;  4YS3 C;  5AV6 C;  5CPK C;  4H9N B;  5JA4 B;  3AV2 D;  5B40 B;  3MGP D;  3AV2 A;  3MGR D;  1P3K C;  5B0Y A;  3NQJ B;  4ZUX C;  5AY8 B;  3VH5 T;  3REK D;  4J8U D;  1U35 B;  4NE6 A;  4YM6 A;  1P3P B;  1EQZ C;  3WTP E;  4H9S C;  5GXQ C;  1M18 B;  1KX4 A;  3WKJ A;  1P3F C;  3UTB D;  3AV1 A;  4KGC D;  2NZD C;  4J8W B;  3REI A;  2F8N H;  3X1T D;  3R45 B;  5C3I B;  3MVD B;  4WV4 B;  4Z5T A;  3W98 C;  3MNN C;  5CPI C;  3KUY C;  3KXB D;  5GSU A;  3KXB A;  3UT9 B;  5F99 B;  4WU8 B;  3C1B C;  3X1S C;  4X23 D;  3AZG D;  4X23 A;  2BYK B;  3C1C C;  5GT0 B;  3W96 A;  5DNN D;  1P3O A;  2FJ7 A;  3AV2 C;  3MGP C;  2IO5 B;  4JJN D;  1JFI B;  3MGR C;  5JRG D;  4KHA B;  5B0Y C;  3LJA D;  2CV5 B;  4LD9 B;  3REK C;  3LEL D;  4J8U C;  4J8V B;  2PYO B;  4UUZ B;  4YM6 C;  1M19 A;  5AY8 D;  3W99 A;  2NQB B;  1P3P D;  3WKJ C;  3AV1 C;  5AVB B;  5GT3 A;  1P3G A;  3REH B;  1M18 D;  3REI C;  3V9R A;  2L5A A;  3X1U D;  3X1U A;  4J8W D;  3WTP A;  4J8X B;  4Z5T C;  2F8N B;  4CSR A;  5GSU C;  3KXB C;  3B0C T;  5CP6 B;  5B33 A;  3AZK B;  4QLC B;  3AZF A;  1P34 B;  5B2I A;  4X23 C;  3UT9 D;  3AZG C;  5AVC B;  3AZI A;  3AZM A;  4XUJ B;  1P3O C;  5KDM A;  2FJ7 C;  1BH9 A;  4JJN C; 
#chains in the Genus database with same CATH topology
 5B1M B;  5JRG C;  2JE5 A;  3LJA C;  1TAF A;  3AZE A;  3LEL C;  2CV5 D;  3W97 D;  3UTA B;  3W99 C;  3VH5 A;  5BNX A;  3O62 D;  4H9O B;  2UWX A;  3H0M C;  5E5A A;  5E5A D;  5GT3 C;  3O62 A;  2NQB D;  1M1A A;  5GXQ B;  3LZ1 A;  5BT1 D;  2Y2N A;  3X1U C;  1T3U A;  3WTP C;  1S32 B;  4YS3 A;  2YFV B;  3AZN B;  5G49 B;  4AWL B;  4G92 B;  3MGQ B;  3REL B;  5B33 C;  4Z66 B;  1P3B D;  1B67 A;  5B2I C;  3AZK D;  4XZQ D;  2DQN C;  3AZI C;  3X1V D;  3AZM C;  2HIO A;  3AZJ A;  1P34 D;  1KX3 B;  5AVC D;  3AZL D;  3KWQ B;  4XUJ D;  5AV5 B;  5B0Z D;  5B0Z A;  4E44 A;  3AYW A;  4EO5 B;  3NQU A;  3AZE C;  5B1M D;  5B1L B;  4R8P A;  5B32 B;  4KUD B;  5B31 D;  3W97 C;  5B31 A;  5DNM B;  4WU9 D;  3MNN A;  3LZ0 B;  4WU9 A;  1ID3 B;  3O62 C;  5E5A C;  1P3L B;  1M1A C;  4ZBJ C;  4CAY A;  1HQ3 B;  3LZ1 C;  1KX4 B;  3B6G A;  5BT1 C;  1A7W A;  2Y2O A;  5B2J A;  2XD5 A;  1Q9C A;  3MGP A;  3MGR A;  1TZY B;  1WWS