3X1UB

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uB00
5CPJD 4WV4B 5AV9C 5JRGB 4NE6A 3LZ0D 4Z5TA 5C3IB 1BH8A 4KGCC 3AFAD 4UUZA 1P3AD 2NQBA 5BO0B 5B31D 5B2IC 1WWIA 4QLCC 1KX3A 5B0YD 3X1VD 1N1JA 1KU5A 5AVBB 5AVCC 2F8NG 3KXBA 4WU9A 3KUYD 3X1SD 1S32B 3UT9B 3W98B 5BS7C 5B33B 4J8UA 3X1TB 1U35D 4YM6D 5CPJC 3W99A 4ZUXA 3LJAC 5GT3D 5DNMB 4XZQB 4H9RB 3C1CA 2BYKB 3AZNA 3LZ0C 4J8XA 3KWQA 5AY8A 4NE3A 3AFAC 1P3AC 3LZ1B 5B31C 1P3BA 5BNVA 3AZMB 4XUJC 5B0YC 1P3FA 3X1VC 3R45B 3B0BA 4J8WB 3WKJB 3A6NB 3X1SC 3WTPE 3MGPB 1M1AC 2PYOA 4YM6C 1EQZC 4J8VD 5CPKD 2FJ7D 3W96C 3UTAB 3TU4A 2YFWA 3REHB 3X1UC 1HTAA 3AN2A 4YS3A 1P3OB 5BT1D 3WAAA 3W97A 4Z66B 2FJ7C 4KHAA 5B0ZD 2CV5B 2BYMA 1ULYA 3AZLB 3WTPB 5AV9A 1TZYB 4Z5TD 4E45A 1P3LB 3REID 3UTBB 5E5AB 2NQBD 3MGRA 5BT1C 1BH9A 1KX3D 4WNNB 5B32B 1P34C 4WU9D 3KXBD 4CAYB 4H9QB 5B0ZC 2RVQD 4H9PB 5B24A 5G49B 1H3OB 3W99D 4ZUXD 5B40B 3LJAA 4DRBA 3AZEC 4R8PB 3C1BA 1M18A 3C1CD 5GXQB 5GT0A 3B0CW 3KWQD 4X23B 4J8XD 5AY8D 1ID3B 3REIC 1P3AA 1P3KC 2NQBC 5KDMA 4XUJA 1P3FD 1P3MB 2NZDB 3NQUB 1M1AA 2RVQC 1M19A 2PYOD 1EQZA 5B32G 3W99C 4ZUXC 2YFVA 5BNXA 3MNNA 1F66B 1S32A 3C1CC 5FUGB 4J8XC 5AY8C 3W96A 2AROB 4G91B 3TU4D 4KUDB 3X1UA 5AV8A 2HUEB 1P3GA 3AN2D 4YS3D 1KX5C 4ZBJC 2PYOC 3WAAD 3W97D 4EO5B 3LZ1A 3AZFA 4LD9A 3AZHB 5DNNB 3MGSB 2JSSA 4J8WA 3A6NA 5AV9D 4H9OA 3TU4C 1JFIA 3B0DB 3VH5W 4CSRB 4H9NB 4G92B 1B6WA 3AN2C 4YS3C 3MGRD 5JA4A 1HQ3B 3NQJB 3WAAC 3W97C 1P34A 3AYWA 3MVDA 5B24D 4JJNC 5B1MC 3LJAD 3AZJA 3AZEA 3AZIA 3LELA 3VH6A 4KGCB 5B2JB 3C1BD 1M18D 5GT0D 1ZLAA 4QLCB 4Z2MH 1AOIA 3REIA 1P3KA 3MGRC 1P3IB 4HGAB 4XUJD 5CPJB 3WA9A 3RELC 1M1AD 1M19D 5B24C 3AV2A 1EQZD 5E5AA 5CP6A 3LZ0B 3B6GA 3MNND 3AFAB 3C1BC 1S32D 1M18C 5GT0C 5B31B 1KX4A 4E44A 3W96D 3X1VB 5CPIB 3KUYB 3X1SB 1F1EA 1U35B 2HIOA 3X1UD 5AV8D 1P3GD 1KX5A 2F8NH 5GT3B 5C3IC 1M19C 5GSUA 3LZ1D 3AZFD 4LD9D 