5AV9A

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9A00
3B0CT 1BH9A 4H9RB 3A6NB 4J8WC 1ID3C 3AZLC 3X1VC 5CP6B 3MGQC 1P3IB 3C1BA 5JA4B 3LZ0B 4Z5TA 1M18B 3MNND 3MGPB 4UUZB 4G92C 5KDMB 4ZUXC 5AVBB 4R8PC 1P3OA 3WTPC 1P3PA 5BNXA 1KU5A 4WU8D 2FJ7A 5GXQC 5E5AA 5GT0B 3RELD 1P3FA 2BYKA 1KX5D 3V9RA 1P3GB 3KWQB 1P3BA 5GT3D 5B32B 3B6FA 1EQZC 5CPIB 3AZHC 5B33C 3O62A 3LZ1B 3REIB 3AZGD 5AVCC 3UTBC 3TU4D 3AZMD 4EO5B 3LJAB 1TZYB 2NZDD 4YM6D 2HIOA 4XZQC 5C3IC 5CPJC 4QLCD 5JRGB 5B2IC 4ZBJC 3MGSB 3UT9C 1F66C 3W98B 5CPKB 1B6WA 5BT1D 3W99B 5B0ZD 1P3MB 2AROA 3X1SD 4J8XB 4NFTA 1HQ3A 4JJNA 3REJD 1P34D 5B31A 4X23A 1P3AA 5DNMD 3WKJA 5BT1C 1P3LC 1M1AC 3AZFC 3MGRA 4NE3A 3AZIC 4J8UD 3AV1D 5AV8A 3MVDA 4XUJD 4WU9C 4LD9B 1HTAA 1JFIA 5B1MB 3LELB 5B24C 3REKC 3AV2B 5AV5C 3AFAD 4KUDC 1P3OD 4H9QB 5B2JD 2FJ7D 5GT0D 4KGCA 3W97C 4HGAC 3C1BC 1BH8B 4Z5TC 3R45B 2NQBD 3B0CW 1P3BD 1P3PC 3AZKB 2F8ND 4M6BA 3MNNA 5E5AC 3C1CD 1P3FC 2YFVA 2F8NH 4KHAB 5AV9A 3NQJA 4J8WB 3B6FC 3X1UC 3RELA 3AZLB 1KX4A 5B32G 1TZYD 3MGQB 1KX5A 4H9SC 2HIOD 2F8NG 4H9OA 5GT3A 4YS3C 3O62C 4ZUXB 4R8PB 3WTPB 3AYWD 5GXQB 4WNNA 3TU4A 2PYOA 1HQ3D 4JJND 3AZEC 3AZMA 3B0BA 3UTAC 2NZDA 2CV5D 5AV6A 1EQZB 1U35A 3AZHB 4QLCA 4NE6A 1M19A 2AROC 3VH5W 3MGRD 3WAAD 5B33B 1HQ3C 5B0ZA 5B31C 4X23C 3UTBB 3X1SA 1P3AC 5AY8A 3WKJC 5GSUD 5CHLB 1P34A 4DRBA 4XZQB 5C3IB 3REHD 5CPJB 3W96C 5B2IB 4ZBJB 3UT9B 1AOID 1F66B 5AV8C 5B0YD 1P3KB 3KXBD 3MVDC 3KUYD 1KX3A 5DNNC 4KGCD 3VH5A 3A6NA 4Z66D 1P3LB 1P3IA 1M1AB 3WTPE 3AZFB 3LZ0A 1ZLAC 3AFAA 4CSRB 3AZIB 1N1JB 1S32D 5KDMA 4J8VD 3AN2D 5B2JA 5AV9D 5GT0A 4WU9B 5B1LB 2BYMA 1KX4D 3MNNC 5B24B 2NQBA 1P3GA 3KWQA 5B32A 5AV5B 5CPIA 2F8NA 4WU8C 5G49A 3VH6T 4KUDB 1BH9B 3RELC 3C1CA 3REIA 1KX5C 3W97B 4HGAB 3C1BB 2PYOD 1H3OA 4Z5TB 5GT3C 1TZYA 5AV6D 1U35D 4Z2MH 5JRGA 3MGSA 3W98A 1M19D 5E5AB 3AZGC 3WA9D 5CPKA 3TU4C 3AZMC 3W99A 4WZSB 1P3MA 3AYWA 4Z2MG 4YM6C 5F99B 3B6FB 5AY8D 2NZDC 5AV6C 3X1UB 4QLCC 3AZND 4G91C 2CV5A 4YS3B 3O62B 3B6GD 5B0ZC 1P3KD 3WAAA 3X1SC 3REJC 1P34C 1KX3D 5DNMC 4WV4B 3AZEB 5BS7A 5GSUA 3A6ND 5BNVA 3UTAB 5CP6D 3LELA 3AZJB 1P3ID 3REHA 4J8UC 3AV2A 2AROB 3LZ0D 3AV1C 1M18D 1AOIA 3MGPD 5B0YA 3KXBA 2JSSA 4XUJC 2L5AA 5AVBD 5B31B 4X23B 4H9QA 1P3AB 3WKJB 3KUYA 5B1LD 1BH8A 1R4VA 5BO0B 3AFAC 3R45A 3B0DC 4Z66A 1B67A 3W96B 1P3GD 3KWQD 1P3OC 5B32D 5AV8B 5B40B 5CPID 3X1TB 5B2JC 2FJ7C 5GT0C 1S32A 4J8VA 3LZ1D 3REID 5DNNB 3AN2A 2NQBC 1ULYA 1P3BC 1ID3B 3X1VB 3LJAD 3MGQA 1F1EA 3C1CC 1ZLAB 5JRGD 3MGSD 3W98D 2IO5C 4G92B 4H9PB 5CPKD 4ZUXA 3W99D 1TZYC 1P3MD 5GXQA 5F99D 4J8XD 2HIOC 3MNNB 2YFVB 3W99C 2RVQD 5FUGA 3AZHA 4WU8B 2YFWA 3AYWC 3WA9A 5B33A 3RELB 4JJNC 1KX5B 5AVCB 4H9OB 2CV5C 3NQUA 4LD9D 3WAAC 5B1MD 3AZNA 3MGRC 3AZJD 3LELD 5CPJA 5B2IA 3UT9A 3B6GA 1F66A 1WWIA 2LY8A 3AZGB 3AV2D 4WNNB 1P3KA 3TU4B 3AZMB 5BS7C 1TAFB 5GSUC 4YM6B 4E44A 3REHC 4QLCB 1AOIC 4H9RA 5B0YC 3KXBC 5CP6A 5B40D 5JA4A 3X1TD 3AZKD 1M18A 3KUYC 4CSRA 3MGPA 3AZIA 4UUZA 4KGCC 3REJB 1P34B 1A7WA 5AVBA 5DNMB 4Z66C 4WU9A 5B1LA 4J8WD 1ID3D 4CAYB 3AZLD 3X1VD 3MGQD 4E45A 3REKB 1S32C 4J8UB 3AV1B 4J8VC 4H9NB 3AN2C 5AV9C 4XUJB 4KUDA 4ZUXD 4R8PD 3WTPD 1KX4C 3LZ1A 5GXQD 3W97A 1Q9CA 3AFAB 3B0DB 3LJAA 1P3OB 1EQZD 3AZHD 1P3PB 5BNXB 5B2JB 2FJ7B 5B33D 2BYMB 1P3FB 2PYOC 2BYKB 3V9RB 2NQBB 5AVCD 3UTBD 5F99A 4J8XA 1P3BB 3X1UA 2HUEC 1U35C 2F8NB 5G49B 1M19C 4H9SA 3WA9C 4XZQD 3C1CB 5CPJD 4YS3A 5B2ID 3UT9D 1F66D 2IO5B 4AWLC 1H3OB 5AY8C 3VH5T 1BFMA 3AZNC 2HIOB 3AZEA 3B6GC 4LD9A 3UTAA 1P3KC 5B1MA 3AZJA 1P3LD 1M1AD 3AZFD 3AYWB 3AZID 1KX3C 1HQ3B 4JJNB 3A6NC 2CV5B 5CP6C 4WU9D 1P3IC 3WAAB 3LZ0C 3MGRB 5BO0A 1M18C 3MGPC 5B24D 3REKD 3W96A 5AVBC 5AV5D 5B40A 3AZKA 3X1TA 3MVDB 5GSUB 4KUDD 5B1LC 1JFIB 5BNVB 5DNNA 4KHAA 3W97D 3REHB 3C1BD 1P3GC 3KWQC 4J8WA 1ID3A 4Z5TD 5B32C 1AOIB 5B0YB 5CPIC 3AZLA 3X1VA 3KXBB 1P3PD 1ZLAA 3KUYB 3LZ1C 3REIC 5E5AD 4KGCB 4H9PA 1P3FD 4R8PA 4EO5C 3WTPA 3LJAC 4NE5A 4Z66B 3B6FD 3VH6W 3X1UD 5JRGC 3MGSC 3W98C 1S32B 5CPKC 3KSYA 4YS3D 3O62D 4J8VB 1EQZA 4WU8A 3AN2B 5AV9B 1P3MC 5F99C 3NQJB 4J8XC 2F8NK 1KX4B 5AVCA 3UTBA 1WWSA 3AZED 5GT3B 2RVQC 3UTAD 4XZQA 2AROD 3AZGA 3VH6A 2PYOB 1TAFA 4LD9C 5B31D 5B1MC 4X23D 4YM6A 2CWEA 1P3AD 3WKJD 2NZDB 3AZJC 5AV6B 2HUEB 5FUGB 3LELC 1U35B 2YFWB 3AV2C 1M19B 4G91B 3WA9B 4DRAA 3W96D 1P3LA 1M1AA 3AZFA 5AV8D 5B0ZB 4AWLB 3X1SB 3MVDD 5AY8B 3NQUB 5B31G 1N1JA 3REJA 3AZNB 5DNND 5DNMA 3B6GB 4CAYA 5B40C 3AZKC 3X1TC 5B24A 3REKA 4J8UA 3AV1A 1ZLAD 4H9NA 5AV5A 1KX3B 4XUJA