A;  1P3A B;  3VH6 W;  2RVQ D;  1P3M D;  1P3B C;  4G91 B;  1F66 B;  3REK A;  1H3O B;  3EG5 B;  4XZQ C;  4J8U A;  3X1V C;  5FUG B;  1R4V A;  2HIO C;  3AFA D;  3AZJ C;  5BO0 A;  3MGS D;  3MGS A;  3AZL C;  3UTB A;  1KX3 D;  4KGC A;  5B0Z C;  3REJ D;  3REJ A;  3AYW C;  3W96 B;  3AZH D;  5AV5 D;  1KX5 B;  3X1T A;  4R8P C;  1ZLA B;  2YFW A;  5B31 C;  1N1J B;  1ULY A;  2ARO B;  5B1L D;  5B32 D;  1P3I B;  4WU9 C;  4KUD D;  5DNM D;  2F8N K;  1M19 B;  5B32 G;  3LZ0 D;  1ID3 D;  3B6G C;  1P3L D;  3WAA D;  2BG1 A;  3AZG A;  3IP4 C;  1HQ3 D;  4H9R A;  5B2J C;  1P3G B;  3V9R B;  5DNN A;  3A6N B;  4JJN A;  2HUE C;  5BNV A;  4H9N A;  3EPJ A;  5JRG A;  5B40 D;  2RVQ C;  5B40 A;  3LJA A;  2JCH A;  1P3M C;  3B6F B;  1F1E A;  2CWE A;  3LEL A;  3NQJ A;  5AV9 B;  3AFA C;  5AY8 A;  1F66 D;  1U35 D;  3AZF B;  3MGS C;  5B2I B;  1P3P A;  4HGA C;  4DRB A;  3UTB C;  4KGC C;  1M18 A;  3REJ C;  2Y2M A;  1WWI A;  4J8W A;  2BYM A;  4WNN A;  3X1T C;  5AV8 B;  1KX5 D;  2Y2H A;  3R45 A;  1ZLA D;  1AOI B;  3MVD D;  3MVD A;  1BH8 B;  1P3I D;  3B0B A;  3TU4 B;  5BNX B;  3WAA C;  3UT9 A;  3AN2 B;  5F99 D;  4WU8 D;  1M1A B;  4WU8 A;  5DNN C;  2BYK A;  3WA9 B;  5B24 B;  5GT0 D;  5CPJ B;  4YS3 B;  5AV6 B;  3A6N D;  5B40 C;  5CPK B;  1PZR A;  4KHA A;  4Z2M G;  1P3K B;  2CV5 A;  4LD9 D;  3W97 A;  5AY8 C;  3B6F D;  1KU5 A;  4J8V D;  4J8V A;  4UPK A;  4ZUX B;  4UUZ A;  2PYO D;  5AV9 D;  1P3P C;  2NQB A;  1M18 C;  1EQZ B;  5AVB D;  5AVB A;  3REH D;  1HTA A;  4J8W C;  1P3F B;  2NZD B;  5C3I C;  5AV8 D;  3MVD C;  4J8X D;  2LY8 A;  4R8P B;  2F8N D;  4H9P B;  1P3B A;  3W98 B;  3MNN B;  5CPI B;  2F8N G;  3KUY B;  5CP6 D;  3AZK A;  4XZQ A;  4QLC D;  3UT9 C;  3X1V A;  3TU4 D;  4WU8 C;  4CAY B;  1P34 A;  3C1B B;  3AN2 D;  5AVC A;  3X1S B;  3AZL A;  4XUJ A;  5GT0 C;  3B0D C;  3C1C B;  3WA9 D;  4NFT A;  2IO5 C;  3AV2 B;  5CPJ D;  3MGP B;  1BFM A;  5B1M A;  3MGR B;  5AV6 D;  2CV5 C;  4LD9 C;  5B0Y B;  3EPL A;  4J8V C;  2PYO C;  1P3K D;  3REK B;  3UTA D;  4J8U B;  3UTA A;  4WJ3 C;  2NQB C;  2XD1 A;  4YM6 B;  4ZUX D;  3KFU G;  2Y2J A;  4H9O A;  5AVB C;  3WKJ B;  2W8S A;  3AV1 B;  5GXQ D;  4KGC B;  3REI B;  1P3F D;  2NZD D;  3VH6 T;  1S32 D;  