5AV9A

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9A00
4XUJB 4E45A 3C1BA 3A6NA 3AZHD 1P3KD 1U35B 5CPJD 5CPKC 5E5AB 3MGQA 3AZMB 4HGAB 5CP6A 4G91C 3O62A 1ID3B 2NZDC 3VH6T 3X1UC 5AY8A 3MVDB 1P3AB 3WAAA 4EO5B 4KGCD 1M1AD 2NQBB 2YFVB 2YFWA 5B1LB 5B1MD 3UT9D 3B0BA 3X1SD 3LELB 4YS3A 3MGSC 4CSRA 5JA4A 3KXBD 3X1VA 2HUEC 4XUJC 5BS7C 1HQ3B 3W96A 1P3BB 1WWSA 1U35C 3AZJD 5E5AC 3AZMC 4HGAC 1H3OB 1ID3C 3WKJA 3AV2B 5F99D 4E44A 5KDMA 3MVDC 1P3AC 4J8WB 3C1BB 4EO5C 1EQZB 3AN2B 2NQBC 1AOIA 3MGQB 1KX5D 5B1LC 3O62B 3LELC 4WNNB 5AY8B 4YM6D 1S32D 4J8XD 3AZHA 1P3KA 3UTAB 5CPJA 1P34D 1KX4D 2YFWB 5GT3B 1HQ3C 1P3BC 1ZLAD 4QLCD 3KUYD 5CPIB 1N1JB 5B33D 3AV2C 3TU4B 4WU9B 4KGCA 1M1AA 5AVCD 4J8WC 3C1BC 1EQZC 3UTBD 3AN2C 5B1MA 3UT9A 3KSYA 3VH6A 3X1SA 3MGQC 1P3LB 4KUDD 4H9NB 3O62C 3WKJB 3AZLD 3KXBA 5AY8C 2AROD 4DRAA 3R45A 3UTAC 1AOIB 3AZJA 5GT3C 3AZED 5CPIC 4H9OB 5F99A 1B6WA 3MGPB 4R8PD 3TU4C 5G49B 3AZHB 4WU9C 1P3KB 3MNNB 1KX5A 1F66D 1F1EA 3REHB 1P3LC 3AZNB 4KHAA 4YM6A 3WKJC 1S32A 4X23B 4J8XA 1P3FD 3W98D 1M1AB 1P34A 1KX4A 5B24B 3LZ0B 4QLCA 3X1SB 3KUYA 1AOIC 5BT1C 5B33A 3AZGB 3V9RA 5AVCA 3MGPC 3W97B 3B6GD 3UTBA 3AZHC 1P3KC 3MNNC 4KUDA 3RELD 5AV6B 3AZLA 3LJAB 4H9SC 3REHC 3AZKB 3AZNC 4Z5TB 2AROA 4X23C 1M1AC 3B6FB 4LD9B 3AZEA 1BFMA 5B24C 3LZ0C 3X1SC 5GSUB 5B0ZB 4WZSB 4AWLB 5B2ID 3AZGC 4R8PA 1KX4B 2FJ7D 3W97C 1F66A 3WA9D 1BH9B 5B2JB 4QLCB 5AV6C 3LJAC 3AZKC 5DNMD 4Z5TC 3REJD 3W98A 4JJNB 5B0YD 1P3OB 4KUDB 1TZYB 3B6FC 4LD9C 5BNXB 3AZLB 3W99D 4J8VB 5GSUC 2F8NB 5GXQD 5B0ZC 4AWLC 3B6GA 2HIOD 5GT0D 1KX4C 3MGRB 5AV8B 1ULYA 5JRGD 3RELA 3AZEB 5B2JC 4QLCC 1P3ID 1M19D 4Z66B 3WTPB 5B31D 3AZIB 4JJNC 3AV1D 2CV5D 1P3OC 3NQUA 4KUDC 4WU8B 1TZYC 1P3MD 3AZLC 4J8VC 5B2IA 3AYWB 3W98B 2BYMB 2BYKB 2FJ7A 3WA9A 5B40B 3MGRC 4DRBA 5BNVA 5AV8C 3KWQD 3AZEC 3A6NB 3AFAD 3REID 1HTAA 1Q9CA 5CP6B 5B0YA 4Z66C 3WTPC 3AZIC 4H9QA 3WAAB 3VH6W 5B31G 5AV5D 3W99A 4WU8C 1P3GD 2F8NH 4NFTA 3C1CD 1TAFA 1BH8A 5GXQA 2HIOA 4Z2MH 5GT0A 5AVBD 3AYWC 4YS3B 3W98C 5JRGA 4CSRB 5JA4B 5B40C 3X1VB 3B0CW 4XZQD 1P3IA 3A6NC 1M19A 3W96B 2RVQD 5B31A 5CP6C 2FJ7B 3AV1A 4ZUXD 5CHLB 2CV5A 2IO5B 5CPKD 5KDMB 3WAAC 1P3MA 2NZDD 3VH5T 3X1UD 1M18D 4YS3C 3X1TD 4G92B 3KWQA 3X1VC 5DNND 3NQJA 3AFAA 3REIA 5CPJB 3AZFD 4WV4B 1BH8B 5FUGA 5GXQB 3MGSD 1JFIA 3W96C 4XUJD 2FJ7C 4J8UD 2IO5C 5AV5A 1U35D 3AZMD 1P3GA 4KGCB 3C1CA 5B1MB 3UT9B 1ZLAA 5AVBA 3WTPE 3MVDD 1P3AD 3KXBB 5B32D 2NQBD 4G92C 4XZQA 5B1LD 3R45B 3LELD 3REKD 5CPJC 3AZJB 5GXQC 4NE6A 4NE3A 4ZUXA 4UUZA 4CAYA 5F99B 5CPKA 2PYOD 1P3BD 2NZDA 4ZBJB 3NQJB 3X1UA 4KGCC 5FUGB 1B67A 1KX5B 3AV2D 5B1MC 3UT9C 1M18A 3X1TA 4KHAB 4YM6B 4J8WD 1WWIA 1EQZD 3KXBC 1S32B 3AN2D 3B0DB 4J8XB 4H9PA 3VH5A 5DNNA 1P3GB 1P3PD 1P34B 3AZFA 5B32G 3MGSA 1ZLAB 3KUYB 3AZJC 4XUJA 5BS7A 5B33B 4J8UA 3V9RB 5F99C 3UTAD 1U35A 5GT3D 3AZMA 1P3FA 5AVCB 4ZBJC 3UTBB 5CPID 3MVDA 1P3AA 1KX5C 3TU4D 4ZUXB 4WU9D 5B32A 2NQBA 4YM6C 2AROB 2YFVA 1S32C 5B1LA 3B0DC 4J8XC 3LELA 3REKA 1P3GC 1P3LD 1P34C 1M18B 1ZLAC 3KUYC 3X1TB 2PYOA 5B33C 1P3BA 4R8PB 5DNNB 5BT1D 3AZFB 1H3OA 5AVCC 1F66B 3AV2A 3UTBC 3MGPD 4J8WA 4ZUXC 1EQZA 4J8UB 3AN2A 3MNND 5AV9D 1P3FB 2AROC 1P3PA 3REHD 4WNNA 1KX3D 3AZND 4X23D 1M18C 3X1TC 5B32B 3UTAA 5DNMA 5GT3A 3REJA 5B24D 4R8PC 3LZ0D 3B6GB 3REKB 5DNNC 5CPIA 1A7WA 3B0CT 1N1JA 3AZFC 3RELB 1F66C 3AZGD 3LZ1D 3TU4A 4M6BA 4WU9A 2PYOB 3W97D 4J8UC 1P3FC 1P3LA 4H9NA 5AV6D 3LJAD 3AZKD 3NQUB 4Z5TD 5B2IB 5B32C 1P3PB 3B6FD 4LD9D 3WA9B 3B6GC 5GSUD 3REKC 4H9OA 5BNVB 5B0ZD 3RELC 3MGPA 5G49A 3MNNA 5DNMB 5AV9A 2PYOC 3REJB 5B0YB 5B2JD 4H9SA 4H9QB 3REHA 1KX3A 3AZNA 4X23A 3W99B 4JJND 1TAFB 5B2IC 5B24A 3LZ0A 5C3IB 1P3OD 2HIOB 5GT0B 1TZYD 1P3PC 1KU5A 2F8NK 5JRGB 4J8VD 3WA9C 2F8ND 3AZGA 3LZ1A 5E5AD 1P3IB 1ID3D 3W97A 1M19B 5DNMC 5AV8D 5B31B 3MGRD 3REJC 5B0YC 5AV6A 3AV1B 3LJAA 2CV5B 3AZKA 4Z5TA 1P3MB 4Z66D 3W99C 3WTPD 3AZID 5AV9B 3B6FA 4LD9A 3VH5W 2CWEA 5C3IC 2HIOC 5GSUA 5GT0C 4WU8D 1KX3B 5B0ZA 5JRGC 3KWQB 1HQ3D 3AYWD 3AFAB 3REIB 1P3IC 2F8NG 5B40D 1JFIB 1BH9A 1M19C 5B2JA 5B31C 4Z2MG 5BO0A 3AV1C 3C1BD 3A6ND 2CV5C 2LY8A 5AV5B 3LZ1B 4H9RA 3MGQD 5CP6D 4JJNA 3C1CB 3O62D 1P3MC 2L5AA 1P3OA 5AV9C 5AY8D 1TZYA 5AVBB 3WAAD 5BNXA 4J8VA 1KX3C 2F8NA 5E5AA 3KWQC 4XZQB 1R4VA 1ID3A 4YS3D 3AFAC 3REIC 3MGRA 5AV8A 3X1VD 4NE5A 4UUZB 4CAYB 5CPKB 3W96D 4G91B 3LZ1C 5AV5C 4Z66A 2NZDB 3WTPA 3AZIA 3X1UB 3C1CC 3WKJD 4WU8A 5AVBC 5BO0B 1HQ3A 4H9PB 4H9RB 1AOID 3AYWA 2BYMA 2BYKA 4XZQC 3MGSB 2JSSA 5B40A 2HUEB 2RVQC