chains in the Genus database with same CATH superfamily
3B0CT 1BH9A 4H9RB 3A6NB 4J8WC 1ID3C 2FFFB 3AZLC 3X1VC 5CP6B 3MGQC 1P3IB 3C1BA 5JA4B 3LZ0B 4Z5TA 1M18B 3MNND 3MGPB 4UUZB 4G92C 5KDMB 4ZUXC 5AVBB 4R8PC 1P3OA 3WTPC 1P3PA 5BNXA 1KU5A 4WU8D 2FJ7A 5GXQC 5E5AA 2Y2HA 5GT0B 3RELD 1P3FA 2BYKA 1KX5D 3V9RA 1P3GB 3KWQB 1P3BA 5GT3D 5B32B 3B6FA 1EQZC 5CPIB 3AZHC 5B33C 3O62A 3LZ1B 3REIB 3AZGD 5AVCC 3UTBC 3TU4D 3AZMD 4EO5B 3A1IA 3LJAB 1TZYB 2RIQA 4YM6D 2HIOA 2NZDD 4XZQC 5C3IC 5CPJC 3H0MC 4QLCD 5JRGB 4ZBJC 5B2IC 3MGSB 3EPJA 3UT9C 1F66C 3W98B 3EPHA 5CPKB 1B6WA 4UPKA 5BT1D 3W99B 5B0ZD 1P3MB 2AROA 2Y2PA 3X1SD 4J8XB 4NFTA 1HQ3A 4JJNA 3REJD 1P34D 5B31A 4X23A 1P3AA 5DNMD 3WKJA 5BT1C 1P3LC 1M1AC 3AZFC 3MGRA 4NE3A 3AZIC 4J8UD 3AV1D 5AV8A 2Y2KA 3MVDA 4XUJD 4WU9C 4LD9B 1HTAA 1JFIA 5B1MB 3LELB 2G5HC 5B24C 3REKC 3AV2B 5AV5C 3AFAD 4KUDC 1P3OD 4H9QB 5B2JD 2FJ7D 5GT0D 4KGCA 3W97C 4HGAC 3C1BC 1BH8B 4Z5TC 3EG5B 3R45B 2NQBD 3B0CW 1P3BD 1P3PC 3AZKB 2F8ND 4M6BA 3MNNA 5E5AC 3C1CD 1P3FC 2YFVA 2F8NH 4KHAB 5AV9A 3NQJA 4J8WB 3B6FC 3X1UC 3RELA 3AZLB 1KX4A 5B32G 1TZYD 3MGQB 1KX5A 4H9SC 2HIOD 2F8NG 4H9OA 5GT3A 4YS3C 3O62C 4ZUXB 4R8PB 3WTPB 3AYWD 5GXQB 4WNNA 3TU4A 2PYOA 1HQ3D 4JJND 3AZEC 3AZMA 3B0BA 2UWXA 3UTAC 2NZDA 2CV5D 5AV6A 1EQZB 1U35A 3AZHB 1PZRA 4QLCA 4NE6A 1M19A 2AROC 2Y2LA 3VH5W 3MGRD 3WAAD 5B33B 2F2AC 1HQ3C 5B0ZA 5B31C 4X23C 3UTBB 3X1SA 1P3AC 5AY8A 3WKJC 5GSUD 5CHLB 1P34A 4DRBA 4XZQB 5C3IB 3REHD 5CPJB 3W96C 5B2IB 4ZBJB 3UT9B 1AOID 1F66B 5AV8C 5B0YD 1P3KB 3KXBD 3MVDC 3KUYD 1KX3A 5DNNC 4KGCD 3VH5A 3A6NA 4Z66D 1P3LB 1P3IA 1M1AB 3WTPE 3AZFB 2XD1A 3LZ0A 1ZLAC 3AFAA 4CSRB 3AZIB 1N1JB 1S32D 5KDMA 4J8VD 3AN2D 5B2JA 5AV9D 2Y2IA 5GT0A 4WU9B 5B1LB 2BYMA 1KX4D 3MNNC 5B24B 2NQBA 2Y2GA 1P3GA 3KWQA 5B32A 5AV5B 5CPIA 2F8NA 4WU8C 5G49A 3VH6T 4KUDB 1BH9B 3RELC 3C1CA 3REIA 1KX5C 3W97B 4HGAB 3C1BB 2PYOD 1H3OA 4Z5TB 5GT3C 1TZYA 5AV6D 1U35D 4Z2MH 5JRGA 3MGSA 3W98A 1M19D 5E5AB 3AZGC 3WA9D 4WJ3C 5CPKA 3TU4C 3AZMC 3W99A 4WZSB 1P3MA 3AYWA 4Z2MG 4YM6C 5F99B 3B6FB 5AY8D 2NZDC 5AV6C 3X1UB 4QLCC 3AZND 4G91C 3FDDA 2CV5A 2DF4C 2BG1A 3O62B 4YS3B 3B6GD 5B0ZC 1P3KD 3WAAA 3X1SC 3REJC 1P34C 2Y2NA 1KX3D 2ZM5A 5DNMC 4WV4B 3AZEB 5BS7A 5GSUA 3A6ND 5BNVA 3UTAB 5CP6D 3LELA 3AZJB 1P3ID 3REHA 4J8UC 3AV2A 2AROB 3LZ0D 3AV1C 1M18D 1AOIA 3MGPD 5B0YA 3KXBA 2JSSA 4XUJC 2L5AA 5AVBD 5B31B 4X23B 4H9QA 1P3AB 2ZY3A 3KUYA 3WKJB 5B1LD 3EPKA 2ZY5A 1BH8A 1R4VA 2Y2MA 5BO0B 3AFAC 3R45A 3B0DC 4Z66A 1B67A 3W96B 1P3GD 3KWQD 1P3OC 5B32D 5AV8B 5B40B 5CPID 3X1TB 5B2JC 2FJ7C 5GT0C 1S32A 1Z2CB 4J8VA 3LZ1D 3REID 5DNNB 3AN2A 2NQBC 1ULYA 1P3BC 1ID3B 3X1VB 3LJAD 3MGQA 1F1EA 3C1CC 1ZLAB 5JRGD 3MGSD 3W98D 3AL0C 2IO5C 4G92B 4H9PB 5CPKD 4ZUXA 3W99D 1TZYC 1P3MD 5GXQA 2ZY4A 5F99D 4J8XD 2HIOC 3MNNB 2YFVB 3W99C 2RVQD 5FUGA 3AZHA 4WU8B 2YFWA 3AYWC 3WA9A 5B33A 3RELB 4JJNC 2XD5A 1KX5B 2Y2QA 5AVCB 4H9OB 2CV5C 3NQUA 4LD9D 3WAAC 5B1MD 3AZNA 3MGRC 3AZJD 3LELD 5CPJA 5B2IA 3UT9A 3B6GA 1F66A 1WWIA 2LY8A 2JCHA 3AZGB 3AV2D 4WNNB 1P3KA 3TU4B 3AZMB 3P5JB 1TAFB 5BS7C 5GSUC 2J8PA 4YM6B 4E44A 3REHC 4QLCB 1AOIC 4H9RA 5B0YC 3KXBC 5CP6A 5B40D 5JA4A 3X1TD 3AZKD 1M18A 3KUYC 4CSRA 3MGPA 3AZIA 4UUZA 4KGCC 3REJB 1P34B 3H0RC 1A7WA 5AVBA 5DNMB 4Z66C 4WU9A 5B1LA 4J8WD 1ID3D 4CAYB 3AZLD 3X1VD 3MGQD 2JE5A 4E45A 3REKB 1S32C 4J8UB 3AV1B 4J8VC 4H9NB 3AN2C 5AV9C 4XUJB 4KUDA 4ZUXD 4R8PD 3WTPD 3EPLA 1KX4C 3LZ1A 5GXQD 3W97A 1Q9CA 3AFAB 3B0DB 3LJAA 1P3OB 1EQZD 3AZHD 1P3PB 5BNXB 5B2JB 2FJ7B 5B33D 2BYMB 1P3FB 2PYOC 2BYKB 3V9RB 2NQBB 5AVCD 3UTBD 5F99A 4J8XA 1P3BB 3X1UA 2HUEC 1U35C 2F8NB 5G49B 1M19C 4H9SA 3WA9C 4XZQD 3C1CB 5CPJD 4YS3A 5B2ID 3UT9D 1F66D 2IO5B 4AWLC 1H3OB 5AY8C 3A1KA 3VH5T 1BFMA 3AZNC 2HIOB 4DQYB 3AZEA 3B6GC 4LD9A 3UTAA 1P3KC 5B1MA 3AZJA 1P3LD 1M1AD 3F6TA 2W8SA 3AZFD 3AYWB 3H0LC 3IP4C 3AZID 1KX3C 1HQ3B 4JJNB 2DQNC 3A6NC 2VQRA 2CV5B 5CP6C 4WU9D 1P3IC 3WAAB 3LZ0C 3MGRB 5BO0A 1M18C 3MGPC 5B24D 3REKD 3W96A 2Y2JA 5AVBC 1W2EA 5B40A 5AV5D 3AZKA 3X1TA 3MVDB 5GSUB 4KUDD 5B1LC 1JFIB 5BNVB 5DNNA 4KHAA 3W97D 3REHB 3C1BD 1P3GC 3KWQC 4J8WA 1ID3A 4Z5TD 5B32C 1AOIB 5B0YB 5CPIC 3AZLA 3X1VA 3KXBB 1P3PD 1ZLAA 3KUYB 3LZ1C 3REIC 5E5AD 4KGCB 4H9PA 1P3FD 4R8PA 4EO5C 3WTPA 3LJAC 4NE5A 4Z66B 3B6FD 3VH6W 3X1UD 5JRGC 3MGSC 3W98C 1S32B 5CPKC 3KSYA 4YS3D 3O62D 4J8VB 1EQZA 4WU8A 2G5IC 3AN2B 5AV9B 1P3MC 3KFUG 5F99C 3NQJB 4J8XC 2ZY2A 2F8NK 1KX4B 5AVCA 3UTBA 1WWSA 3AZED 5GT3B 2RVQC 3UTAD 4XZQA 2AROD 3AZGA 3VH6A 2PYOB 1TAFA 4LD9C 5B31D 5B1MC 4X23D 4YM6A 2CWEA 1P3AD 3WKJD 2NZDB 3AZJC 5AV6B 2HUEB 5FUGB 3LELC 1U35B 2YFWB 3AV2C 1M19B 4G91B 3WA9B 4DRAA 3W96D 1P3LA 1M1AA 3AZFA 5AV8D 5B0ZB 4AWLB 3X1SB 3MVDD 5AY8B 3NQUB 5B31G 1N1JA 3REJA 3AZNB 5DNND 5DNMA 3B6GB 4CAYA 5B40C 3AZKC 3X1TC 5B24A 3REKA 2Y2OA 4J8UA 3AV1A 1T3UA 1ZLAD 4H9NA 5AV5A 1KX3B 4XUJA