4J8X C;  2YFW B;  2YFV A;  3AZN D;  1P3M A;  4Z5T B;  3MGQ D;  3REL D;  5GSU B;  5CP6 C;  4Z66 D;  3KXB B;  4QLC C;  3MGQ A;  3AZK C;  3W98 D;  3AFA A;  5CPI D;  3KUY D;  1P34 C;  4H9Q A;  5AVC C;  4DRA A;  4X23 B;  3AZG B;  4XUJ C;  1KX3 A;  4DQY B;  3C1B D;  3X1S D;  4M6B A;  3KWQ D;  3AZH A;  5AV5 A;  3A1I A;  1P3O B;  2FJ7 B;  3C1C D;  5B1M C;  4JJN B;  5BNV B;  5JRG B;  3LJA B;  5B1L A;  5B32 A;  4KUD A;  5B0Y D;  3LEL B;  3UTA C;  5DNM A;  3W99 B;  3LZ0 A;  1ID3 A;  3KSY A;  4YM6 D;  1P3L A;  1Z2C B;  3WAA A;  3VH5 W;  5GT3 B;  1KX4 D;  1HQ3 A;  2G5I C;  3WKJ D;  5BS7 A;  3AV1 D;  3X1U B;  3REI D;  2BYM B;  4WNN B;  1S32 C;  3WTP B;  5JA4 A;  4E45 A;  4AWL C;  3AZN C;  3EPH A;  1TZY D;  1P3A D;  1TZY A;  4CSR B;  1P3A A;  4G92 C;  3MGQ C;  3REL C;  4Z66 C;  4Z5T D;  2RIQ A;  5B33 B;  1F66 A;  5GSU D;  1H3O A;  1U35 A;  5FUG A;  3AZI B;  3AZM B;  1KX3 C;  3AZH C;  2G5H C;  3KWQ C;  5AV5 C;  5KDM B;  1BH9 B;  3W96 D;  4EO5 C;  3B0D B;  1P3O D;  1KX5 A;  2FJ7 D;  5B1L C;  1TAF B;  5B32 C;  3AZE B;  1ZLA A;  4KUD C;  4WZS B;  1N1J A;  5DNM C;  2ARO D;  2ARO A;  3W97 B;  3LZ0 C;  1P3I A;  1ID3 C;  3EPK A;  1P3L C;  1M19 D;  2Y2L A;  4NE3 A;  3W99 D;  3O62 B;  5E5A B;  1HQ3 C;  5F99 A;  1KX4 C;  3H0L C;  4ZBJ B;  5BS7 C;  3LZ1 B;  5GT3 D;  1P3G D;  5GT0 A;  3VH6 A;  3A6N A;  1JFI A;  1TZY C;  1P3A C;  3WTP D;  4LD9 A;  4G91 C;  1F66 C;  1P3B B;  1U35 C;  3B6F A;  2PYO A;  2Y2Q A;  5AV9 A;  5B33 D;  4XZQ B;  3X1V B;  2HIO B;  3AZF D;  3AZJ B;  5B2I D;  4NE5 A;  3AZI D;  3B0C W;  3AZM D;  3AZL B;  3REH A;  3W96 C;  1B6W A;  5B0Z B;  1KX5 C;  3AYW B;  3NQU B;  1ZLA C;  5AV8 A;  4J8X A;  2ARO C;  5B31 B;  1AOI D;  1P3I C;  3AZE D;  1AOI A;  2ZY2 A;  2F8N A;  1BH8 A;  1M19 C;  2FFF B;  4WU9 B;  5CP6 A;  4QLC A;  5F99 C;  3TU4 A;  3B6G B;  3H0R C;  3AN2 A;  1P3G C;  1M1A D;  2Y2K A;  5B2J B;  3LZ1 D;  5B24 D;  3WA9 A;  5B24 A;  3A6N C;  5CPJ A;  4YS3 D;  5AV6 A;  2HUE B;  5CPK D;  5CPK A;  2JSS A;  2ZM5 A;  3B6F C;  1P3M B;  3A1K A;  1P3K A;  5AV9 C;  4ZUX A;  3AFA B;  3AZF C;  4H9Q B;  2ZY5 A;  5BO0 B;  3MGS B;  3REH C;  1EQZ D;  2HIO D;  4HGA B;  4H9S A;  3UTB B;  3AZJ D;  5GXQ A;  