chains in the Genus database with same CATH superfamily
4XUJB 4E45A 3C1BA 3A6NA 3AZHD 1P3KD 1U35B 5CPJD 5CPKC 5E5AB 3MGQA 3AZMB 4HGAB 5CP6A 4G91C 3O62A 1ID3B 2NZDC 3VH6T 3X1UC 5AY8A 3MVDB 1P3AB 3WAAA 4UPKA 2ZM5A 4EO5B 2ZY5A 3AL0C 2ZY2A 4KGCD 1M1AD 2NQBB 2YFVB 2YFWA 5B1LB 5B1MD 3UT9D 3B0BA 3X1SD 3LELB 4YS3A 3MGSC 4CSRA 5JA4A 3KXBD 3X1VA 2HUEC 4XUJC 5BS7C 2Y2OA 1HQ3B 3W96A 1P3BB 1WWSA 1U35C 3AZJD 5E5AC 3AZMC 4HGAC 1H3OB 1ID3C 3WKJA 2F2AC 3AV2B 5F99D 4E44A 5KDMA 3MVDC 1P3AC 4J8WB 3C1BB 4EO5C 1EQZB 3H0RC 3AN2B 2NQBC 1AOIA 2JCHA 3MGQB 1KX5D 5B1LC 3O62B 3LELC 4WNNB 5AY8B 4YM6D 1S32D 4J8XD 3AZHA 1P3KA 3UTAB 3EG5B 5CPJA 1P34D 1KX4D 2YFWB 5GT3B 1HQ3C 1P3BC 2Y2IA 1ZLAD 4QLCD 3KUYD 5CPIB 1N1JB 2FFFB 5B33D 3AV2C 3TU4B 4WU9B 4KGCA 1M1AA 5AVCD 4J8WC 3C1BC 1EQZC 3UTBD 3AN2C 5B1MA 3UT9A 3KSYA 3VH6A 3X1SA 3MGQC 1P3LB 4KUDD 4H9NB 3O62C 3WKJB 3AZLD 3KXBA 5AY8C 2AROD 2Y2QA 4DRAA 3R45A 3H0MC 3UTAC 1T3UA 3AZJA 1AOIB 5GT3C 3AZED 2Y2KA 5CPIC 4H9OB 5F99A 1B6WA 3MGPB 4R8PD 4DQYB 5G49B 3TU4C 3AZHB 4WU9C 1P3KB 3MNNB 3KFUG 1KX5A 1F66D 1F1EA 3REHB 1P3LC 3AZNB 4KHAA 4YM6A 3WKJC 1S32A 4X23B 4J8XA 1P3FD 3W98D 1M1AB 1P34A 1KX4A 2Y2HA 5B24B 3LZ0B 4QLCA 3X1SB 3KUYA 1AOIC 5BT1C 5B33A 2Y2MA 3AZGB 3V9RA 2ZY4A 5AVCA 3MGPC 3W97B 3B6GD 3UTBA 3AZHC 1P3KC 3MNNC 4KUDA 4WJ3C 3RELD 5AV6B 3AZLA 3LJAB 4H9SC 3REHC 3AZKB 3AZNC 4Z5TB 2AROA 4X23C 1M1AC 3B6FB 4LD9B 3AZEA 1BFMA 5B24C 3LZ0C 3X1SC 5GSUB 5B0ZB 3H0LC 4WZSB 4AWLB 5B2ID 3AZGC 4R8PA 1Z2CB 1KX4B 2FJ7D 3W97C 1F66A 3WA9D 1BH9B 5B2JB 4QLCB 2W8SA 2Y2PA 5AV6C 3LJAC 3AZKC 5DNMD 4Z5TC 3REJD 3W98A 4JJNB 5B0YD 1P3OB 4KUDB 1TZYB 3B6FC 4LD9C 2Y2NA 5BNXB 3AZLB 3W99D 4J8VB 5GSUC 2F8NB 5GXQD 5B0ZC 4AWLC 3B6GA 2HIOD 5GT0D 1KX4C 3MGRB 5AV8B 1ULYA 5JRGD 3RELA 3AZEB 5B2JC 4QLCC 1P3ID 1M19D 4Z66B 3WTPB 5B31D 3AZIB 4JJNC 3AV1D 2CV5D 1P3OC 3NQUA 4KUDC 4WU8B 1TZYC 1PZRA 1P3MD 3AZLC 4J8VC 5B2IA 3AYWB 3W98B 2BYMB 2BYKB 2FJ7A 3WA9A 5B40B 3MGRC 4DRBA 5BNVA 5AV8C 3KWQD 3AZEC 3A6NB 3AFAD 3REID 1HTAA 1Q9CA 5CP6B 5B0YA 4Z66C 3WTPC 3AZIC 4H9QA 3WAAB 3VH6W 5B31G 5AV5D 3W99A 4WU8C 1P3GD 2F8NH 4NFTA 3C1CD 1TAFA 1BH8A 5GXQA 2HIOA 4Z2MH 5GT0A 5AVBD 3AYWC 4YS3B 2DQNC 3W98C 5JRGA 4CSRB 5JA4B 5B40C 3X1VB 3B0CW 4XZQD 1P3IA 3A6NC 1M19A 3W96B 2RVQD 5B31A 5CP6C 2FJ7B 3AV1A 4ZUXD 5CHLB 2CV5A 2IO5B 5CPKD 2Y2LA 5KDMB 3WAAC 1P3MA 2NZDD 3VH5T 3X1UD 1M18D 4YS3C 3X1TD 4G92B 3KWQA 3EPHA 3A1KA 3X1VC 5DNND 3NQJA 3AFAA 3REIA 5CPJB 3AZFD 4WV4B 1BH8B 5FUGA 5GXQB 3MGSD 3EPKA 1JFIA 3W96C 4XUJD 2FJ7C 4J8UD 2IO5C 5AV5A 1U35D 3AZMD 1P3GA 4KGCB 3C1CA 5B1MB 3UT9B 1ZLAA 2ZY3A 5AVBA 3WTPE 3MVDD 1P3AD 3KXBB 5B32D 2NQBD 4G92C 4XZQA 5B1LD 3R45B 3LELD 3REKD 5CPJC 3AZJB 5GXQC 4NE6A 4NE3A 4ZUXA 4UUZA 4CAYA 2UWXA 2XD5A 5F99B 5CPKA 2PYOD 1P3BD 2NZDA 4ZBJB 2BG1A 3NQJB 3X1UA 4KGCC 5FUGB 1B67A 1KX5B 3AV2D 5B1MC 3UT9C 1M18A 3A1IA 3X1TA 4KHAB 4YM6B 4J8WD 1WWIA 1EQZD 3KXBC 1S32B 3AN2D 3B0DB 4J8XB 4H9PA 3VH5A 5DNNA 1P3GB 1P3PD 1P34B 3AZFA 5B32G 3MGSA 1ZLAB 3KUYB 3AZJC 4XUJA 3EPLA 5BS7A 5B33B 3F6TA 4J8UA 3V9RB 5F99C 3UTAD 1U35A 5GT3D 3AZMA 1P3FA 5AVCB 4ZBJC 3UTBB 5CPID 3MVDA 1P3AA 1KX5C 3TU4D 4ZUXB 4WU9D 5B32A 2NQBA 4YM6C 2AROB 2YFVA 1S32C 5B1LA 3B0DC 4J8XC 3LELA 3REKA 3EPJA 1P3GC 1P3LD 1P34C 2DF4C 1M18B 1ZLAC 3KUYC 3X1TB 2PYOA 3P5JB 5B33C 1P3BA 4R8PB 3FDDA 5DNNB 5BT1D 3AZFB 1H3OA 5AVCC 1F66B 3AV2A 3UTBC 3MGPD 4J8WA 4ZUXC 1EQZA 4J8UB 3AN2A 2VQRA 3MNND 5AV9D 1P3FB 2AROC 2G5HC 1P3PA 3REHD 4WNNA 1KX3D 3AZND 4X23D 1M18C 3X1TC 5B32B 3UTAA 5DNMA 5GT3A 3REJA 5B24D 4R8PC 3LZ0D 3B6GB 3REKB 5DNNC 5CPIA 1A7WA 3B0CT 1N1JA 3AZFC 3RELB 1F66C 3AZGD 3LZ1D 3TU4A 4M6BA 4WU9A 2PYOB 3W97D 4J8UC 1P3FC 1P3LA 4H9NA 5AV6D 3IP4C 3LJAD 2JE5A 3NQUB 3AZKD 4Z5TD 5B2IB 5B32C 1P3PB 3B6FD 4LD9D 3WA9B 3B6GC 5GSUD 3REKC 2G5IC 4H9OA 5BNVB 5B0ZD 3RELC 3MGPA 5G49A 3MNNA 5DNMB 5AV9A 2PYOC 3REJB 5B0YB 5B2JD 4H9SA 4H9QB 2XD1A 3REHA 3AZNA 1KX3A 2RIQA 4X23A 3W99B 4JJND 1TAFB 5B2IC 5B24A 3LZ0A 5C3IB 1P3OD 2HIOB 5GT0B 1TZYD 1P3PC 1KU5A 2F8NK 5JRGB 4J8VD 3WA9C 2F8ND 3AZGA 3LZ1A 5E5AD 1P3IB 1ID3D 3W97A 1M19B 5DNMC 5AV8D 5B31B 3MGRD 3REJC 5B0YC 5AV6A 2J8PA 3AV1B 3LJAA 2CV5B 3AZKA 4Z5TA 1P3MB 4Z66D 3W99C 3WTPD 3AZID 5AV9B 3B6FA 4LD9A 3VH5W 2CWEA 5C3IC 2HIOC 5GSUA 5GT0C 4WU8D 1KX3B 5B0ZA 5JRGC 3KWQB 1HQ3D 3AYWD 3AFAB 3REIB 1P3IC 2F8NG 5B40D 1JFIB 1BH9A 1M19C 5B2JA 5B31C 4Z2MG 5BO0A 3AV1C 3C1BD 3A6ND 2CV5C 2LY8A 5AV5B 3LZ1B 4H9RA 3MGQD 1W2EA 5CP6D 4JJNA 3C1CB 3O62D 1P3MC 2L5AA 1P3OA 5AV9C 5AY8D 1TZYA 5AVBB 3WAAD 5BNXA 4J8VA 1KX3C 2F8NA 5E5AA 3KWQC 4XZQB 1R4VA 1ID3A 4YS3D 3AFAC 3REIC 3MGRA 5AV8A 3X1VD 4NE5A 4UUZB 2Y2GA 4CAYB 5CPKB 3W96D 4G91B 3LZ1C 5AV5C 4Z66A 2NZDB 2Y2JA 3WTPA 3AZIA 3X1UB 3C1CC 3WKJD 4WU8A 5AVBC 5BO0B 1HQ3A 4H9PB 4H9RB 1AOID 3AYWA 2BYMA 2BYKA 4XZQC 3MGSB 2JSSA 5B40A 2HUEB 2RVQC