chains in the Genus database with same CATH topology
3B0CT 1BH9A 4H9RB 3A6NB 4J8WC 1ID3C 2FFFB 3AZLC 3X1VC 5CP6B 3MGQC 1P3IB 3C1BA 5JA4B 3LZ0B 4Z5TA 1M18B 3MNND 3MGPB 4UUZB 4G92C 5KDMB 4ZUXC 5AVBB 4R8PC 1P3OA 3WTPC 1P3PA 5BNXA 1KU5A 4WU8D 2FJ7A 5GXQC 5E5AA 2Y2HA 5GT0B 3RELD 1P3FA 2BYKA 1KX5D 3V9RA 1P3GB 3KWQB 1P3BA 5GT3D 5B32B 3B6FA 1EQZC 5CPIB 3AZHC 5B33C 3O62A 3LZ1B 3REIB 3AZGD 5AVCC 3UTBC 3TU4D 3AZMD 4EO5B 3A1IA 3LJAB 1TZYB 2RIQA 4YM6D 2HIOA 2NZDD 4XZQC 5C3IC 5CPJC 3H0MC 4QLCD 5JRGB 4ZBJC 5B2IC 3MGSB 3EPJA 3UT9C 1F66C 3W98B 3EPHA 5CPKB 1B6WA 4UPKA 5BT1D 3W99B 5B0ZD 1P3MB 2AROA 2Y2PA 3X1SD 4J8XB 4NFTA 1HQ3A 4JJNA 3REJD 1P34D 5B31A 4X23A 1P3AA 5DNMD 3WKJA 5BT1C 1P3LC 1M1AC 3AZFC 3MGRA 4NE3A 3AZIC 4J8UD 3AV1D 5AV8A 2Y2KA 3MVDA 4XUJD 4WU9C 4LD9B 1HTAA 1JFIA 5B1MB 3LELB 2G5HC 5B24C 3REKC 3AV2B 5AV5C 3AFAD 4KUDC 1P3OD 4H9QB 5B2JD 2FJ7D 5GT0D 4KGCA 3W97C 4HGAC 3C1BC 1BH8B 4Z5TC 3EG5B 3R45B 2NQBD 3B0CW 1P3BD 1P3PC 3AZKB 2F8ND 4M6BA 3MNNA 5E5AC 3C1CD 1P3FC 2YFVA 2F8NH 4KHAB 5AV9A 3NQJA 4J8WB 3B6FC 3X1UC 3RELA 3AZLB 1KX4A 5B32G 1TZYD 3MGQB 1KX5A 4H9SC 2HIOD 2F8NG 4H9OA 5GT3A 4YS3C 3O62C 4ZUXB 4R8PB 3WTPB 3AYWD 5GXQB 4WNNA 3TU4A 2PYOA 1HQ3D 4JJND 3AZEC 3AZMA 3B0BA 2UWXA 3UTAC 2NZDA 2CV5D 5AV6A 1EQZB 1U35A 3AZHB 1PZRA 4QLCA 4NE6A 1M19A 2AROC 2Y2LA 3VH5W 3MGRD 3WAAD 5B33B 2F2AC 1HQ3C 5B0ZA 5B31C 4X23C 3UTBB 3X1SA 1P3AC 5AY8A 3WKJC 5GSUD 5CHLB 1P34A 4DRBA 4XZQB 5C3IB 3REHD 5CPJB 3W96C 5B2IB 4ZBJB 3UT9B 1AOID 1F66B 5AV8C 5B0YD 1P3KB 3KXBD 3MVDC 3KUYD 1KX3A 5DNNC 4KGCD 3VH5A 3A6NA 4Z66D 1P3LB 1P3IA 1M1AB 3WTPE 3AZFB 2XD1A 3LZ0A 1ZLAC 3AFAA 4CSRB 3AZIB 1N1JB 1S32D 5KDMA 4J8VD 3AN2D 5B2JA 5AV9D 2Y2IA 5GT0A 4WU9B 5B1LB 2BYMA 1KX4D 3MNNC 5B24B 2NQBA 2Y2GA 1P3GA 3KWQA 5B32A 5AV5B 5CPIA 2F8NA 4WU8C 5G49A 3VH6T 4KUDB 1BH9B 3RELC 3C1CA 3REIA 1KX5C 3W97B 4HGAB 3C1BB 2PYOD 1H3OA 4Z5TB 5GT3C 1TZYA 5AV6D 1U35D 4Z2MH 5JRGA 3MGSA 3W98A 1M19D 5E5AB 3AZGC 3WA9D 4WJ3C 5CPKA 3TU4C 3AZMC 3W99A 4WZSB 1P3MA 3AYWA 4Z2MG 4YM6C 5F99B 3B6FB 5AY8D 2NZDC 5AV6C 3X1UB 4QLCC 3AZND 4G91C 3FDDA 2CV5A 2DF4C 2BG1A 3O62B 4YS3B 3B6GD 5B0ZC 1P3KD 3WAAA 3X1SC 3REJC 1P34C 2Y2NA 1KX3D 2ZM5A 5DNMC 4WV4B 3AZEB 5BS7A 5GSUA 3A6ND 5BNVA 3UTAB 5CP6D 3LELA 3AZJB 1P3ID 3REHA 4J8UC 3AV2A 2AROB 3LZ0D 3AV1C 1M18D 1AOIA 3MGPD 5B0YA 3KXBA 2JSSA 4XUJC 2L5AA 5AVBD 5B31B 4X23B 4H9QA 1P3AB 2ZY3A 3KUYA 3WKJB 5B1LD 3EPKA 2ZY5A 1BH8A 1R4VA 2Y2MA 5BO0B 3AFAC 3R45A 3B0DC 4Z66A 1B67A 3W96B 1P3GD 3KWQD 1P3OC 5B32D 5AV8B 5B40B 5CPID 3X1TB 5B2JC 2FJ7C 5GT0C 1S32A 1Z2CB 4J8VA 3LZ1D 3REID 5DNNB 3AN2A 2NQBC 1ULYA 1P3BC 1ID3B 3X1VB 3LJAD 3MGQA 1F1EA 3C1CC 1ZLAB 5JRGD 3MGSD 3W98D 3AL0C 2IO5C 4G92B 4H9PB 5CPKD 4ZUXA 3W99D 1TZYC 1P3MD 5GXQA 2ZY4A 5F99D 4J8XD 2HIOC 3MNNB 2YFVB 3W99C 2RVQD 5FUGA 3AZHA 4WU8B 2YFWA 3AYWC 3WA9A 5B33A 3RELB 4JJNC 2XD5A 1KX5B 2Y2QA 5AVCB 4H9OB 2CV5C 3NQUA 4LD9D 3WAAC 5B1MD 3AZNA 3MGRC 3AZJD 3LELD 5CPJA 5B2IA 3UT9A 3B6GA 1F66A 1WWIA 2LY8A 2JCHA 3AZGB 3AV2D 4WNNB 1P3KA 3TU4B 3AZMB 3P5JB 1TAFB 5BS7C 5GSUC 2J8PA 4YM6B 4E44A 3REHC 4QLCB 1AOIC 4H9RA 5B0YC 3KXBC 5CP6A 5B40D 5JA4A 3X1TD 3AZKD 1M18A 3KUYC 4CSRA 3MGPA 3AZIA 4UUZA 4KGCC 3REJB 1P34B 3H0RC 1A7WA 5AVBA 5DNMB 4Z66C 4WU9A 5B1LA 4J8WD 1ID3D 4CAYB 3AZLD 3X1VD 3MGQD 2JE5A 4E45A 3REKB 1S32C 4J8UB 3AV1B 4J8VC 4H9NB 3AN2C 5AV9C 4XUJB 4KUDA 4ZUXD 4R8PD 3WTPD 3EPLA 1KX4C 3LZ1A 5GXQD 3W97A 1Q9CA 3AFAB 3B0DB 3LJAA 1P3OB 1EQZD 3AZHD 1P3PB 5BNXB 5B2JB 2FJ7B 5B33D 2BYMB 1P3FB 2PYOC 2BYKB 3V9RB 2NQBB 5AVCD 3UTBD 5F99A 4J8XA 1P3BB 3X1UA 2HUEC 1U35C 2F8NB 5G49B 1M19C 4H9SA 3WA9C 4XZQD 3C1CB 5CPJD 4YS3A 5B2ID 3UT9D 1F66D 2IO5B 4AWLC 1H3OB 5AY8C 3A1KA 3VH5T 1BFMA 3AZNC 2HIOB 4DQYB 3AZEA 3B6GC 4LD9A 3UTAA 1P3KC 5B1MA 3AZJA 1P3LD 1M1AD 3F6TA 2W8SA 3AZFD 3AYWB 3H0LC 3IP4C 3AZID 1KX3C 1HQ3B 4JJNB 2DQNC 3A6NC 2VQRA 2CV5B 5CP6C 4WU9D 1P3IC 3WAAB 3LZ0C 3MGRB 5BO0A 