1EQZ A;  2DF4 C;  3REJ B;  5CHL B;  3AZH B;  1P3F A;  2NZD A;  5AV8 C;  3AYW D;  3X1T B;  1S32 A;  1AOI C;  3AZN A;  5G49 A;  4R8P D;  3REL A;  4Z66 A;  4H9P A;  3TU4 C;  3MNN D;  5B31 G;  3W98 A;  5CPI A;  3KUY A;  3AN2 C;  3WAA B;  4H9R B;  3B6G D;  3C1B A;  4Z2M H;  3WA9 C;  5B24 C;  3X1S A;  5DNN B;  3KWQ A;  5B2J D;  3C1C A;  5CPJ C;  4YS3 C;  5AV6 C;  5CPK C;  4H9N B;  5JA4 B;  3AV2 D;  5B40 B;  3MGP D;  3AV2 A;  3MGR D;  1P3K C;  5B0Y A;  3NQJ B;  4ZUX C;  5AY8 B;  3VH5 T;  3REK D;  4J8U D;  1U35 B;  4NE6 A;  4YM6 A;  1P3P B;  1EQZ C;  3WTP E;  4H9S C;  5GXQ C;  1M18 B;  1KX4 A;  2ZY4 A;  3WKJ A;  1P3F C;  3UTB D;  3AV1 A;  4KGC D;  2NZD C;  4J8W B;  3REI A;  2F8N H;  3AL0 C;  3R45 B;  5C3I B;  3X1T D;  3MVD B;  4WV4 B;  4Z5T A;  3W98 C;  3MNN C;  5CPI C;  3KUY C;  3KXB D;  5GSU A;  3KXB A;  3UT9 B;  2F2A C;  5F99 B;  4WU8 B;  3C1B C;  3X1S C;  4X23 D;  3AZG D;  4X23 A;  2BYK B;  3C1C C;  5GT0 B;  3W96 A;  5DNN D;  1P3O A;  2FJ7 A;  3AV2 C;  3MGP C;  2IO5 B;  4JJN D;  1JFI B;  3MGR C;  5JRG D;  4KHA B;  5B0Y C;  3LJA D;  2Y2P A;  2CV5 B;  4LD9 B;  3REK C;  2Y2I A;  3LEL D;  2ZY3 A;  3F6T A;  4UUZ B;  4J8U C;  4J8V B;  4YM6 C;  1M19 A;  2PYO B;  5AY8 D;  2Y2G A;  3W99 A;  2NQB B;  1P3P D;  3WKJ C;  3AV1 C;  3P5J B;  5AVB B;  5GT3 A;  1P3G A;  3REH B;  1M18 D;  3REI C;  3V9R A;  2L5A A;  3X1U D;  3X1U A;  4J8W D;  1W2E A;  3WTP A;  4J8X B;  2VQR A;  3FDD A;  2J8P A;  4Z5T C;  2F8N B;  4CSR A;  5GSU C;  3KXB C;  3B0C T;  5CP6 B;  5B33 A;  3AZK B;  4QLC B;  3AZF A;  1P34 B;  5B2I A;  4X23 C;  3UT9 D;  3AZG C;  5AVC B;  3AZI A;  3AZM A;  4XUJ B;  1P3O C;  5KDM A;  2FJ7 C;  1BH9 A;  4JJN C; 
#chains in the Genus database with same CATH homology
 5B1M B;  5JRG C;  2JE5 A;  3LJA C;  1TAF A;  3AZE A;  3LEL C;  2CV5 D;  3W97 D;  3UTA B;  3W99 C;  3VH5 A;  5BNX A;  3O62 D;  4H9O B;  2UWX A;  3H0M C;  5E5A A;  5E5A D;  5GT3 C;  3O62 A;  2NQB D;  1M1A A;  5GXQ B;  3LZ1 A;  5BT1 D;  2Y2N A;  3X1U C;  1T3U A;  3WTP C;  1S32 B;  4YS3 A;  2YFV B;  3AZN B;  5G49 B;  4AWL B;  4G92 B;  3MGQ B;  3REL B;  5B33 C;  4Z66 B;  1P3B D;  1B67 A;  5B2I C;  3AZK D;  4XZQ D;  2DQN C;  3AZI C;  3X1V D;  3AZM