chains in the Genus database with same CATH topology
4XUJB 4E45A 3C1BA 3A6NA 3AZHD 1P3KD 1U35B 5CPJD 5CPKC 5E5AB 3MGQA 3AZMB 4HGAB 5CP6A 4G91C 3O62A 1ID3B 2NZDC 3VH6T 3X1UC 5AY8A 3MVDB 1P3AB 3WAAA 4UPKA 2ZM5A 4EO5B 2ZY5A 3AL0C 2ZY2A 4KGCD 1M1AD 2NQBB 2YFVB 2YFWA 5B1LB 5B1MD 3UT9D 3B0BA 3X1SD 3LELB 4YS3A 3MGSC 4CSRA 5JA4A 3KXBD 3X1VA 2HUEC 4XUJC 5BS7C 2Y2OA 1HQ3B 3W96A 1P3BB 1WWSA 1U35C 3AZJD 5E5AC 3AZMC 4HGAC 1H3OB 1ID3C 3WKJA 2F2AC 3AV2B 5F99D 4E44A 5KDMA 3MVDC 1P3AC 4J8WB 3C1BB 4EO5C 1EQZB 3H0RC 3AN2B 2NQBC 1AOIA 2JCHA 3MGQB 1KX5D 5B1LC 3O62B 3LELC 4WNNB 5AY8B 4YM6D 1S32D 4J8XD 3AZHA 1P3KA 3UTAB 3EG5B 5CPJA 1P34D 1KX4D 2YFWB 5GT3B 1HQ3C 1P3BC 2Y2IA 1ZLAD 4QLCD 3KUYD 5CPIB 1N1JB 2FFFB 5B33D 3AV2C 3TU4B 4WU9B 4KGCA 1M1AA 5AVCD 4J8WC 3C1BC 1EQZC 3UTBD 3AN2C 5B1MA 3UT9A 3KSYA 3VH6A 3X1SA 3MGQC 1P3LB 4KUDD 4H9NB 3O62C 3WKJB 3AZLD 3KXBA 5AY8C 2AROD 2Y2QA 4DRAA 3R45A 3H0MC 3UTAC 1T3UA 3AZJA 1AOIB 5GT3C 3AZED 2Y2KA 5CPIC 4H9OB 5F99A 1B6WA 3MGPB 4R8PD 4DQYB 5G49B 3TU4C 3AZHB 4WU9C 1P3KB 3MNNB 3KFUG 1KX5A 1F66D 1F1EA 3REHB 1P3LC 3AZNB 4KHAA 4YM6A 3WKJC 1S32A 4X23B 4J8XA 1P3FD 3W98D 1M1AB 1P34A 1KX4A 2Y2HA 5B24B 3LZ0B 4QLCA 3X1SB 3KUYA 1AOIC 5BT1C 5B33A 2Y2MA 3AZGB 3V9RA 2ZY4A 5AVCA 3MGPC 3W97B 3B6GD 3UTBA 3AZHC 1P3KC 3MNNC 4KUDA 4WJ3C 3RELD 5AV6B 3AZLA 3LJAB 4H9SC 3REHC 3AZKB 3AZNC 4Z5TB 2AROA 4X23C 1M1AC 3B6FB 4LD9B 3AZEA 1BFMA 5B24C 3LZ0C 3X1SC 5GSUB 5B0ZB 3H0LC 4WZSB 4AWLB 5B2ID 3AZGC 4R8PA 1Z2CB 1KX4B 2FJ7D 3W97C 1F66A 3WA9D 1BH9B 5B2JB 4QLCB 2W8SA 2Y2PA 5AV6C 3LJAC 3AZKC 5DNMD 4Z5TC 3REJD 3W98A 4JJNB 5B0YD 1P3OB 4KUDB 1TZYB 3B6FC 4LD9C 2Y2NA 5BNXB 3AZLB 3W99D 4J8VB 5GSUC 2F8NB 5GXQD 5B0ZC 4AWLC 3B6GA 2HIOD 5GT0D 1KX4C 3MGRB 5AV8B 1ULYA 5JRGD 3RELA 3AZEB 5B2JC 4QLCC 1P3ID 1M19D 4Z66B 3WTPB 5B31D 3AZIB 4JJNC 3AV1D 2CV5D 1P3OC 3NQUA 4KUDC 4WU8B 1TZYC 1PZRA 1P3MD 3AZLC 4J8VC 5B2IA 3AYWB 3W98B 2BYMB 2BYKB 2FJ7A 3WA9A 5B40B 3MGRC 4DRBA 5BNVA 5AV8C 3KWQD 3AZEC 3A6NB 3AFAD 3REID 1HTAA 1Q9CA 5CP6B 5B0YA 4Z66C 3WTPC 3AZIC 4H9QA 3WAAB 3VH6W 5B31G 5AV5D 3W99A 4WU8C 1P3GD 2F8NH 4NFTA 3C1CD 1TAFA 1BH8A 5GXQA 2HIOA 4Z2MH 5GT0A 5AVBD 3AYWC 4YS3B 2DQNC 3W98C 5JRGA 4CSRB 5JA4B 5B40C 3X1VB 3B0CW 4XZQD 1P3IA 3A6NC 1M19A 3W96B 2RVQD 5B31A 5CP6C 2FJ7B 3AV1A 4ZUXD 5CHLB 2CV5A 2IO5B 5CPKD 2Y2LA 5KDMB 3WAAC 1P3MA 2NZDD 3VH5T 3X1UD 1M18D 4YS3C 3X1TD 4G92B 3KWQA 3EPHA 3A1KA 3X1VC 5DNND 3NQJA 3AFAA 3REIA 5CPJB 3AZFD 4WV4B 1BH8B 5FUGA 5GXQB 3MGSD 3EPKA 1JFIA 3W96C 4XUJD 2FJ7C 4J8UD 2IO5C 5AV5A 1U35D 3AZMD 1P3GA 4KGCB 3C1CA 5B1MB 3UT9B 1ZLAA 2ZY3A 5AVBA 3WTPE 3MVDD 1P3AD 3KXBB 5B32D 2NQBD 4G92C 4XZQA 5B1LD 3R45B 3LELD 3REKD 5CPJC 3AZJB 5GXQC 4NE6A 4NE3A 4ZUXA 4UUZA 4CAYA 2UWXA 2XD5A 5F99B 5CPKA 2PYOD 1P3BD 2NZDA 4ZBJB 2BG1A 3NQJB 3X1UA 4KGCC 5FUGB 1B67A 1KX5B 3AV2D 5B1MC 3UT9C 1M18A 3A1IA 3X1TA 4KHAB 4YM6B 4J8WD 1WWIA 1EQZD 3KXBC 1S32B 3AN2D 3B0DB 4J8XB 4H9PA 3VH5A 5DNNA 1P3GB 1P3PD 1P34B 3AZFA 5B32G 3MGSA 1ZLAB 3KUYB 3AZJC 4XUJA 3EPLA 5BS7A 5B33B 3F6TA 4J8UA 3V9RB 5F99C 3UTAD 1U35A 5GT3D 3AZMA 1P3FA 5AVCB 4ZBJC 3UTBB 5CPID 3MVDA 1P3AA 1KX5C 3TU4D 4ZUXB 4WU9D 5B32A 2NQBA 4YM6C 2AROB 2YFVA 1S32C 5B1LA 3B0DC 4J8XC 3LELA 3REKA 3EPJA 1P3GC 1P3LD 1P34C 2DF4C 1M18B 1ZLAC 3KUYC 3X1TB 2PYOA 3P5JB 5B33C 1P3BA 4R8PB 3FDDA 5DNNB 5BT1D 3AZFB 1H3OA 5AVCC 1F66B 3AV2A 3UTBC 3MGPD 4J8WA 4ZUXC 1EQZA 4J8UB 3AN2A 2VQRA 3MNND 5AV9D 1P3FB 2AROC 2G5HC 1P3PA 3REHD 4WNNA 1KX3D 3AZND 4X23D 1M18C 3X1TC 5B32B 3UTAA 5DNMA 5GT3A 3REJA 5B24D 4R8PC 3LZ0D 3B6GB 3REKB 5DNNC 5CPIA 1A7WA 3B0CT 1N1JA 3AZFC 3RELB 1F66C 3AZGD 3LZ1D 3TU4A 4M6BA 4WU9A 2PYOB 3W97D 4J8UC 1P3FC 1P3LA 4H9NA 5AV6D 3IP4C 3LJAD 2JE5A 3NQUB 3AZKD 4Z5TD 5B2IB 5B32C 1P3PB 3B6FD 4LD9D 3WA9B 3B6GC 5GSUD 3REKC 2G5IC 4H9OA 5BNVB 5B0ZD 3RELC 3MGPA 5G49A 3MNNA 5DNMB 5AV9A 2PYOC 3REJB 5B0YB 5B2JD 4H9SA 4H9QB 2XD1A 3REHA 3AZNA 1KX3A 2RIQA 