1M18C 3MGPC 5B24D 3REKD 3W96A 2Y2JA 5AVBC 1W2EA 5B40A 5AV5D 3AZKA 3X1TA 3MVDB 5GSUB 4KUDD 5B1LC 1JFIB 5BNVB 5DNNA 4KHAA 3W97D 3REHB 3C1BD 1P3GC 3KWQC 4J8WA 1ID3A 4Z5TD 5B32C 1AOIB 5B0YB 5CPIC 3AZLA 3X1VA 3KXBB 1P3PD 1ZLAA 3KUYB 3LZ1C 3REIC 5E5AD 4KGCB 4H9PA 1P3FD 4R8PA 4EO5C 3WTPA 3LJAC 4NE5A 4Z66B 3B6FD 3VH6W 3X1UD 5JRGC 3MGSC 3W98C 1S32B 5CPKC 3KSYA 4YS3D 3O62D 4J8VB 1EQZA 4WU8A 2G5IC 3AN2B 5AV9B 1P3MC 3KFUG 5F99C 3NQJB 4J8XC 2ZY2A 2F8NK 1KX4B 5AVCA 3UTBA 1WWSA 3AZED 5GT3B 2RVQC 3UTAD 4XZQA 2AROD 3AZGA 3VH6A 2PYOB 1TAFA 4LD9C 5B31D 5B1MC 4X23D 4YM6A 2CWEA 1P3AD 3WKJD 2NZDB 3AZJC 5AV6B 2HUEB 5FUGB 3LELC 1U35B 2YFWB 3AV2C 1M19B 4G91B 3WA9B 4DRAA 3W96D 1P3LA 1M1AA 3AZFA 5AV8D 5B0ZB 4AWLB 3X1SB 3MVDD 5AY8B 3NQUB 5B31G 1N1JA 3REJA 3AZNB 5DNND 5DNMA 3B6GB 4CAYA 5B40C 3AZKC 3X1TC 5B24A 3REKA 2Y2OA 4J8UA 3AV1A 1T3UA 1ZLAD 4H9NA 5AV5A 1KX3B 4XUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C T;  1BH9 A;  4H9R B;  3A6N B;  4J8W C;  1ID3 C;  3AZL C;  3X1V C;  5CP6 B;  3MGQ C;  1P3I B;  3C1B A;  5JA4 B;  3LZ0 B;  4Z5T A;  1M18 B;  3MNN D;  3MGP B;  4UUZ B;  4G92 C;  5KDM B;  4ZUX C;  5AVB B;  4R8P C;  1P3O A;  3WTP C;  1P3P A;  5BNX A;  1KU5 A;  4WU8 D;  2FJ7 A;  5GXQ C;  5E5A A;  5GT0 B;  3REL D;  1P3F A;  2BYK A;  1KX5 D;  3V9R A;  1P3G B;  3KWQ B;  1P3B A;  5GT3 D;  5B32 B;  3B6F A;  1EQZ C;  5CPI B;  3AZH C;  5B33 C;  3O62 A;  3LZ1 B;  3REI B;  3AZG D;  5AVC C;  3UTB C;  3TU4 D;  3AZM D;  4EO5 B;  3LJA B;  1TZY B;  2NZD D;  4YM6 D;  2HIO A;  4XZQ C;  5C3I C;  5CPJ C;  4QLC D;  5JRG B;  5B2I C;  4ZBJ C;  3MGS B;  3UT9 C;  1F66 C;  3W98 B;  5CPK B;  1B6W A;  5BT1 D;  3W99 B;  5B0Z D;  1P3M B;  2ARO A;  3X1S D;  4J8X B;  4NFT A;  1HQ3 A;  4JJN A;  3REJ D;  1P34 D;  5B31 A;  4X23 A;  1P3A A;  5DNM D;  3WKJ A;  5BT1 C;  1P3L C;  1M1A C;  3AZF C;  3MGR A;  4NE3 A;  3AZI C;  4J8U D;  3AV1 D;  5AV8 A;  3MVD A;  4XUJ D;  4WU9 C;  4LD9 B;  1HTA A;  1JFI A;  5B1M B;  3LEL B;  5B24 C;  3REK C;  3AV2 B;  5AV5 C;  3AFA D;  4KUD C;  1P3O D;  4H9Q B;  5B2J D;  2FJ7 D;  5GT0 D;  4KGC A;  3W97 C;  4HGA C;  3C1B C;  1BH8 B;  4Z5T C;  3R45 B;  2NQB D;  3B0C W;  1P3B D;  1P3P C;  3AZK B;  2F8N D;  4M6B A;  3MNN A;  5E5A C;  3C1C D;  1P3F C;  2YFV A;  2F8N H;  4KHA B;  5AV9 A;  3NQJ A;  4J8W B;  3B6F C;  3X1U C;  3REL A;  3AZL B;  1KX4 A;  5B32 G;  1TZY D;  3MGQ B;  1KX5 A;  4H9S C;  2HIO D;  2F8N G;  4H9O A;  5GT3 A;  4YS3 C;  3O62 C;  4ZUX B;  4R8P B;  3WTP B;  3AYW D;  5GXQ B;  4WNN A;  3TU4 A;  2PYO A;  1HQ3 D;  4JJN D;  3AZE C;  3AZM A;  3B0B A;  3UTA C;  2NZD A;  2CV5 D;  5AV6 A;  1EQZ B;  1U35 A;  3AZH B;  4QLC A;  4NE6 A;  1M19 A;  2ARO C;  3VH5 W;  3MGR D;  3WAA D;  5B33 B;  1HQ3 C;  5B0Z A;  5B31 C;  4X23 C;  3UTB B;  3X1S A;  1P3A C;  5AY8 A;  3WKJ C;  5GSU D;  5CHL B;  1P34 A;  4DRB A;  4XZQ B;  5C3I B;  3REH D;  5CPJ B;  3W96 C;  5B2I B;  4ZBJ B;  3UT9 B;  1AOI D;  1F66 B;  5AV8 C;  5B0Y D;  1P3K B;  3KXB D;  3MVD C;  3KUY D;  1KX3 A;  5DNN C;  4KGC D;  3VH5 A;  3A6N A;  4Z66 D;  1P3L B;  1P3I A;  1M1A B;  3WTP E;  3AZF B;  3LZ0 A;  1ZLA C;  3AFA A;  4CSR B;  3AZI B;  1N1J B;  1S32 D;  5KDM A;  4J8V D;  3AN2 D;  5B2J A;  5AV9 D;  5GT0 A;  4WU9 B;  5B1L B;  2BYM A;  1KX4 D;  3MNN C;  5B24 B;  2NQB A;  1P3G A;  3KWQ A;  5B32 A;  5AV5 B;  5CPI A;  2F8N A;  4WU8 C;  5G49 A;  3VH6 T;  4KUD B;  1BH9 B;  3REL C;  3C1C A;  3REI A;  1KX5 C;  3W97 B;  4HGA B;  3C1B B;  2PYO D;  1H3O A;  4Z5T B;  5GT3 C;  1TZY A;  5AV6 D;  1U35 D;  4Z2M H;  5JRG A;  3MGS A;  3W98 A;  1M19 D;  5E5A B;  3AZG C;  3WA9 D;  5CPK A;  3TU4 C;  3AZM C;  3W99 A;  4WZS B;  1P3M A;  3AYW A;  4Z2M G;  4YM6 C;  5F99 B;  3B6F B;  5AY8 D;  2NZD C;  5AV6 C;  3X1U B;  4QLC C;  3AZN D;  4G91 C;  2CV5 A;  4YS3 B;  3O62 B;  3B6G D;  5B0Z C;  1P3K D;  3WAA A;  3X1S C;  3REJ C;  1P34 C;  1KX3 D;  5DNM C;  4WV4 B;  3AZE B;  5BS7 A;  5GSU A;  3A6N D;  5BNV A;  3UTA B;  5CP6 D;  3LEL A;  3AZJ B;  1P3I D;  3REH A;  4J8U C;  3AV2 A;  2ARO B;  3LZ0 D;  3AV1 C;  1M18 D;  1AOI A;  3MGP D;  5B0Y A;  3KXB A;  2JSS A;  4XUJ C;  2L5A A;  5AVB D;  5B31 B;  4X23 B;  4H9Q A;  1P3A B;  3WKJ B;  3KUY A;  5B1L D;  1BH8 A;  1R4V A;  5BO0 B;  3AFA C;  3R45 A;  3B0D C;  4Z66 A;  1B67 A;  3W96 B;  1P3G D;  3KWQ D;  1P3O C;  5B32 D;  5AV8 B;  5B40 B;  5CPI D;  3X1T