4J8WD 3O62B 5F99A 3MNNC 3A6ND 1S32C 3UT9C 5AV6B 1P3PA 5B1LA 3REJA 5DNMC 4XZQC 5B31G 5AV8C 4J8VB 4WU8A 1P3GC 5CPKB 2FJ7B 3MGQA 3AZKA 3V9RB 1P34D 3LZ1C 3AZFC 3AYWD 4LD9C 3MVDD 3AV1A 4J8WC 4JJNA 3A6NC 5B1MA 3AZJD 3AZED 5AV5A 3B6FB 3AZID 3LELD 2IO5B 1ZLAD 1AOID 1P3KD 1Q9CA 3UTAC 3WA9D 3AYWC 3RELA 3MVDC 3REHC 2F8NA 3AZGB 3AV2D 5E5AD 5CP6D 3AZJC 4Z5TB 3AZIC 3B6GD 3LELC 1BH8B 3B0CT 4UUZB 2NQBB 1KX4D 1ZLAC 1KX3B 1AOIC 4DRAA 3KXBB 4WU9B 5JRGA 1TZYC 4J8UB 2HIOD 5B2JA 3W99B 4ZUXB 3WA9C 1KX5D 3REKB 3AV2C 3UTBC 5E5AC 5BO0A 5GSUD 5CP6C 3C1CB 3AZNB 4J8XB 3KWQB 5B32C 3B6GC 5AY8B 5AVBA 5F99D 3W98A 3UT9A 4H9SA 5B33A 3X1TA 1P3BB 1KX4C 1P3FB 1P3PD 5B40C 5B1LD 3REJD 5DNMA 4XZQA 4ZBJB 2PYOB 2HIOC 3KSYA 4H9RA 2BYKA 4WU8D 5GXQC 3MGQD 3AZKD 5CPIA 5GSUC 3AZMA 3AV1D 3R45A 3WKJA 5F99C 4JJND 3TU4B 5B1MD 3MGPA 5AV5D 2YFWB 1P3PC 5B1LC 3VH5T 3REJC 3AN2B 3VH6T 3AZHD 4YS3B 3O62A 3WAAB 4WU8C 3MGQC 3AZKC 4KHAB 5AV6A 3UTAA 4G91C 2BYMB 5AV9B 3RELD 3REHA 2F8ND 3AV1C 2HUEC 4AWLC 1P3OA 5AV5C 3VH5A 4Z66A 3AZHC 3MGRB 5B2IB 5DNNC 2CV5A 1BH9B 3AZLA 3WTPA 5AVCB 2L5AA 3B6FA 5JRGD 1TZYA 5B24B 5B2JD 3B0DC 3LJAB 1P3LA 3UTBA 1M18B 5GT0B 4WNNA 5B32A 1HQ3C 5AVBD 3W98D 4CAYA 3UT9D 1P3AB 4H9QA 5KDMB 4H9PA 5B33D 3X1TD 5G49A 4XUJB 5B0YB 1H3OA 3AZGA 5B40A 5DNMD 5JRGC 4XZQD 1M1AB 4R8PA 1M19B 4YM6B 5B2JC 1EQZB 5GXQA 4X23A 2YFVB 1ID3A 1TAFB 1WWSA 5CPID 1BFMA 5BNXB 3MNNB 1P3IC 4HGAC 3AZMD 1P3MA 5AVBC 3WKJD 3W96B 3W98C 2NZDA 3NQUA 3MGPD 4H9SC 5B33C 3X1TC 3REKA 3X1UB 5AV8B 1P3GB 3O62D 1F66A 5FUGA 3AZFB 4LD9B 5AV6D 2AROA 5CPIC 3UTAD 3KUYC 3REHD 3AZMC 4H9OB 1U35C 4KUDA 3WKJC 1JFIB 1P3OD 5GT3C 3MGPC 4Z66D 4WZSB 3AZHA 5JA4B 5DNNA 3MGSA 2CV5D 3O62C 3WTPD 3AZLD 1P34B 3AYWB 3B6FD 3MVDB 5B0ZB 5AV6C 1TZYD 3AZJB 3AZEB 4CSRA 3AZIB 4H9NA 3LELB 4J8VC 1P3LD 3UTBD 5CPKC 4M6BA 1P3OC 1ZLAB 1HQ3A 5B32D 3NQJA 4Z66C 1AOIB 4NE5A 3REIB 