4X23A 3W99B 4JJND 1TAFB 5B2IC 5B24A 3LZ0A 5C3IB 1P3OD 2HIOB 5GT0B 1TZYD 1P3PC 1KU5A 2F8NK 5JRGB 4J8VD 3WA9C 2F8ND 3AZGA 3LZ1A 5E5AD 1P3IB 1ID3D 3W97A 1M19B 5DNMC 5AV8D 5B31B 3MGRD 3REJC 5B0YC 5AV6A 2J8PA 3AV1B 3LJAA 2CV5B 3AZKA 4Z5TA 1P3MB 4Z66D 3W99C 3WTPD 3AZID 5AV9B 3B6FA 4LD9A 3VH5W 2CWEA 5C3IC 2HIOC 5GSUA 5GT0C 4WU8D 1KX3B 5B0ZA 5JRGC 3KWQB 1HQ3D 3AYWD 3AFAB 3REIB 1P3IC 2F8NG 5B40D 1JFIB 1BH9A 1M19C 5B2JA 5B31C 4Z2MG 5BO0A 3AV1C 3C1BD 3A6ND 2CV5C 2LY8A 5AV5B 3LZ1B 4H9RA 3MGQD 1W2EA 5CP6D 4JJNA 3C1CB 3O62D 1P3MC 2L5AA 1P3OA 5AV9C 5AY8D 1TZYA 5AVBB 3WAAD 5BNXA 4J8VA 1KX3C 2F8NA 5E5AA 3KWQC 4XZQB 1R4VA 1ID3A 4YS3D 3AFAC 3REIC 3MGRA 5AV8A 3X1VD 4NE5A 4UUZB 2Y2GA 4CAYB 5CPKB 3W96D 4G91B 3LZ1C 5AV5C 4Z66A 2NZDB 2Y2JA 3WTPA 3AZIA 3X1UB 3C1CC 3WKJD 4WU8A 5AVBC 5BO0B 1HQ3A 4H9PB 4H9RB 1AOID 3AYWA 2BYMA 2BYKA 4XZQC 3MGSB 2JSSA 5B40A 2HUEB 2RVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ B;  4E45 A;  3C1B A;  3A6N A;  3AZH D;  1P3K D;  1U35 B;  5CPJ D;  5CPK C;  5E5A B;  3MGQ A;  3AZM B;  4HGA B;  5CP6 A;  4G91 C;  3O62 A;  1ID3 B;  2NZD C;  3VH6 T;  3X1U C;  5AY8 A;  3MVD B;  1P3A B;  3WAA A;  4EO5 B;  4KGC D;  1M1A D;  2NQB B;  2YFV B;  2YFW A;  5B1L B;  5B1M D;  3UT9 D;  3B0B A;  3X1S D;  3LEL B;  4YS3 A;  3MGS C;  4CSR A;  5JA4 A;  3KXB D;  3X1V A;  2HUE C;  4XUJ C;  5BS7 C;  1HQ3 B;  3W96 A;  1P3B B;  1WWS A;  1U35 C;  3AZJ D;  5E5A C;  3AZM C;  4HGA C;  1H3O B;  1ID3 C;  3WKJ A;  3AV2 B;  5F99 D;  4E44 A;  5KDM A;  3MVD C;  1P3A C;  4J8W B;  3C1B B;  4EO5 C;  1EQZ B;  3AN2 B;  2NQB C;  1AOI A;  3MGQ B;  1KX5 D;  5B1L C;  3O62 B;  3LEL C;  4WNN B;  5AY8 B;  4YM6 D;  1S32 D;  4J8X D;  3AZH A;  1P3K A;  3UTA B;  5CPJ A;  1P34 D;  1KX4 D;  2YFW B;  5GT3 B;  1HQ3 C;  1P3B C;  1ZLA D;  4QLC D;  3KUY D;  5CPI B;  1N1J B;  5B33 D;  3AV2 C;  3TU4 B;  4WU9 B;  4KGC A;  1M1A A;  5AVC D;  4J8W C;  3C1B C;  1EQZ C;  3UTB D;  3AN2 C;  5B1M A;  3UT9 A;  3KSY A;  3VH6 A;  3X1S A;  3MGQ C;  1P3L B;  4KUD D;  4H9N B;  3O62 C;  3WKJ B;  3AZL D;  3KXB A;  5AY8 C;  2ARO D;  4DRA A;  3R45 A;  3UTA C;  1AOI B;  3AZJ A;  5GT3 C;  3AZE D;  5CPI C;  4H9O B;  5F99 A;  1B6W A;  3MGP B;  4R8P D;  3TU4 C;  5G49 B;  3AZH B;  4WU9 C;  1P3K B;  3MNN B;  1KX5 A;  1F66 D;  1F1E A;  3REH B;  1P3L C;  3AZN B;  4KHA A;  4YM6 A;  3WKJ C;  1S32 A;  4X23 B;  4J8X A;  1P3F D;  3W98 D;  1M1A B;  1P34 A;  1KX4 A;  5B24 B;  3LZ0 B;  4QLC A;  3X1S B;  3KUY A;  1AOI C;  5BT1 C;  5B33 A;  3AZG B;  3V9R A;  5AVC A;  3MGP C;  3W97 B;  3B6G D;  3UTB A;  3AZH C;  1P3K C;  3MNN C;  4KUD A;  3REL D;  5AV6 B;  3AZL A;  3LJA B;  4H9S C;  3REH C;  3AZK B;  3AZN C;  4Z5T B;  2ARO A;  4X23 C;  1M1A C;  3B6F B;  4LD9 B;  3AZE A;  1BFM A;  5B24 C;  3LZ0 C;  3X1S C;  5GSU B;  5B0Z B;  4WZS B;  4AWL B;  5B2I D;  3AZG C;  4R8P A;  1KX4 B;  2FJ7 D;  3W97 C;  1F66 A;  3WA9 D;  1BH9 B;  5B2J B;  4QLC B;  5AV6 C;  3LJA C;  3AZK C;  5DNM D;  4Z5T C;  3REJ D;  3W98 A;  4JJN B;  5B0Y D;  1P3O B;  4KUD B;  1TZY B;  3B6F C;  4LD9 C;  5BNX B;  3AZL B;  3W99 D;  4J8V B;  5GSU C;  2F8N B;  5GXQ D;  5B0Z C;  4AWL C;  3B6G A;  2HIO D;  5GT0 D;  1KX4 C;  3MGR B;  5AV8 B;  1ULY A;  5JRG D;  3REL A;  3AZE B;  5B2J C;  4QLC C;  1P3I D;  1M19 D;  4Z66 B;  3WTP B;  5B31 D;  3AZI B;  4JJN C;  3AV1 D;  2CV5 D;  1P3O C;  3NQU A;  4KUD C;  4WU8 B;  1TZY C;  1P3M D;  3AZL C;  4J8V C;  5B2I A;  3AYW B;  3W98 B;  2BYM B;  2BYK B;  2FJ7 A;  3WA9 A;  5B40 B;  3MGR C;  4DRB A;  5BNV A;  5AV8 C;  3KWQ D;  3AZE C;  3A6N B;  3AFA D;  3REI D;  1HTA A;  1Q9C A;  5CP6 B;  5B0Y A;  4Z66 C;  3WTP C;  3AZI C;  4H9Q A;  3WAA B;  3VH6 W;  5B31 G;  5AV5 D;  3W99 A;  4WU8 C;  1P3G D;  2F8N H;  4NFT A;  3C1C D;  1TAF A;  1BH8 A;  5GXQ A;  2HIO A;  4Z2M H;  5GT0 A;  5AVB D;  3AYW C;  4YS3 B;  3W98 C;  5JRG A;  4CSR B;  5JA4 B;  5B40 C;  3X1V B;  3B0C W;  4XZQ D;  1P3I A;  3A6N C;  1M19 A;  3W96 B;  2RVQ D;  5B31 A;  5CP6 C;  2FJ7 B;  3AV1 A;  4ZUX D;  5CHL B;  2CV5 A;  2IO5 B;  5CPK D;  5KDM B;  3WAA C;  1P3M A;  2NZD D;  3VH5 T;  3X1U D;  1M18 D;  4YS3 C;  3X1T D;  4G92 B;  3KWQ A;  3X1V C;  5DNN D;  3NQJ A;  3AFA A;  3REI A;  5CPJ B;  3AZF D;  4WV4 B;  1BH8 B;  5FUG A;  5GXQ B;  3MGS D;  1JFI A;  3W96 C;  4XUJ D;  2FJ7 C;  4J8U D;  2IO5 C;  5AV5 A;  1U35 D;  3AZM D;  1P3G A;  4KGC