B;  5B2J C;  2FJ7 C;  5GT0 C;  1S32 A;  4J8V A;  3LZ1 D;  3REI D;  5DNN B;  3AN2 A;  2NQB C;  1ULY A;  1P3B C;  1ID3 B;  3X1V B;  3LJA D;  3MGQ A;  1F1E A;  3C1C C;  1ZLA B;  5JRG D;  3MGS D;  3W98 D;  2IO5 C;  4G92 B;  4H9P B;  5CPK D;  4ZUX A;  3W99 D;  1TZY C;  1P3M D;  5GXQ A;  5F99 D;  4J8X D;  2HIO C;  3MNN B;  2YFV B;  3W99 C;  2RVQ D;  5FUG A;  3AZH A;  4WU8 B;  2YFW A;  3AYW C;  3WA9 A;  5B33 A;  3REL B;  4JJN C;  1KX5 B;  5AVC B;  4H9O B;  2CV5 C;  3NQU A;  4LD9 D;  3WAA C;  5B1M D;  3AZN A;  3MGR C;  3AZJ D;  3LEL D;  5CPJ A;  5B2I A;  3UT9 A;  3B6G A;  1F66 A;  1WWI A;  2LY8 A;  3AZG B;  3AV2 D;  4WNN B;  1P3K A;  3TU4 B;  3AZM B;  5BS7 C;  1TAF B;  5GSU C;  4YM6 B;  4E44 A;  3REH C;  4QLC B;  1AOI C;  4H9R A;  5B0Y C;  3KXB C;  5CP6 A;  5B40 D;  5JA4 A;  3X1T D;  3AZK D;  1M18 A;  3KUY C;  4CSR A;  3MGP A;  3AZI A;  4UUZ A;  4KGC C;  3REJ B;  1P34 B;  1A7W A;  5AVB A;  5DNM B;  4Z66 C;  4WU9 A;  5B1L A;  4J8W D;  1ID3 D;  4CAY B;  3AZL D;  3X1V D;  3MGQ D;  4E45 A;  3REK B;  1S32 C;  4J8U B;  3AV1 B;  4J8V C;  4H9N B;  3AN2 C;  5AV9 C;  4XUJ B;  4KUD A;  4ZUX D;  4R8P D;  3WTP D;  1KX4 C;  3LZ1 A;  5GXQ D;  3W97 A;  1Q9C A;  3AFA B;  3B0D B;  3LJA A;  1P3O B;  1EQZ D;  3AZH D;  1P3P B;  5BNX B;  5B2J B;  2FJ7 B;  5B33 D;  2BYM B;  1P3F B;  2PYO C;  2BYK B;  3V9R B;  2NQB B;  5AVC D;  3UTB D;  5F99 A;  4J8X A;  1P3B B;  3X1U A;  2HUE C;  1U35 C;  2F8N B;  5G49 B;  1M19 C;  4H9S A;  3WA9 C;  4XZQ D;  3C1C B;  5CPJ D;  4YS3 A;  5B2I D;  3UT9 D;  1F66 D;  2IO5 B;  4AWL C;  1H3O B;  5AY8 C;  3VH5 T;  1BFM A;  3AZN C;  2HIO B;  3AZE A;  3B6G C;  4LD9 A;  3UTA A;  1P3K C;  5B1M A;  3AZJ A;  1P3L D;  1M1A D;  3AZF D;  3AYW B;  3AZI D;  1KX3 C;  1HQ3 B;  4JJN B;  3A6N C;  2CV5 B;  5CP6 C;  4WU9 D;  1P3I C;  3WAA B;  3LZ0 C;  3MGR B;  5BO0 A;  1M18 C;  3MGP C;  5B24 D;  3REK D;  3W96 A;  5AVB C;  5AV5 D;  5B40 A;  3AZK A;  3X1T A;  3MVD B;  5GSU B;  4KUD D;  5B1L C;  1JFI B;  5BNV B;  5DNN A;  4KHA A;  3W97 D;  3REH B;  3C1B D;  1P3G C;  3KWQ C;  4J8W A;  1ID3 A;  4Z5T D;  5B32 C;  1AOI B;  5B0Y B;  5CPI C;  3AZL A;  3X1V A;  3KXB B;  1P3P D;  1ZLA A;  3KUY B;  3LZ1 C;  3REI C;  5E5A D;  4KGC B;  4H9P A;  1P3F D;  4R8P A;  4EO5 C;  3WTP A;  3LJA C;  4NE5 A;  4Z66 B;  3B6F D;  3VH6 W;  3X1U D;  5JRG C;  3MGS C;  3W98 C;  1S32 B;  5CPK C;  3KSY A;  4YS3 D;  3O62 D;  4J8V B;  1EQZ A;  4WU8 A;  3AN2 B;  5AV9 B;  1P3M C;  5F99 C;  3NQJ B;  4J8X C;  2F8N K;  1KX4 B;  5AVC A;  3UTB A;  1WWS A;  3AZE D;  5GT3 B;  2RVQ C;  3UTA D;  4XZQ A;  2ARO D;  3AZG A;  3VH6 A;  2PYO B;  1TAF A;  4LD9 C;  5B31 D;  5B1M C;  4X23 D;  4YM6 A;  2CWE A;  1P3A D;  3WKJ D;  2NZD B;  3AZJ C;  5AV6 B;  2HUE B;  5FUG B;  3LEL C;  1U35 B;  2YFW B;  3AV2 C;  1M19 B;  4G91 B;  3WA9 B;  4DRA A;  3W96 D;  1P3L A;  1M1A A;  3AZF A;  5AV8 D;  5B0Z B;  4AWL B;  3X1S B;  3MVD D;  5AY8 B;  3NQU B;  5B31 G;  1N1J A;  3REJ A;  3AZN B;  5DNN D;  5DNM A;  3B6G B;  4CAY A;  5B40 C;  3AZK C;  3X1T C;  5B24 A;  3REK A;  4J8U A;  3AV1 A;  1ZLA D;  4H9N A;  5AV5 A;  1KX3 B;  4XUJ A; 
#chains in the Genus database with same CATH topology
 3B0C T;  1BH9 A;  4H9R B;  3A6N B;  4J8W C;  1ID3 C;  2FFF B;  3AZL C;  3X1V C;  5CP6 B;  3MGQ C;  1P3I B;  3C1B A;  5JA4 B;  3LZ0 B;  4Z5T A;  1M18 B;  3MNN D;  3MGP B;  4UUZ B;  4G92 C;  5KDM B;  4ZUX C;  5AVB B;  4R8P C;  1P3O A;  3WTP C;  1P3P A;  5BNX A;  1KU5 A;  4WU8 D;  2FJ7 A;  5GXQ C;  5E5A A;  2Y2H A;  5GT0 B;  3REL D;  1P3F A;  2BYK A;  1KX5 D;  3V9R A;  1P3G B;  3KWQ B;  1P3B A;  5GT3 D;  5B32 B;  3B6F A;  1EQZ C;  5CPI B;  3AZH C;  5B33 C;  3O62 A;  3LZ1 B;  3REI B;  3AZG D;  5AVC C;  3UTB C;  3TU4 D;  3AZM D;  4EO5 B;  3A1I A;  3LJA B;  1TZY B;  2RIQ A;  4YM6 D;  2HIO A;  2NZD D;  4XZQ C;  5C3I C;  5CPJ C;  3H0M C;  4QLC D;  5JRG B;  4ZBJ C;  5B2I C;  3MGS B;  3EPJ A;  3UT9 C;  1F66 C;  3W98 B;  3EPH A;  5CPK B;  1B6W A;  4UPK A;  5BT1 D;  3W99 B;  5B0Z D;  1P3M B;  2ARO A;  2Y2P A;  3X1S D;  4J8X B;  4NFT A;  1HQ3 A;  4JJN A;  3REJ D;  1P34 D;  5B31 A;  4X23 A;  1P3A A;  5DNM D;  3WKJ A;  5BT1 C;  1P3L C;  1M1A C;  3AZF C;  3MGR A;  4NE3 A;  3AZI C;  4J8U D;  3AV1 D;  5AV8 A;  2Y2K A;  3MVD A;  4XUJ D;  4WU9 C;  4LD9 B;  1HTA A;  1JFI A;  5B1M B;  3LEL B;  2G5H C;  5B24 C;  3REK C;  