C;  2HIO A;  3AZJ A;  1P34 D;  1KX3 B;  5AVC D;  3AZL D;  3KWQ B;  4XUJ D;  5AV5 B;  5B0Z D;  5B0Z A;  4E44 A;  3AYW A;  4EO5 B;  3NQU A;  3AZE C;  5B1M D;  5B1L B;  4R8P A;  5B32 B;  4KUD B;  5B31 D;  3W97 C;  5B31 A;  5DNM B;  4WU9 D;  3MNN A;  3LZ0 B;  4WU9 A;  1ID3 B;  3O62 C;  5E5A C;  1P3L B;  1M1A C;  4ZBJ C;  4CAY A;  1HQ3 B;  3LZ1 C;  1KX4 B;  3B6G A;  5BT1 C;  1A7W A;  2Y2O A;  5B2J A;  2XD5 A;  1Q9C A;  3MGP A;  3MGR A;  1TZY B;  1WWS A;  1P3A B;  3VH6 W;  2RVQ D;  1P3M D;  1P3B C;  4G91 B;  1F66 B;  3REK A;  1H3O B;  3EG5 B;  4XZQ C;  4J8U A;  3X1V C;  5FUG B;  1R4V A;  2HIO C;  3AFA D;  3AZJ C;  5BO0 A;  3MGS D;  3MGS A;  3AZL C;  3UTB A;  1KX3 D;  4KGC A;  5B0Z C;  3REJ D;  3REJ A;  3AYW C;  3W96 B;  3AZH D;  5AV5 D;  1KX5 B;  3X1T A;  4R8P C;  1ZLA B;  2YFW A;  5B31 C;  1N1J B;  1ULY A;  2ARO B;  5B1L D;  5B32 D;  1P3I B;  4WU9 C;  4KUD D;  5DNM D;  2F8N K;  1M19 B;  5B32 G;  3LZ0 D;  1ID3 D;  3B6G C;  1P3L D;  3WAA D;  2BG1 A;  3AZG A;  3IP4 C;  1HQ3 D;  4H9R A;  5B2J C;  1P3G B;  3V9R B;  5DNN A;  3A6N B;  4JJN A;  2HUE C;  5BNV A;  4H9N A;  3EPJ A;  5JRG A;  5B40 D;  2RVQ C;  5B40 A;  3LJA A;  2JCH A;  1P3M C;  3B6F B;  1F1E A;  2CWE A;  3LEL A;  3NQJ A;  5AV9 B;  3AFA C;  5AY8 A;  1F66 D;  1U35 D;  3AZF B;  3MGS C;  5B2I B;  1P3P A;  4HGA C;  4DRB A;  3UTB C;  4KGC C;  1M18 A;  3REJ C;  2Y2M A;  1WWI A;  4J8W A;  2BYM A;  4WNN A;  3X1T C;  5AV8 B;  1KX5 D;  2Y2H A;  3R45 A;  1ZLA D;  1AOI B;  3MVD D;  3MVD A;  1BH8 B;  1P3I D;  3B0B A;  3TU4 B;  5BNX B;  3WAA C;  3UT9 A;  3AN2 B;  5F99 D;  4WU8 D;  1M1A B;  4WU8 A;  5DNN C;  2BYK A;  3WA9 B;  5B24 B;  5GT0 D;  5CPJ B;  4YS3 B;  5AV6 B;  3A6N D;  5B40 C;  5CPK B;  1PZR A;  4KHA A;  4Z2M G;  1P3K B;  2CV5 A;  4LD9 D;  3W97 A;  5AY8 C;  3B6F D;  1KU5 A;  4J8V D;  4J8V A;  4UPK A;  4ZUX B;  4UUZ A;  2PYO D;  5AV9 D;  1P3P C;  2NQB A;  1M18 C;  1EQZ B;  5AVB D;  5AVB A;  3REH D;  1HTA A;  4J8W C;  1P3F B;  2NZD B;  5C3I C;  5AV8 D;  3MVD C;  4J8X D;  2LY8 A;  4R8P B;  2F8N D;  4H9P B;  1P3B A;  3W98 B;  3MNN B;  5CPI B;  2F8N G;  3KUY B;  5CP6 D;  3AZK A;  4XZQ A;  4QLC D;  3UT9 C;  3X1V A;  3TU4 D;  4WU8 C;  4CAY