B;  3C1C A;  5B1M B;  3UT9 B;  1ZLA A;  5AVB A;  3WTP E;  3MVD D;  1P3A D;  3KXB B;  5B32 D;  2NQB D;  4G92 C;  4XZQ A;  5B1L D;  3R45 B;  3LEL D;  3REK D;  5CPJ C;  3AZJ B;  5GXQ C;  4NE6 A;  4NE3 A;  4ZUX A;  4UUZ A;  4CAY A;  5F99 B;  5CPK A;  2PYO D;  1P3B D;  2NZD A;  4ZBJ B;  3NQJ B;  3X1U A;  4KGC C;  5FUG B;  1B67 A;  1KX5 B;  3AV2 D;  5B1M C;  3UT9 C;  1M18 A;  3X1T A;  4KHA B;  4YM6 B;  4J8W D;  1WWI A;  1EQZ D;  3KXB C;  1S32 B;  3AN2 D;  3B0D B;  4J8X B;  4H9P A;  3VH5 A;  5DNN A;  1P3G B;  1P3P D;  1P34 B;  3AZF A;  5B32 G;  3MGS A;  1ZLA B;  3KUY B;  3AZJ C;  4XUJ A;  5BS7 A;  5B33 B;  4J8U A;  3V9R B;  5F99 C;  3UTA D;  1U35 A;  5GT3 D;  3AZM A;  1P3F A;  5AVC B;  4ZBJ C;  3UTB B;  5CPI D;  3MVD A;  1P3A A;  1KX5 C;  3TU4 D;  4ZUX B;  4WU9 D;  5B32 A;  2NQB A;  4YM6 C;  2ARO B;  2YFV A;  1S32 C;  5B1L A;  3B0D C;  4J8X C;  3LEL A;  3REK A;  1P3G C;  1P3L D;  1P34 C;  1M18 B;  1ZLA C;  3KUY C;  3X1T B;  2PYO A;  5B33 C;  1P3B A;  4R8P B;  5DNN B;  5BT1 D;  3AZF B;  1H3O A;  5AVC C;  1F66 B;  3AV2 A;  3UTB C;  3MGP D;  4J8W A;  4ZUX C;  1EQZ A;  4J8U B;  3AN2 A;  3MNN D;  5AV9 D;  1P3F B;  2ARO C;  1P3P A;  3REH D;  4WNN A;  1KX3 D;  3AZN D;  4X23 D;  1M18 C;  3X1T C;  5B32 B;  3UTA A;  5DNM A;  5GT3 A;  3REJ A;  5B24 D;  4R8P C;  3LZ0 D;  3B6G B;  3REK B;  5DNN C;  5CPI A;  1A7W A;  3B0C T;  1N1J A;  3AZF C;  3REL B;  1F66 C;  3AZG D;  3LZ1 D;  3TU4 A;  4M6B A;  4WU9 A;  2PYO B;  3W97 D;  4J8U C;  1P3F C;  1P3L A;  4H9N A;  5AV6 D;  3LJA D;  3AZK D;  3NQU B;  4Z5T D;  5B2I B;  5B32 C;  1P3P B;  3B6F D;  4LD9 D;  3WA9 B;  3B6G C;  5GSU D;  3REK C;  4H9O A;  5BNV B;  5B0Z D;  3REL C;  3MGP A;  5G49 A;  3MNN A;  5DNM B;  5AV9 A;  2PYO C;  3REJ B;  5B0Y B;  5B2J D;  4H9S A;  4H9Q B;  3REH A;  1KX3 A;  3AZN A;  4X23 A;  3W99 B;  4JJN D;  1TAF B;  5B2I C;  5B24 A;  3LZ0 A;  5C3I B;  1P3O D;  2HIO B;  5GT0 B;  1TZY D;  1P3P C;  1KU5 A;  2F8N K;  5JRG B;  4J8V D;  3WA9 C;  2F8N D;  3AZG A;  3LZ1 A;  5E5A D;  1P3I B;  1ID3 D;  3W97 A;  1M19 B;  5DNM C;  5AV8 D;  5B31 B;  3MGR D;  3REJ C;  5B0Y C;  5AV6 A;  3AV1 B;  3LJA A;  2CV5 B;  3AZK A;  4Z5T A;  1P3M B;  4Z66 D;  3W99 C;  3WTP D;  3AZI D;  5AV9 B;  3B6F A;  4LD9 A;  3VH5 W;  2CWE A;  5C3I C;  2HIO C;  5GSU A;  5GT0 C;  4WU8 D;  1KX3 B;  5B0Z A;  5JRG C;  3KWQ B;  1HQ3 D;  3AYW D;  3AFA B;  3REI B;  1P3I C;  2F8N G;  5B40 D;  1JFI B;  1BH9 A;  1M19 C;  5B2J A;  5B31 C;  4Z2M G;  5BO0 A;  3AV1 C;  3C1B D;  3A6N D;  2CV5 C;  2LY8 A;  5AV5 B;  3LZ1 B;  4H9R A;  3MGQ D;  5CP6 D;  4JJN A;  3C1C B;  3O62 D;  1P3M C;  2L5A A;  1P3O A;  5AV9 C;  5AY8 D;  1TZY A;  5AVB B;  3WAA D;  5BNX A;  4J8V A;  1KX3 C;  2F8N A;  5E5A A;  3KWQ C;  4XZQ B;  1R4V A;  1ID3 A;  4YS3 D;  3AFA C;  3REI C;  3MGR A;  5AV8 A;  3X1V D;  4NE5 A;  4UUZ B;  4CAY B;  5CPK B;  3W96 D;  4G91 B;  3LZ1 C;  5AV5 C;  4Z66 A;  2NZD B;  3WTP A;  3AZI A;  3X1U B;  3C1C C;  3WKJ D;  4WU8 A;  5AVB C;  5BO0 B;  1HQ3 A;  4H9P B;  4H9R B;  1AOI D;  3AYW A;  2BYM A;  2BYK A;  4XZQ C;  3MGS B;  2JSS A;  5B40 A;  2HUE B;  2RVQ C; 
#chains in the Genus database with same CATH topology
 4XUJ B;  4E45 A;  3C1B A;  3A6N A;  3AZH D;  1P3K D;  1U35 B;  5CPJ D;  5CPK C;  5E5A B;  3MGQ A;  3AZM B;  4HGA B;  5CP6 A;  4G91 C;  3O62 A;  1ID3 B;  2NZD C;  3VH6 T;  3X1U C;  5AY8 A;  3MVD B;  1P3A B;  3WAA A;  4UPK A;  2ZM5 A;  4EO5 B;  2ZY5 A;  3AL0 C;  2ZY2 A;  4KGC D;  1M1A D;  2NQB B;  2YFV B;  2YFW A;  5B1L B;  5B1M D;  3UT9 D;  3B0B A;  3X1S D;  3LEL B;  4YS3 A;  3MGS C;  4CSR A;  5JA4 A;  3KXB D;  3X1V A;  2HUE C;  4XUJ C;  5BS7 C;  2Y2O A;  1HQ3 B;  3W96 A;  1P3B B;  1WWS A;  1U35 C;  3AZJ D;  5E5A C;  3AZM C;  4HGA C;  1H3O B;  1ID3 C;  3WKJ A;  2F2A C;  3AV2 B;  5F99 D;  4E44 A;  5KDM A;  3MVD C;  1P3A C;  4J8W B;  3C1B B;  4EO5 C;  1EQZ B;  3H0R C;  3AN2 B;  2NQB C;  1AOI A;  2JCH A;  3MGQ B;  1KX5 D;  5B1L C;  3O62 B;  3LEL C;  4WNN B;  5AY8 B;  4YM6 D;  1S32 D;  4J8X D;  3AZH A;  1P3K A;  3UTA B;  3EG5 B;  5CPJ A;  1P34 D;  1KX4 D;  2YFW B;  5GT3 B;  1HQ3 C;  1P3B C;  2Y2I A;  1ZLA D;  4QLC D;  3KUY D;  5CPI B;  1N1J B;  2FFF B;  5B33 D;  3AV2 C;  3TU4 B;  4WU9 B;  4KGC A;  1M1A A;  5AVC D;  4J8W C;  3C1B C;  1EQZ C;  3UTB D;  3AN2 C;  5B1M A;  3UT9 A;  3KSY A;  3VH6 A;  3X1S A;  