3AV2 B;  5AV5 C;  3AFA D;  4KUD C;  1P3O D;  4H9Q B;  5B2J D;  2FJ7 D;  5GT0 D;  4KGC A;  3W97 C;  4HGA C;  3C1B C;  1BH8 B;  4Z5T C;  3EG5 B;  3R45 B;  2NQB D;  3B0C W;  1P3B D;  1P3P C;  3AZK B;  2F8N D;  4M6B A;  3MNN A;  5E5A C;  3C1C D;  1P3F C;  2YFV A;  2F8N H;  4KHA B;  5AV9 A;  3NQJ A;  4J8W B;  3B6F C;  3X1U C;  3REL A;  3AZL B;  1KX4 A;  5B32 G;  1TZY D;  3MGQ B;  1KX5 A;  4H9S C;  2HIO D;  2F8N G;  4H9O A;  5GT3 A;  4YS3 C;  3O62 C;  4ZUX B;  4R8P B;  3WTP B;  3AYW D;  5GXQ B;  4WNN A;  3TU4 A;  2PYO A;  1HQ3 D;  4JJN D;  3AZE C;  3AZM A;  3B0B A;  2UWX A;  3UTA C;  2NZD A;  2CV5 D;  5AV6 A;  1EQZ B;  1U35 A;  3AZH B;  1PZR A;  4QLC A;  4NE6 A;  1M19 A;  2ARO C;  2Y2L A;  3VH5 W;  3MGR D;  3WAA D;  5B33 B;  2F2A C;  1HQ3 C;  5B0Z A;  5B31 C;  4X23 C;  3UTB B;  3X1S A;  1P3A C;  5AY8 A;  3WKJ C;  5GSU D;  5CHL B;  1P34 A;  4DRB A;  4XZQ B;  5C3I B;  3REH D;  5CPJ B;  3W96 C;  5B2I B;  4ZBJ B;  3UT9 B;  1AOI D;  1F66 B;  5AV8 C;  5B0Y D;  1P3K B;  3KXB D;  3MVD C;  3KUY D;  1KX3 A;  5DNN C;  4KGC D;  3VH5 A;  3A6N A;  4Z66 D;  1P3L B;  1P3I A;  1M1A B;  3WTP E;  3AZF B;  2XD1 A;  3LZ0 A;  1ZLA C;  3AFA A;  4CSR B;  3AZI B;  1N1J B;  1S32 D;  5KDM A;  4J8V D;  3AN2 D;  5B2J A;  5AV9 D;  2Y2I A;  5GT0 A;  4WU9 B;  5B1L B;  2BYM A;  1KX4 D;  3MNN C;  5B24 B;  2NQB A;  2Y2G A;  1P3G A;  3KWQ A;  5B32 A;  5AV5 B;  5CPI A;  2F8N A;  4WU8 C;  5G49 A;  3VH6 T;  4KUD B;  1BH9 B;  3REL C;  3C1C A;  3REI A;  1KX5 C;  3W97 B;  4HGA B;  3C1B B;  2PYO D;  1H3O A;  4Z5T B;  5GT3 C;  1TZY A;  5AV6 D;  1U35 D;  4Z2M H;  5JRG A;  3MGS A;  3W98 A;  1M19 D;  5E5A B;  3AZG C;  3WA9 D;  4WJ3 C;  5CPK A;  3TU4 C;  3AZM C;  3W99 A;  4WZS B;  1P3M A;  3AYW A;  4Z2M G;  4YM6 C;  5F99 B;  3B6F B;  5AY8 D;  2NZD C;  5AV6 C;  3X1U B;  4QLC C;  3AZN D;  4G91 C;  3FDD A;  2CV5 A;  2DF4 C;  2BG1 A;  3O62 B;  4YS3 B;  3B6G D;  5B0Z C;  1P3K D;  3WAA A;  3X1S C;  3REJ C;  1P34 C;  2Y2N A;  1KX3 D;  2ZM5 A;  5DNM C;  4WV4 B;  3AZE B;  5BS7 A;  5GSU A;  3A6N D;  5BNV A;  3UTA B;  5CP6 D;  3LEL A;  3AZJ B;  1P3I D;  3REH A;  4J8U C;  3AV2 A;  2ARO B;  3LZ0 D;  3AV1 C;  1M18 D;  1AOI A;  3MGP D;  5B0Y A;  3KXB A;  2JSS A;  4XUJ C;  2L5A A;  5AVB D;  5B31 B;  4X23 B;  4H9Q A;  1P3A B;  2ZY3 A;  3KUY A;  3WKJ B;  5B1L D;  3EPK A;  2ZY5 A;  1BH8 A;  1R4V A;  2Y2M A;  5BO0 B;  3AFA C;  3R45 A;  3B0D C;  4Z66 A;  1B67 A;  3W96 B;  1P3G D;  3KWQ D;  1P3O C;  5B32 D;  5AV8 B;  5B40 B;  5CPI D;  3X1T B;  5B2J C;  2FJ7 C;  5GT0 C;  1S32 A;  1Z2C B;  4J8V A;  3LZ1 D;  3REI D;  5DNN B;  3AN2 A;  2NQB C;  1ULY A;  1P3B C;  1ID3 B;  3X1V B;  3LJA D;  3MGQ A;  1F1E A;  3C1C C;  1ZLA B;  5JRG D;  3MGS D;  3W98 D;  3AL0 C;  2IO5 C;  4G92 B;  4H9P B;  5CPK D;  4ZUX A;  3W99 D;  1TZY C;  1P3M D;  5GXQ A;  2ZY4 A;  5F99 D;  4J8X D;  2HIO C;  3MNN B;  2YFV B;  3W99 C;  2RVQ D;  5FUG A;  3AZH A;  4WU8 B;  2YFW A;  3AYW C;  3WA9 A;  5B33 A;  3REL B;  4JJN C;  2XD5 A;  1KX5 B;  2Y2Q A;  5AVC B;  4H9O B;  2CV5 C;  3NQU A;  4LD9 D;  3WAA C;  5B1M D;  3AZN A;  3MGR C;  3AZJ D;  3LEL D;  5CPJ A;  5B2I A;  3UT9 A;  3B6G A;  1F66 A;  1WWI A;  2LY8 A;  2JCH A;  3AZG B;  3AV2 D;  4WNN B;  1P3K A;  3TU4 B;  3AZM B;  3P5J B;  1TAF B;  5BS7 C;  5GSU C;  2J8P A;  4YM6 B;  4E44 A;  3REH C;  4QLC B;  1AOI C;  4H9R A;  5B0Y C;  3KXB C;  5CP6 A;  5B40 D;  5JA4 A;  3X1T D;  3AZK D;  1M18 A;  3KUY C;  4CSR A;  3MGP A;  3AZI A;  4UUZ A;  4KGC C;  3REJ B;  1P34 B;  3H0R C;  1A7W A;  5AVB A;  5DNM B;  4Z66 C;  4WU9 A;  5B1L A;  4J8W D;  1ID3 D;  4CAY B;  3AZL D;  3X1V D;  3MGQ D;  2JE5 A;  4E45 A;  3REK B;  1S32 C;  4J8U B;  3AV1 B;  4J8V C;  4H9N B;  3AN2 C;  5AV9 C;  4XUJ B;  4KUD A;  4ZUX D;  4R8P D;  3WTP D;  3EPL A;  1KX4 C;  3LZ1 A;  5GXQ D;  3W97 A;  1Q9C A;  3AFA B;  3B0D B;  3LJA A;  1P3O B;  1EQZ D;  3AZH D;  1P3P B;  5BNX B;  5B2J B;  2FJ7 B;  5B33 D;  2BYM B;  1P3F B;  2PYO C;  2BYK B;  3V9R B;  2NQB B;  5AVC D;  3UTB D;  5F99 A;  4J8X A;  1P3B B;  3X1U A;  2HUE C;  1U35 C;  2F8N B;  5G49 B;  1M19 C;  4H9S A;  3WA9 C;  4XZQ D;  3C1C B;  5CPJ D;  4YS3 A;  5B2I D;  3UT9 D;  1F66 D;  2IO5 B;  4AWL C;  1H3O B;  5AY8 C;  3A1K A;  3VH5 T;  1BFM A;  3AZN C;  2HIO B;  4DQY B;  3AZE A;  3B6G C;  4LD9 A;  3UTA A;  1P3K C;  5B1M A;  3AZJ A;  1P3L D;  1M1A