1P3KB 2CV5C 3AZGD 3WTPC 3AZLC 1N1JB 5B40D 3WA9B 3B6FC 4NFTA 4R8PD 4KGCA 3AV2B 2IO5C 5GXQD 5CP6B 5B2IA 4X23D 4QLCA 1ID3D 3B6GB 5AVCA 1P3LC 1P3IA 5BS7A 1KX4B 4J8UD 5CPJA 1P3MD 2NZDD 5BNVB 3REKD 3AZGC 2HIOB 3LZ0A 3AZND 4Z5TC 1KX5B 4R8PC 3AFAA 1F66D 5GSUB 5B31A 4X23C 1P3BD 1KX3C 1ID3C 5B0YA 2AROD 3X1VA 5F99B 3KXBC 3KUYA 3X1SA 4WU9C 4J8UC 1U35A 4KUDD 4YM6A 1P3MC 1P3PB 2NZDC 1B67A 5B1LB 3REJB 5GT3A 1TAFA 3REKC 5CHLB 4WU8B 3AZNC 2LY8A 3KWQC 3MGQB 3AZKB 5DNND 3MGSD 1F66C 3W97B 1P3BC 1P3FC 2AROC 3AV1B 4JJNB 5B1MB 4AWLB 5AV5B 4KUDC 2CWEA 4J8VA 5CPKA 2FJ7A 1HQ3D 3V9RA 4EO5C 1R4VA 3MGSC 4Z2MG 3RELB 2F8NB 2F8NK 3VH6W 4KGCD 5B2ID 4QLCD 4G92C 5AVCD 1A7WA 3C1BB 1P3ID 5B0ZA
chains in the Genus database with same CATH superfamily
5CPJD 4WV4B 5AV9C 2ZY2A 5JRGB 4NE6A 3LZ0D 4Z5TA 5C3IB 1BH8A 4KGCC 3AFAD 4UUZA 1P3AD 2NQBA 5BO0B 5B31D 5B2IC 1WWIA 4QLCC 1KX3A 5B0YD 3X1VD 1N1JA 1KU5A 5AVBB 5AVCC 2F8NG 3KXBA 4WU9A 3KUYD 3X1SD 1S32B 3UT9B 3W98B 5BS7C 5B33B 4J8UA 3X1TB 1U35D 4YM6D 5CPJC 3W99A 4ZUXA 2BG1A 3LJAC 5GT3D 5DNMB 4XZQB 4H9RB 3C1CA 2BYKB 3AZNA 3LZ0C 4J8XA 3KWQA 5AY8A 4NE3A 3AFAC 1P3AC 3LZ1B 5B31C 1P3BA 5BNVA 3AZMB 4XUJC 5B0YC 1P3FA 3X1VC 3R45B 3B0BA 4J8WB 3WKJB 3A6NB 3X1SC 3WTPE 3MGPB 1M1AC 1W2EA 2PYOA 4YM6C 1EQZC 4J8VD 5CPKD 2FJ7D 3IP4C 1T3UA 3W96C 3UTAB 2ZM5A 3TU4A 2YFWA 3REHB 3X1UC 1HTAA 3AN2A 4YS3A 1P3OB 5BT1D 2ZY5A 3WAAA 3W97A 4Z66B 2FJ7C 4KHAA 5B0ZD 2CV5B 2BYMA 1ULYA 3AZLB 3WTPB 5AV9A 1TZYB 3F6TA 4Z5TD 4E45A 1P3LB 3REID 3UTBB 5E5AB 2NQBD 3MGRA 5BT1C 1BH9A 1KX3D 4WNNB 5B32B 2W8SA 1P34C 4WU9D 3KXBD 4CAYB 4H9QB 5B0ZC 2RVQD 4H9PB 5B24A 5G49B 1H3OB 3W99D 4ZUXD 5B40B 3LJAA 4DRBA 3AZEC 4R8PB 3C1BA 1M18A 3C1CD 5GXQB 5GT0A 3B0CW 3KWQD 4X23B 4J8XD 5AY8D 1ID3B 3H0MC 3REIC 1P3AA 1P3KC 5KDMA 2NQBC 4XUJA 1P3FD 1P3MB 2NZDB 3NQUB 1M1AA 2RVQC 1M19A 2PYOD 1EQZA 5B32G 3W99C 4ZUXC 2YFVA 