3MGQ C;  1P3L B;  4KUD D;  4H9N B;  3O62 C;  3WKJ B;  3AZL D;  3KXB A;  5AY8 C;  2ARO D;  2Y2Q A;  4DRA A;  3R45 A;  3H0M C;  3UTA C;  1T3U A;  3AZJ A;  1AOI B;  5GT3 C;  3AZE D;  2Y2K A;  5CPI C;  4H9O B;  5F99 A;  1B6W A;  3MGP B;  4R8P D;  4DQY B;  5G49 B;  3TU4 C;  3AZH B;  4WU9 C;  1P3K B;  3MNN B;  3KFU G;  1KX5 A;  1F66 D;  1F1E A;  3REH B;  1P3L C;  3AZN B;  4KHA A;  4YM6 A;  3WKJ C;  1S32 A;  4X23 B;  4J8X A;  1P3F D;  3W98 D;  1M1A B;  1P34 A;  1KX4 A;  2Y2H A;  5B24 B;  3LZ0 B;  4QLC A;  3X1S B;  3KUY A;  1AOI C;  5BT1 C;  5B33 A;  2Y2M A;  3AZG B;  3V9R A;  2ZY4 A;  5AVC A;  3MGP C;  3W97 B;  3B6G D;  3UTB A;  3AZH C;  1P3K C;  3MNN C;  4KUD A;  4WJ3 C;  3REL D;  5AV6 B;  3AZL A;  3LJA B;  4H9S C;  3REH C;  3AZK B;  3AZN C;  4Z5T B;  2ARO A;  4X23 C;  1M1A C;  3B6F B;  4LD9 B;  3AZE A;  1BFM A;  5B24 C;  3LZ0 C;  3X1S C;  5GSU B;  5B0Z B;  3H0L C;  4WZS B;  4AWL B;  5B2I D;  3AZG C;  4R8P A;  1Z2C B;  1KX4 B;  2FJ7 D;  3W97 C;  1F66 A;  3WA9 D;  1BH9 B;  5B2J B;  4QLC B;  2W8S A;  2Y2P A;  5AV6 C;  3LJA C;  3AZK C;  5DNM D;  4Z5T C;  3REJ D;  3W98 A;  4JJN B;  5B0Y D;  1P3O B;  4KUD B;  1TZY B;  3B6F C;  4LD9 C;  2Y2N A;  5BNX B;  3AZL B;  3W99 D;  4J8V B;  5GSU C;  2F8N B;  5GXQ D;  5B0Z C;  4AWL C;  3B6G A;  2HIO D;  5GT0 D;  1KX4 C;  3MGR B;  5AV8 B;  1ULY A;  5JRG D;  3REL A;  3AZE B;  5B2J C;  4QLC C;  1P3I D;  1M19 D;  4Z66 B;  3WTP B;  5B31 D;  3AZI B;  4JJN C;  3AV1 D;  2CV5 D;  1P3O C;  3NQU A;  4KUD C;  4WU8 B;  1TZY C;  1PZR A;  1P3M D;  3AZL C;  4J8V C;  5B2I A;  3AYW B;  3W98 B;  2BYM B;  2BYK B;  2FJ7 A;  3WA9 A;  5B40 B;  3MGR C;  4DRB A;  5BNV A;  5AV8 C;  3KWQ D;  3AZE C;  3A6N B;  3AFA D;  3REI D;  1HTA A;  1Q9C A;  5CP6 B;  5B0Y A;  4Z66 C;  3WTP C;  3AZI C;  4H9Q A;  3WAA B;  3VH6 W;  5B31 G;  5AV5 D;  3W99 A;  4WU8 C;  1P3G D;  2F8N H;  4NFT A;  3C1C D;  1TAF A;  1BH8 A;  5GXQ A;  2HIO A;  4Z2M H;  5GT0 A;  5AVB D;  3AYW C;  4YS3 B;  2DQN C;  3W98 C;  5JRG A;  4CSR B;  5JA4 B;  5B40 C;  3X1V B;  3B0C W;  4XZQ D;  1P3I A;  3A6N C;  1M19 A;  3W96 B;  2RVQ D;  5B31 A;  5CP6 C;  2FJ7 B;  3AV1 A;  4ZUX D;  5CHL B;  2CV5 A;  2IO5 B;  5CPK D;  2Y2L A;  5KDM B;  3WAA C;  1P3M A;  2NZD D;  3VH5 T;  3X1U D;  1M18 D;  4YS3 C;  3X1T D;  4G92 B;  3KWQ A;  3EPH A;  3A1K A;  3X1V C;  5DNN D;  3NQJ A;  3AFA A;  3REI A;  5CPJ B;  3AZF D;  4WV4 B;  1BH8 B;  5FUG A;  5GXQ B;  3MGS D;  3EPK A;  1JFI A;  3W96 C;  4XUJ D;  2FJ7 C;  4J8U D;  2IO5 C;  5AV5 A;  1U35 D;  3AZM D;  1P3G A;  4KGC B;  3C1C A;  5B1M B;  3UT9 B;  1ZLA A;  2ZY3 A;  5AVB A;  3WTP E;  3MVD D;  1P3A D;  3KXB B;  5B32 D;  2NQB D;  4G92 C;  4XZQ A;  5B1L D;  3R45 B;  3LEL D;  3REK D;  5CPJ C;  3AZJ B;  5GXQ C;  4NE6 A;  4NE3 A;  4ZUX A;  4UUZ A;  4CAY A;  2UWX A;  2XD5 A;  5F99 B;  5CPK A;  2PYO D;  1P3B D;  2NZD A;  4ZBJ B;  2BG1 A;  3NQJ B;  3X1U A;  4KGC C;  5FUG B;  1B67 A;  1KX5 B;  3AV2 D;  5B1M C;  3UT9 C;  1M18 A;  3A1I A;  3X1T A;  4KHA B;  4YM6 B;  4J8W D;  1WWI A;  1EQZ D;  3KXB C;  1S32 B;  3AN2 D;  3B0D B;  4J8X B;  4H9P A;  3VH5 A;  5DNN A;  1P3G B;  1P3P D;  1P34 B;  3AZF A;  5B32 G;  3MGS A;  1ZLA B;  3KUY B;  3AZJ C;  4XUJ A;  3EPL A;  5BS7 A;  5B33 B;  3F6T A;  4J8U A;  3V9R B;  5F99 C;  3UTA D;  1U35 A;  5GT3 D;  3AZM A;  1P3F A;  5AVC B;  4ZBJ C;  3UTB B;  5CPI D;  3MVD A;  1P3A A;  1KX5 C;  3TU4 D;  4ZUX B;  4WU9 D;  5B32 A;  2NQB A;  4YM6 C;  2ARO B;  2YFV A;  1S32 C;  5B1L A;  3B0D C;  4J8X C;  3LEL A;  3REK A;  3EPJ A;  1P3G C;  1P3L D;  1P34 C;  2DF4 C;  1M18 B;  1ZLA C;  3KUY C;  3X1T B;  2PYO A;  3P5J B;  5B33 C;  1P3B A;  4R8P B;  3FDD A;  5DNN B;  5BT1 D;  3AZF B;  1H3O A;  5AVC C;  1F66 B;  3AV2 A;  3UTB C;  3MGP D;  4J8W A;  4ZUX C;  1EQZ A;  4J8U B;  3AN2 A;  2VQR A;  3MNN D;  5AV9 D;  1P3F B;  2ARO C;  2G5H C;  1P3P A;  3REH D;  4WNN A;  1KX3 D;  3AZN D;  4X23 D;  1M18 C;  3X1T C;  5B32 B;  3UTA A;  5DNM A;  5GT3 A;  3REJ A;  5B24 D;  4R8P C;  3LZ0 D;  3B6G B;  3REK B;  5DNN C;  5CPI A;  1A7W A;  3B0C T;  1N1J A;  3AZF C;  3REL B;  1F66 C;  3AZG D;  3LZ1 D;  3TU4 A;  4M6B A;  4WU9 A;  2PYO B;  3W97 D;  4J8U C;  1P3F C;  1P3L A;  4H9N A;  5AV6 D;  3IP4 C;  3LJA D;  2JE5 A;  3NQU B;  3AZK D;  4Z5T D;  5B2I B;  5B32 C;  1P3P B;  3B6F D;  4LD9 D;  3WA9 B;  3B6G C;  5GSU D;  3REK