D;  3F6T A;  2W8S A;  3AZF D;  3AYW B;  3H0L C;  3IP4 C;  3AZI D;  1KX3 C;  1HQ3 B;  4JJN B;  2DQN C;  3A6N C;  2VQR A;  2CV5 B;  5CP6 C;  4WU9 D;  1P3I C;  3WAA B;  3LZ0 C;  3MGR B;  5BO0 A;  1M18 C;  3MGP C;  5B24 D;  3REK D;  3W96 A;  2Y2J A;  5AVB C;  1W2E A;  5B40 A;  5AV5 D;  3AZK A;  3X1T A;  3MVD B;  5GSU B;  4KUD D;  5B1L C;  1JFI B;  5BNV B;  5DNN A;  4KHA A;  3W97 D;  3REH B;  3C1B D;  1P3G C;  3KWQ C;  4J8W A;  1ID3 A;  4Z5T D;  5B32 C;  1AOI B;  5B0Y B;  5CPI C;  3AZL A;  3X1V A;  3KXB B;  1P3P D;  1ZLA A;  3KUY B;  3LZ1 C;  3REI C;  5E5A D;  4KGC B;  4H9P A;  1P3F D;  4R8P A;  4EO5 C;  3WTP A;  3LJA C;  4NE5 A;  4Z66 B;  3B6F D;  3VH6 W;  3X1U D;  5JRG C;  3MGS C;  3W98 C;  1S32 B;  5CPK C;  3KSY A;  4YS3 D;  3O62 D;  4J8V B;  1EQZ A;  4WU8 A;  2G5I C;  3AN2 B;  5AV9 B;  1P3M C;  3KFU G;  5F99 C;  3NQJ B;  4J8X C;  2ZY2 A;  2F8N K;  1KX4 B;  5AVC A;  3UTB A;  1WWS A;  3AZE D;  5GT3 B;  2RVQ C;  3UTA D;  4XZQ A;  2ARO D;  3AZG A;  3VH6 A;  2PYO B;  1TAF A;  4LD9 C;  5B31 D;  5B1M C;  4X23 D;  4YM6 A;  2CWE A;  1P3A D;  3WKJ D;  2NZD B;  3AZJ C;  5AV6 B;  2HUE B;  5FUG B;  3LEL C;  1U35 B;  2YFW B;  3AV2 C;  1M19 B;  4G91 B;  3WA9 B;  4DRA A;  3W96 D;  1P3L A;  1M1A A;  3AZF A;  5AV8 D;  5B0Z B;  4AWL B;  3X1S B;  3MVD D;  5AY8 B;  3NQU B;  5B31 G;  1N1J A;  3REJ A;  3AZN B;  5DNN D;  5DNM A;  3B6G B;  4CAY A;  5B40 C;  3AZK C;  3X1T C;  5B24 A;  3REK A;  2Y2O A;  4J8U A;  3AV1 A;  1T3U A;  1ZLA D;  4H9N A;  5AV5 A;  1KX3 B;  4XUJ A; 
#chains in the Genus database with same CATH homology
 3B0C T;  1BH9 A;  4H9R B;  3A6N B;  4J8W C;  1ID3 C;  2FFF B;  3AZL C;  3X1V C;  5CP6 B;  3MGQ C;  1P3I B;  3C1B A;  5JA4 B;  3LZ0 B;  4Z5T A;  1M18 B;  3MNN D;  3MGP B;  4UUZ B;  4G92 C;  5KDM B;  4ZUX C;  5AVB B;  4R8P C;  1P3O A;  3WTP C;  1P3P A;  5BNX A;  1KU5 A;  4WU8 D;  2FJ7 A;  5GXQ C;  5E5A A;  2Y2H A;  5GT0 B;  3REL D;  1P3F A;  2BYK A;  1KX5 D;  3V9R A;  1P3G B;  3KWQ B;  1P3B A;  5GT3 D;  5B32 B;  3B6F A;  1EQZ C;  5CPI B;  3AZH C;  5B33 C;  3O62 A;  3LZ1 B;  3REI B;  3AZG D;  5AVC C;  3UTB C;  3TU4 D;  3AZM D;  4EO5 B;  3A1I A;  3LJA B;  1TZY B;  2RIQ A;  4YM6 D;  2HIO A;  2NZD D;  4XZQ C;  5C3I C;  5CPJ C;  3H0M C;  4QLC D;  5JRG B;  4ZBJ C;  5B2I C;  3MGS B;  3EPJ A;  3UT9 C;  1F66 C;  3W98 B;  3EPH A;  5CPK B;  1B6W A;  4UPK A;  5BT1 D;  3W99 B;  5B0Z D;  1P3M B;  2ARO A;  2Y2P A;  3X1S D;  4J8X B;  4NFT A;  1HQ3 A;  4JJN A;  3REJ D;  1P34 D;  5B31 A;  4X23 A;  1P3A A;  5DNM D;  3WKJ A;  5BT1 C;  1P3L C;  1M1A C;  3AZF C;  3MGR A;  4NE3 A;  3AZI C;  4J8U D;  3AV1 D;  5AV8 A;  2Y2K A;  3MVD A;  4XUJ D;  4WU9 C;  4LD9 B;  1HTA A;  1JFI A;  5B1M B;  3LEL B;  2G5H C;  5B24 C;  3REK C;  3AV2 B;  5AV5 C;  3AFA D;  4KUD C;  1P3O D;  4H9Q B;  5B2J D;  2FJ7 D;  5GT0 D;  4KGC A;  3W97 C;  4HGA C;  3C1B C;  1BH8 B;  4Z5T C;  3EG5 B;  3R45 B;  2NQB D;  3B0C W;  1P3B D;  1P3P C;  3AZK B;  2F8N D;  4M6B A;  3MNN A;  5E5A C;  3C1C D;  1P3F C;  2YFV A;  2F8N H;  4KHA B;  5AV9 A;  3NQJ A;  4J8W B;  3B6F C;  3X1U C;  3REL A;  3AZL B;  1KX4 A;  5B32 G;  1TZY D;  3MGQ B;  1KX5 A;  4H9S C;  2HIO D;  2F8N G;  4H9O A;  5GT3 A;  4YS3 C;  3O62 C;  4ZUX B;  4R8P B;  3WTP B;  3AYW D;  5GXQ B;  4WNN A;  3TU4 A;  2PYO A;  1HQ3 D;  4JJN D;  3AZE C;  3AZM A;  3B0B A;  2UWX A;  3UTA C;  2NZD A;  2CV5 D;  5AV6 A;  1EQZ B;  1U35 A;  3AZH B;  1PZR A;  4QLC A;  4NE6 A;  1M19 A;  2ARO C;  2Y2L A;  3VH5 W;  3MGR D;  3WAA D;  5B33 B;  2F2A C;  1HQ3 C;  5B0Z A;  5B31 C;  4X23 C;  3UTB B;  3X1S A;  1P3A C;  5AY8 A;  3WKJ C;  5GSU D;  5CHL B;  1P34 A;  4DRB A;  4XZQ B;  5C3I B;  3REH D;  5CPJ B;  3W96 C;  5B2I B;  4ZBJ B;  3UT9 B;  1AOI D;  1F66 B;  5AV8 C;  5B0Y D;  1P3K B;  3KXB D;  3MVD C;  3KUY D;  1KX3 A;  5DNN C;  4KGC D;  3VH5 A;  3A6N A;  4Z66 D;  1P3L B;  1P3I A;  1M1A B;  3WTP E;  3AZF B;  2XD1 A;  3LZ0 A;  1ZLA C;  3AFA A;  4CSR B;  3AZI B;  1N1J B;  1S32 D;  5KDM A;  4J8V D;  3AN2 D;  5B2J A;  5AV9 D;  2Y2I A;  5GT0 A;  4WU9 B;  5B1L B;  2BYM A;  1KX4 D;  3MNN C;  5B24 B;  2NQB A;  2Y2G A;  1P3G A;  3KWQ A;  5B32 A;  5AV5 B;  5CPI A;  2F8N A;  4WU8 C;  5G49 A;  3VH6 T;  4KUD B;  1BH9 B;  3REL C;  3C1C A;  3REI A;  1KX5 C;  3W97 B;  4HGA B;  3C1B B;  2PYO D;  1H3O A;  4Z5T B;  5GT3 C;  1TZY A;  5AV6 D;  