B;  1P34 A;  3C1B B;  3AN2 D;  5AVC A;  3X1S B;  3AZL A;  4XUJ A;  5GT0 C;  3B0D C;  3C1C B;  3WA9 D;  4NFT A;  2IO5 C;  3AV2 B;  5CPJ D;  3MGP B;  1BFM A;  5B1M A;  3MGR B;  5AV6 D;  2CV5 C;  4LD9 C;  5B0Y B;  3EPL A;  4J8V C;  2PYO C;  1P3K D;  3REK B;  3UTA D;  4J8U B;  3UTA A;  4WJ3 C;  2NQB C;  2XD1 A;  4YM6 B;  4ZUX D;  3KFU G;  2Y2J A;  4H9O A;  5AVB C;  3WKJ B;  2W8S A;  3AV1 B;  5GXQ D;  4KGC B;  3REI B;  1P3F D;  2NZD D;  3VH6 T;  1S32 D;  4J8X C;  2YFW B;  2YFV A;  3AZN D;  1P3M A;  4Z5T B;  3MGQ D;  3REL D;  5GSU B;  5CP6 C;  4Z66 D;  3KXB B;  4QLC C;  3MGQ A;  3AZK C;  3W98 D;  3AFA A;  5CPI D;  3KUY D;  1P34 C;  4H9Q A;  5AVC C;  4DRA A;  4X23 B;  3AZG B;  4XUJ C;  1KX3 A;  4DQY B;  3C1B D;  3X1S D;  4M6B A;  3KWQ D;  3AZH A;  5AV5 A;  3A1I A;  1P3O B;  2FJ7 B;  3C1C D;  5B1M C;  4JJN B;  5BNV B;  5JRG B;  3LJA B;  5B1L A;  5B32 A;  4KUD A;  5B0Y D;  3LEL B;  3UTA C;  5DNM A;  3W99 B;  3LZ0 A;  1ID3 A;  3KSY A;  4YM6 D;  1P3L A;  1Z2C B;  3WAA A;  3VH5 W;  5GT3 B;  1KX4 D;  1HQ3 A;  2G5I C;  3WKJ D;  5BS7 A;  3AV1 D;  3X1U B;  3REI D;  2BYM B;  4WNN B;  1S32 C;  3WTP B;  5JA4 A;  4E45 A;  4AWL C;  3AZN C;  3EPH A;  1TZY D;  1P3A D;  1TZY A;  4CSR B;  1P3A A;  4G92 C;  3MGQ C;  3REL C;  4Z66 C;  4Z5T D;  2RIQ A;  5B33 B;  1F66 A;  5GSU D;  1H3O A;  1U35 A;  5FUG A;  3AZI B;  3AZM B;  1KX3 C;  3AZH C;  2G5H C;  3KWQ C;  5AV5 C;  5KDM B;  1BH9 B;  3W96 D;  4EO5 C;  3B0D B;  1P3O D;  1KX5 A;  2FJ7 D;  5B1L C;  1TAF B;  5B32 C;  3AZE B;  1ZLA A;  4KUD C;  4WZS B;  1N1J A;  5DNM C;  2ARO D;  2ARO A;  3W97 B;  3LZ0 C;  1P3I A;  1ID3 C;  3EPK A;  1P3L C;  1M19 D;  2Y2L A;  4NE3 A;  3W99 D;  3O62 B;  5E5A B;  1HQ3 C;  5F99 A;  1KX4 C;  3H0L C;  4ZBJ B;  5BS7 C;  3LZ1 B;  5GT3 D;  1P3G D;  5GT0 A;  3VH6 A;  3A6N A;  1JFI A;  1TZY C;  1P3A C;  3WTP D;  4LD9 A;  4G91 C;  1F66 C;  1P3B B;  1U35 C;  3B6F A;  2PYO A;  2Y2Q A;  5AV9 A;  5B33 D;  4XZQ B;  3X1V B;  2HIO B;  3AZF D;  3AZJ B;  5B2I D;  4NE5 A;  3AZI D;  3B0C W;  3AZM D;  3AZL B;  3REH A;  3W96 C;  1B6W A;  5B0Z B;  1KX5 C;  3AYW B;  3NQU B;  1ZLA C;  5AV8 A;  4J8X A;  2ARO C;  5B31 B;  1AOI D;  1P3I C;  3AZE D;  1AOI