C;  2G5I C;  4H9O A;  5BNV B;  5B0Z D;  3REL C;  3MGP A;  5G49 A;  3MNN A;  5DNM B;  5AV9 A;  2PYO C;  3REJ B;  5B0Y B;  5B2J D;  4H9S A;  4H9Q B;  2XD1 A;  3REH A;  3AZN A;  1KX3 A;  2RIQ A;  4X23 A;  3W99 B;  4JJN D;  1TAF B;  5B2I C;  5B24 A;  3LZ0 A;  5C3I B;  1P3O D;  2HIO B;  5GT0 B;  1TZY D;  1P3P C;  1KU5 A;  2F8N K;  5JRG B;  4J8V D;  3WA9 C;  2F8N D;  3AZG A;  3LZ1 A;  5E5A D;  1P3I B;  1ID3 D;  3W97 A;  1M19 B;  5DNM C;  5AV8 D;  5B31 B;  3MGR D;  3REJ C;  5B0Y C;  5AV6 A;  2J8P A;  3AV1 B;  3LJA A;  2CV5 B;  3AZK A;  4Z5T A;  1P3M B;  4Z66 D;  3W99 C;  3WTP D;  3AZI D;  5AV9 B;  3B6F A;  4LD9 A;  3VH5 W;  2CWE A;  5C3I C;  2HIO C;  5GSU A;  5GT0 C;  4WU8 D;  1KX3 B;  5B0Z A;  5JRG C;  3KWQ B;  1HQ3 D;  3AYW D;  3AFA B;  3REI B;  1P3I C;  2F8N G;  5B40 D;  1JFI B;  1BH9 A;  1M19 C;  5B2J A;  5B31 C;  4Z2M G;  5BO0 A;  3AV1 C;  3C1B D;  3A6N D;  2CV5 C;  2LY8 A;  5AV5 B;  3LZ1 B;  4H9R A;  3MGQ D;  1W2E A;  5CP6 D;  4JJN A;  3C1C B;  3O62 D;  1P3M C;  2L5A A;  1P3O A;  5AV9 C;  5AY8 D;  1TZY A;  5AVB B;  3WAA D;  5BNX A;  4J8V A;  1KX3 C;  2F8N A;  5E5A A;  3KWQ C;  4XZQ B;  1R4V A;  1ID3 A;  4YS3 D;  3AFA C;  3REI C;  3MGR A;  5AV8 A;  3X1V D;  4NE5 A;  4UUZ B;  2Y2G A;  4CAY B;  5CPK B;  3W96 D;  4G91 B;  3LZ1 C;  5AV5 C;  4Z66 A;  2NZD B;  2Y2J A;  3WTP A;  3AZI A;  3X1U B;  3C1C C;  3WKJ D;  4WU8 A;  5AVB C;  5BO0 B;  1HQ3 A;  4H9P B;  4H9R B;  1AOI D;  3AYW A;  2BYM A;  2BYK A;  4XZQ C;  3MGS B;  2JSS A;  5B40 A;  2HUE B;  2RVQ C; 
#chains in the Genus database with same CATH homology
 4XUJ B;  4E45 A;  3C1B A;  3A6N A;  3AZH D;  1P3K D;  1U35 B;  5CPJ D;  5CPK C;  5E5A B;  3MGQ A;  3AZM B;  4HGA B;  5CP6 A;  4G91 C;  3O62 A;  1ID3 B;  2NZD C;  3VH6 T;  3X1U C;  5AY8 A;  3MVD B;  1P3A B;  3WAA A;  4UPK A;  2ZM5 A;  4EO5 B;  2ZY5 A;  3AL0 C;  2ZY2 A;  4KGC D;  1M1A D;  2NQB B;  2YFV B;  2YFW A;  5B1L B;  5B1M D;  3UT9 D;  3B0B A;  3X1S D;  3LEL B;  4YS3 A;  3MGS C;  4CSR A;  5JA4 A;  3KXB D;  3X1V A;  2HUE C;  4XUJ C;  5BS7 C;  2Y2O A;  1HQ3 B;  3W96 A;  1P3B B;  1WWS A;  1U35 C;  3AZJ D;  5E5A C;  3AZM C;  4HGA C;  1H3O B;  1ID3 C;  3WKJ A;  2F2A C;  3AV2 B;  5F99 D;  4E44 A;  5KDM A;  3MVD C;  1P3A C;  4J8W B;  3C1B B;  4EO5 C;  1EQZ B;  3H0R C;  3AN2 B;  2NQB C;  1AOI A;  2JCH A;  3MGQ B;  1KX5 D;  5B1L C;  3O62 B;  3LEL C;  4WNN B;  5AY8 B;  4YM6 D;  1S32 D;  4J8X D;  3AZH A;  1P3K A;  3UTA B;  3EG5 B;  5CPJ A;  1P34 D;  1KX4 D;  2YFW B;  5GT3 B;  1HQ3 C;  1P3B C;  2Y2I A;  1ZLA D;  4QLC D;  3KUY D;  5CPI B;  1N1J B;  2FFF B;  5B33 D;  3AV2 C;  3TU4 B;  4WU9 B;  4KGC A;  1M1A A;  5AVC D;  4J8W C;  3C1B C;  1EQZ C;  3UTB D;  3AN2 C;  5B1M A;  3UT9 A;  3KSY A;  3VH6 A;  3X1S A;  3MGQ C;  1P3L B;  4KUD D;  4H9N B;  3O62 C;  3WKJ B;  3AZL D;  3KXB A;  5AY8 C;  2ARO D;  2Y2Q A;  4DRA A;  3R45 A;  3H0M C;  3UTA C;  1T3U A;  3AZJ A;  1AOI B;  5GT3 C;  3AZE D;  2Y2K A;  5CPI C;  4H9O B;  5F99 A;  1B6W A;  3MGP B;  4R8P D;  4DQY B;  5G49 B;  3TU4 C;  3AZH B;  4WU9 C;  1P3K B;  3MNN B;  3KFU G;  1KX5 A;  1F66 D;  1F1E A;  3REH B;  1P3L C;  3AZN B;  4KHA A;  4YM6 A;  3WKJ C;  1S32 A;  4X23 B;  4J8X A;  1P3F D;  3W98 D;  1M1A B;  1P34 A;  1KX4 A;  2Y2H A;  5B24 B;  3LZ0 B;  4QLC A;  3X1S B;  3KUY A;  1AOI C;  5BT1 C;  5B33 A;  2Y2M A;  3AZG B;  3V9R A;  2ZY4 A;  5AVC A;  3MGP C;  3W97 B;  3B6G D;  3UTB A;  3AZH C;  1P3K C;  3MNN C;  4KUD A;  4WJ3 C;  3REL D;  5AV6 B;  3AZL A;  3LJA B;  4H9S C;  3REH C;  3AZK B;  3AZN C;  4Z5T B;  2ARO A;  4X23 C;  1M1A C;  3B6F B;  4LD9 B;  3AZE A;  1BFM A;  5B24 C;  3LZ0 C;  3X1S C;  5GSU B;  5B0Z B;  3H0L C;  4WZS B;  4AWL B;  5B2I D;  3AZG C;  4R8P A;  1Z2C B;  1KX4 B;  2FJ7 D;  3W97 C;  1F66 A;  3WA9 D;  1BH9 B;  5B2J B;  4QLC B;  2W8S A;  2Y2P A;  5AV6 C;  3LJA C;  3AZK C;  5DNM D;  4Z5T C;  3REJ D;  3W98 A;  4JJN B;  5B0Y D;  1P3O B;  4KUD B;  1TZY B;  3B6F C;  4LD9 C;  2Y2N A;  5BNX B;  3AZL B;  3W99 D;  4J8V B;  5GSU C;  2F8N B;  5GXQ D;  5B0Z C;  4AWL C;  3B6G A;  2HIO D;  5GT0 D;  1KX4 C;  3MGR B;  5AV8 B;  1ULY A;  5JRG D;  3REL A;  3AZE B;  5B2J C;  4QLC C;  1P3I D;  1M19 D;  4Z66 B;  3WTP B;  5B31 D;  3AZI B;  4JJN C;  3AV1 D;  2CV5 D;  1P3O C;  3NQU A;  4KUD C;  4WU8 B;  1TZY C;  1PZR A;  1P3M D;  3AZL C;  4J8V C;  5B2I A;  3AYW B;  