1U35 D;  4Z2M H;  5JRG A;  3MGS A;  3W98 A;  1M19 D;  5E5A B;  3AZG C;  3WA9 D;  4WJ3 C;  5CPK A;  3TU4 C;  3AZM C;  3W99 A;  4WZS B;  1P3M A;  3AYW A;  4Z2M G;  4YM6 C;  5F99 B;  3B6F B;  5AY8 D;  2NZD C;  5AV6 C;  3X1U B;  4QLC C;  3AZN D;  4G91 C;  3FDD A;  2CV5 A;  2DF4 C;  2BG1 A;  3O62 B;  4YS3 B;  3B6G D;  5B0Z C;  1P3K D;  3WAA A;  3X1S C;  3REJ C;  1P34 C;  2Y2N A;  1KX3 D;  2ZM5 A;  5DNM C;  4WV4 B;  3AZE B;  5BS7 A;  5GSU A;  3A6N D;  5BNV A;  3UTA B;  5CP6 D;  3LEL A;  3AZJ B;  1P3I D;  3REH A;  4J8U C;  3AV2 A;  2ARO B;  3LZ0 D;  3AV1 C;  1M18 D;  1AOI A;  3MGP D;  5B0Y A;  3KXB A;  2JSS A;  4XUJ C;  2L5A A;  5AVB D;  5B31 B;  4X23 B;  4H9Q A;  1P3A B;  2ZY3 A;  3KUY A;  3WKJ B;  5B1L D;  3EPK A;  2ZY5 A;  1BH8 A;  1R4V A;  2Y2M A;  5BO0 B;  3AFA C;  3R45 A;  3B0D C;  4Z66 A;  1B67 A;  3W96 B;  1P3G D;  3KWQ D;  1P3O C;  5B32 D;  5AV8 B;  5B40 B;  5CPI D;  3X1T B;  5B2J C;  2FJ7 C;  5GT0 C;  1S32 A;  1Z2C B;  4J8V A;  3LZ1 D;  3REI D;  5DNN B;  3AN2 A;  2NQB C;  1ULY A;  1P3B C;  1ID3 B;  3X1V B;  3LJA D;  3MGQ A;  1F1E A;  3C1C C;  1ZLA B;  5JRG D;  3MGS D;  3W98 D;  3AL0 C;  2IO5 C;  4G92 B;  4H9P B;  5CPK D;  4ZUX A;  3W99 D;  1TZY C;  1P3M D;  5GXQ A;  2ZY4 A;  5F99 D;  4J8X D;  2HIO C;  3MNN B;  2YFV B;  3W99 C;  2RVQ D;  5FUG A;  3AZH A;  4WU8 B;  2YFW A;  3AYW C;  3WA9 A;  5B33 A;  3REL B;  4JJN C;  2XD5 A;  1KX5 B;  2Y2Q A;  5AVC B;  4H9O B;  2CV5 C;  3NQU A;  4LD9 D;  3WAA C;  5B1M D;  3AZN A;  3MGR C;  3AZJ D;  3LEL D;  5CPJ A;  5B2I A;  3UT9 A;  3B6G A;  1F66 A;  1WWI A;  2LY8 A;  2JCH A;  3AZG B;  3AV2 D;  4WNN B;  1P3K A;  3TU4 B;  3AZM B;  3P5J B;  1TAF B;  5BS7 C;  5GSU C;  2J8P A;  4YM6 B;  4E44 A;  3REH C;  4QLC B;  1AOI C;  4H9R A;  5B0Y C;  3KXB C;  5CP6 A;  5B40 D;  5JA4 A;  3X1T D;  3AZK D;  1M18 A;  3KUY C;  4CSR A;  3MGP A;  3AZI A;  4UUZ A;  4KGC C;  3REJ B;  1P34 B;  3H0R C;  1A7W A;  5AVB A;  5DNM B;  4Z66 C;  4WU9 A;  5B1L A;  4J8W D;  1ID3 D;  4CAY B;  3AZL D;  3X1V D;  3MGQ D;  2JE5 A;  4E45 A;  3REK B;  1S32 C;  4J8U B;  3AV1 B;  4J8V C;  4H9N B;  3AN2 C;  5AV9 C;  4XUJ B;  4KUD A;  4ZUX D;  4R8P D;  3WTP D;  3EPL A;  1KX4 C;  3LZ1 A;  5GXQ D;  3W97 A;  1Q9C A;  3AFA B;  3B0D B;  3LJA A;  1P3O B;  1EQZ D;  3AZH D;  1P3P B;  5BNX B;  5B2J B;  2FJ7 B;  5B33 D;  2BYM B;  1P3F B;  2PYO C;  2BYK B;  3V9R B;  2NQB B;  5AVC D;  3UTB D;  5F99 A;  4J8X A;  1P3B B;  3X1U A;  2HUE C;  1U35 C;  2F8N B;  5G49 B;  1M19 C;  4H9S A;  3WA9 C;  4XZQ D;  3C1C B;  5CPJ D;  4YS3 A;  5B2I D;  3UT9 D;  1F66 D;  2IO5 B;  4AWL C;  1H3O B;  5AY8 C;  3A1K A;  3VH5 T;  1BFM A;  3AZN C;  2HIO B;  4DQY B;  3AZE A;  3B6G C;  4LD9 A;  3UTA A;  1P3K C;  5B1M A;  3AZJ A;  1P3L D;  1M1A D;  3F6T A;  2W8S A;  3AZF D;  3AYW B;  3H0L C;  3IP4 C;  3AZI D;  1KX3 C;  1HQ3 B;  4JJN B;  2DQN C;  3A6N C;  2VQR A;  2CV5 B;  5CP6 C;  4WU9 D;  1P3I C;  3WAA B;  3LZ0 C;  3MGR B;  5BO0 A;  1M18 C;  3MGP C;  5B24 D;  3REK D;  3W96 A;  2Y2J A;  5AVB C;  1W2E A;  5B40 A;  5AV5 D;  3AZK A;  3X1T A;  3MVD B;  5GSU B;  4KUD D;  5B1L C;  1JFI B;  5BNV B;  5DNN A;  4KHA A;  3W97 D;  3REH B;  3C1B D;  1P3G C;  3KWQ C;  4J8W A;  1ID3 A;  4Z5T D;  5B32 C;  1AOI B;  5B0Y B;  5CPI C;  3AZL A;  3X1V A;  3KXB B;  1P3P D;  1ZLA A;  3KUY B;  3LZ1 C;  3REI C;  5E5A D;  4KGC B;  4H9P A;  1P3F D;  4R8P A;  4EO5 C;  3WTP A;  3LJA C;  4NE5 A;  4Z66 B;  3B6F D;  3VH6 W;  3X1U D;  5JRG C;  3MGS C;  3W98 C;  1S32 B;  5CPK C;  3KSY A;  4YS3 D;  3O62 D;  4J8V B;  1EQZ A;  4WU8 A;  2G5I C;  3AN2 B;  5AV9 B;  1P3M C;  3KFU G;  5F99 C;  3NQJ B;  4J8X C;  2ZY2 A;  2F8N K;  1KX4 B;  5AVC A;  3UTB A;  1WWS A;  3AZE D;  5GT3 B;  2RVQ C;  3UTA D;  4XZQ A;  2ARO D;  3AZG A;  3VH6 A;  2PYO B;  1TAF A;  4LD9 C;  5B31 D;  5B1M C;  4X23 D;  4YM6 A;  2CWE A;  1P3A D;  3WKJ D;  2NZD B;  3AZJ C;  5AV6 B;  2HUE B;  5FUG B;  3LEL C;  1U35 B;  2YFW B;  3AV2 C;  1M19 B;  4G91 B;  3WA9 B;  4DRA A;  3W96 D;  1P3L A;  1M1A A;  3AZF A;  5AV8 D;  5B0Z B;  4AWL B;  3X1S B;  3MVD D;  5AY8 B;  3NQU B;  5B31 G;  1N1J A;  3REJ A;  3AZN B;  5DNN D;  5DNM A;  3B6G B;  4CAY A;  5B40 C;  3AZK C;  3X1T C;  5B24 A;  3REK A;  2Y2O A;  4J8U A;  3AV1 A;  1T3U A;  1ZLA D;  4H9N A;  5AV5 A;  1KX3 B;  4XUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...