A;  2ZY2 A;  2F8N A;  1BH8 A;  1M19 C;  2FFF B;  4WU9 B;  5CP6 A;  4QLC A;  5F99 C;  3TU4 A;  3B6G B;  3H0R C;  3AN2 A;  1P3G C;  1M1A D;  2Y2K A;  5B2J B;  3LZ1 D;  5B24 D;  3WA9 A;  5B24 A;  3A6N C;  5CPJ A;  4YS3 D;  5AV6 A;  2HUE B;  5CPK D;  5CPK A;  2JSS A;  2ZM5 A;  3B6F C;  1P3M B;  3A1K A;  1P3K A;  5AV9 C;  4ZUX A;  3AFA B;  3AZF C;  4H9Q B;  2ZY5 A;  5BO0 B;  3MGS B;  3REH C;  1EQZ D;  2HIO D;  4HGA B;  4H9S A;  3UTB B;  3AZJ D;  5GXQ A;  1EQZ A;  2DF4 C;  3REJ B;  5CHL B;  3AZH B;  1P3F A;  2NZD A;  5AV8 C;  3AYW D;  3X1T B;  1S32 A;  1AOI C;  3AZN A;  5G49 A;  4R8P D;  3REL A;  4Z66 A;  4H9P A;  3TU4 C;  3MNN D;  5B31 G;  3W98 A;  5CPI A;  3KUY A;  3AN2 C;  3WAA B;  4H9R B;  3B6G D;  3C1B A;  4Z2M H;  3WA9 C;  5B24 C;  3X1S A;  5DNN B;  3KWQ A;  5B2J D;  3C1C A;  5CPJ C;  4YS3 C;  5AV6 C;  5CPK C;  4H9N B;  5JA4 B;  3AV2 D;  5B40 B;  3MGP D;  3AV2 A;  3MGR D;  1P3K C;  5B0Y A;  3NQJ B;  4ZUX C;  5AY8 B;  3VH5 T;  3REK D;  4J8U D;  1U35 B;  4NE6 A;  4YM6 A;  1P3P B;  1EQZ C;  3WTP E;  4H9S C;  5GXQ C;  1M18 B;  1KX4 A;  2ZY4 A;  3WKJ A;  1P3F C;  3UTB D;  3AV1 A;  4KGC D;  2NZD C;  4J8W B;  3REI A;  2F8N H;  3AL0 C;  3R45 B;  5C3I B;  3X1T D;  3MVD B;  4WV4 B;  4Z5T A;  3W98 C;  3MNN C;  5CPI C;  3KUY C;  3KXB D;  5GSU A;  3KXB A;  3UT9 B;  2F2A C;  5F99 B;  4WU8 B;  3C1B C;  3X1S C;  4X23 D;  3AZG D;  4X23 A;  2BYK B;  3C1C C;  5GT0 B;  3W96 A;  5DNN D;  1P3O A;  2FJ7 A;  3AV2 C;  3MGP C;  2IO5 B;  4JJN D;  1JFI B;  3MGR C;  5JRG D;  4KHA B;  5B0Y C;  3LJA D;  2Y2P A;  2CV5 B;  4LD9 B;  3REK C;  2Y2I A;  3LEL D;  2ZY3 A;  3F6T A;  4UUZ B;  4J8U C;  4J8V B;  4YM6 C;  1M19 A;  2PYO B;  5AY8 D;  2Y2G A;  3W99 A;  2NQB B;  1P3P D;  3WKJ C;  3AV1 C;  3P5J B;  5AVB B;  5GT3 A;  1P3G A;  3REH B;  1M18 D;  3REI C;  3V9R A;  2L5A A;  3X1U D;  3X1U A;  4J8W D;  1W2E A;  3WTP A;  4J8X B;  2VQR A;  3FDD A;  2J8P A;  4Z5T C;  2F8N B;  4CSR A;  5GSU C;  3KXB C;  3B0C T;  5CP6 B;  5B33 A;  3AZK B;  4QLC B;  3AZF A;  1P34 B;  5B2I A;  4X23 C;  3UT9 D;  3AZG C;  5AVC B;  3AZI A;  3AZM A;  4XUJ B;  1P3O C;  5KDM A;  2FJ7 C;  1BH9 A;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...