3W98 B;  2BYM B;  2BYK B;  2FJ7 A;  3WA9 A;  5B40 B;  3MGR C;  4DRB A;  5BNV A;  5AV8 C;  3KWQ D;  3AZE C;  3A6N B;  3AFA D;  3REI D;  1HTA A;  1Q9C A;  5CP6 B;  5B0Y A;  4Z66 C;  3WTP C;  3AZI C;  4H9Q A;  3WAA B;  3VH6 W;  5B31 G;  5AV5 D;  3W99 A;  4WU8 C;  1P3G D;  2F8N H;  4NFT A;  3C1C D;  1TAF A;  1BH8 A;  5GXQ A;  2HIO A;  4Z2M H;  5GT0 A;  5AVB D;  3AYW C;  4YS3 B;  2DQN C;  3W98 C;  5JRG A;  4CSR B;  5JA4 B;  5B40 C;  3X1V B;  3B0C W;  4XZQ D;  1P3I A;  3A6N C;  1M19 A;  3W96 B;  2RVQ D;  5B31 A;  5CP6 C;  2FJ7 B;  3AV1 A;  4ZUX D;  5CHL B;  2CV5 A;  2IO5 B;  5CPK D;  2Y2L A;  5KDM B;  3WAA C;  1P3M A;  2NZD D;  3VH5 T;  3X1U D;  1M18 D;  4YS3 C;  3X1T D;  4G92 B;  3KWQ A;  3EPH A;  3A1K A;  3X1V C;  5DNN D;  3NQJ A;  3AFA A;  3REI A;  5CPJ B;  3AZF D;  4WV4 B;  1BH8 B;  5FUG A;  5GXQ B;  3MGS D;  3EPK A;  1JFI A;  3W96 C;  4XUJ D;  2FJ7 C;  4J8U D;  2IO5 C;  5AV5 A;  1U35 D;  3AZM D;  1P3G A;  4KGC B;  3C1C A;  5B1M B;  3UT9 B;  1ZLA A;  2ZY3 A;  5AVB A;  3WTP E;  3MVD D;  1P3A D;  3KXB B;  5B32 D;  2NQB D;  4G92 C;  4XZQ A;  5B1L D;  3R45 B;  3LEL D;  3REK D;  5CPJ C;  3AZJ B;  5GXQ C;  4NE6 A;  4NE3 A;  4ZUX A;  4UUZ A;  4CAY A;  2UWX A;  2XD5 A;  5F99 B;  5CPK A;  2PYO D;  1P3B D;  2NZD A;  4ZBJ B;  2BG1 A;  3NQJ B;  3X1U A;  4KGC C;  5FUG B;  1B67 A;  1KX5 B;  3AV2 D;  5B1M C;  3UT9 C;  1M18 A;  3A1I A;  3X1T A;  4KHA B;  4YM6 B;  4J8W D;  1WWI A;  1EQZ D;  3KXB C;  1S32 B;  3AN2 D;  3B0D B;  4J8X B;  4H9P A;  3VH5 A;  5DNN A;  1P3G B;  1P3P D;  1P34 B;  3AZF A;  5B32 G;  3MGS A;  1ZLA B;  3KUY B;  3AZJ C;  4XUJ A;  3EPL A;  5BS7 A;  5B33 B;  3F6T A;  4J8U A;  3V9R B;  5F99 C;  3UTA D;  1U35 A;  5GT3 D;  3AZM A;  1P3F A;  5AVC B;  4ZBJ C;  3UTB B;  5CPI D;  3MVD A;  1P3A A;  1KX5 C;  3TU4 D;  4ZUX B;  4WU9 D;  5B32 A;  2NQB A;  4YM6 C;  2ARO B;  2YFV A;  1S32 C;  5B1L A;  3B0D C;  4J8X C;  3LEL A;  3REK A;  3EPJ A;  1P3G C;  1P3L D;  1P34 C;  2DF4 C;  1M18 B;  1ZLA C;  3KUY C;  3X1T B;  2PYO A;  3P5J B;  5B33 C;  1P3B A;  4R8P B;  3FDD A;  5DNN B;  5BT1 D;  3AZF B;  1H3O A;  5AVC C;  1F66 B;  3AV2 A;  3UTB C;  3MGP D;  4J8W A;  4ZUX C;  1EQZ A;  4J8U B;  3AN2 A;  2VQR A;  3MNN D;  5AV9 D;  1P3F B;  2ARO C;  2G5H C;  1P3P A;  3REH D;  4WNN A;  1KX3 D;  3AZN D;  4X23 D;  1M18 C;  3X1T C;  5B32 B;  3UTA A;  5DNM A;  5GT3 A;  3REJ A;  5B24 D;  4R8P C;  3LZ0 D;  3B6G B;  3REK B;  5DNN C;  5CPI A;  1A7W A;  3B0C T;  1N1J A;  3AZF C;  3REL B;  1F66 C;  3AZG D;  3LZ1 D;  3TU4 A;  4M6B A;  4WU9 A;  2PYO B;  3W97 D;  4J8U C;  1P3F C;  1P3L A;  4H9N A;  5AV6 D;  3IP4 C;  3LJA D;  2JE5 A;  3NQU B;  3AZK D;  4Z5T D;  5B2I B;  5B32 C;  1P3P B;  3B6F D;  4LD9 D;  3WA9 B;  3B6G C;  5GSU D;  3REK C;  2G5I C;  4H9O A;  5BNV B;  5B0Z D;  3REL C;  3MGP A;  5G49 A;  3MNN A;  5DNM B;  5AV9 A;  2PYO C;  3REJ B;  5B0Y B;  5B2J D;  4H9S A;  4H9Q B;  2XD1 A;  3REH A;  3AZN A;  1KX3 A;  2RIQ A;  4X23 A;  3W99 B;  4JJN D;  1TAF B;  5B2I C;  5B24 A;  3LZ0 A;  5C3I B;  1P3O D;  2HIO B;  5GT0 B;  1TZY D;  1P3P C;  1KU5 A;  2F8N K;  5JRG B;  4J8V D;  3WA9 C;  2F8N D;  3AZG A;  3LZ1 A;  5E5A D;  1P3I B;  1ID3 D;  3W97 A;  1M19 B;  5DNM C;  5AV8 D;  5B31 B;  3MGR D;  3REJ C;  5B0Y C;  5AV6 A;  2J8P A;  3AV1 B;  3LJA A;  2CV5 B;  3AZK A;  4Z5T A;  1P3M B;  4Z66 D;  3W99 C;  3WTP D;  3AZI D;  5AV9 B;  3B6F A;  4LD9 A;  3VH5 W;  2CWE A;  5C3I C;  2HIO C;  5GSU A;  5GT0 C;  4WU8 D;  1KX3 B;  5B0Z A;  5JRG C;  3KWQ B;  1HQ3 D;  3AYW D;  3AFA B;  3REI B;  1P3I C;  2F8N G;  5B40 D;  1JFI B;  1BH9 A;  1M19 C;  5B2J A;  5B31 C;  4Z2M G;  5BO0 A;  3AV1 C;  3C1B D;  3A6N D;  2CV5 C;  2LY8 A;  5AV5 B;  3LZ1 B;  4H9R A;  3MGQ D;  1W2E A;  5CP6 D;  4JJN A;  3C1C B;  3O62 D;  1P3M C;  2L5A A;  1P3O A;  5AV9 C;  5AY8 D;  1TZY A;  5AVB B;  3WAA D;  5BNX A;  4J8V A;  1KX3 C;  2F8N A;  5E5A A;  3KWQ C;  4XZQ B;  1R4V A;  1ID3 A;  4YS3 D;  3AFA C;  3REI C;  3MGR A;  5AV8 A;  3X1V D;  4NE5 A;  4UUZ B;  2Y2G A;  4CAY B;  5CPK B;  3W96 D;  4G91 B;  3LZ1 C;  5AV5 C;  4Z66 A;  2NZD B;  2Y2J A;  3WTP A;  3AZI A;  3X1U B;  3C1C C;  3WKJ D;  4WU8 A;  5AVB C;  5BO0 B;  1HQ3 A;  4H9P B;  4H9R B;  1AOI D;  3AYW A;  2BYM A;  2BYK A;  4XZQ C;  3MGS B;  2JSS A;  5B40 A;  2HUE B;  2RVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...