2DF4C 5BNXA 3MNNA 1F66B 1S32A 3C1CC 5FUGB 4J8XC 5AY8C 2Y2GA 2AROB 3W96A 4G91B 3TU4D 4KUDB 3X1UA 5AV8A 2HUEB 1P3GA 3AN2D 4YS3D 1KX5C 4ZBJC 2PYOC 3WAAD 3W97D 4EO5B 3LZ1A 3AZFA 4LD9A 1Z2CB 3AZHB 5DNNB 3MGSB 2JSSA 4J8WA 3A6NA 5AV9D 4H9OA 2Y2OA 3TU4C 1JFIA 3B0DB 3A1KA 3VH5W 4CSRB 4H9NB 4G92B 1B6WA 3AN2C 4YS3C 3MGRD 5JA4A 1HQ3B 3NQJB 3WAAC 3W97C 1P34A 3AYWA 3MVDA 5B24D 4JJNC 5B1MC 3LJAD 3AZJA 3AZEA 3AZIA 3LELA 3VH6A 4KGCB 5B2JB 3C1BD 1M18D 3EPJA 5GT0D 1ZLAA 2Y2JA 4QLCB 4Z2MH 1AOIA 3REIA 1P3KA 2F2AC 3MGRC 1P3IB 4HGAB 4XUJD 5CPJB 3WA9A 2G5HC 3RELC 1M1AD 1M19D 5B24C 3AV2A 1EQZD 5E5AA 5CP6A 3LZ0B 3B6GA 3MNND 3AFAB 3C1BC 1S32D 1M18C 1PZRA 5GT0C 5B31B 1KX4A 4E44A 3W96D 3X1VB 5CPIB 3KUYB 3X1SB 1F1EA 1U35B 2HIOA 3X1UD 5AV8D 2Y2QA 1P3GD 4UPKA 1KX5A 2F8NH 5GT3B 5C3IC 1M19C 5GSUA 3LZ1D 2Y2LA 3AZFD 4LD9D 4J8WD 3O62B 5F99A 3MNNC 3A6ND 1S32C 3UT9C 2ZY4A 5AV6B 1P3PA 5B1LA 3REJA 5DNMC 4XZQC 5B31G 5AV8C 4J8VB 4WU8A 1P3GC 5CPKB 2FJ7B 3MGQA 3AZKA 3V9RB 1P34D 3LZ1C 3AZFC 3AYWD 2JCHA 4LD9C 3MVDD 3AV1A 4J8WC 4JJNA 3A6NC 5B1MA 3AZJD 3AZED 5AV5A 3B6FB 3AZID 3LELD 2IO5B 2ZY3A 1ZLAD 1AOID 1P3KD 1Q9CA 3UTAC 3WA9D 3AYWC 3RELA 3MVDC 3REHC 2F8NA 3AZGB 3AV2D 2JE5A 3KFUG 5E5AD 5CP6D 3AZJC 4Z5TB 3AZIC 3B6GD 3LELC 1BH8B 3B0CT 4UUZB 2NQBB 1KX4D 1ZLAC 1KX3B 1AOIC 2VQRA 4DRAA 3KXBB 4WU9B 5JRGA 1TZYC 4J8UB 2HIOD 5B2JA 3W99B 4ZUXB 3WA9C 1KX5D 2UWXA 3EPLA 3REKB 3AV2C 3UTBC 5E5AC 5BO0A 5GSUD 5CP6C 3C1CB 3AZNB 4J8XB 3KWQB 5B32C 3B6GC 5AY8B 5AVBA 5F99D 3W98A 3UT9A 4H9SA 5B33A 3X1TA 1P3BB 1KX4C 1P3FB 1P3PD 5B40C 5B1LD 3REJD 5DNMA 4XZQA 4ZBJB 2PYOB 2HIOC 3KSYA 4H9RA 2BYKA 4WU8D 3H0LC 5GXQC 3MGQD 3AZKD 5CPIA 5GSUC 3AZMA 3AV1D 3R45A 3WKJA 5F99C 4JJND 3TU4B 5B1MD 3MGPA 3FDDA 5AV5D 2YFWB 1P3PC 4DQYB 5B1LC 3VH5T 3REJC 3AN2B 3VH6T 3AZHD 4YS3B 3O62A 3WAAB 4WU8C 2FFFB 3MGQC 3AZKC 4KHAB 5AV6A 3UTAA 2BYMB 4G91C 5AV9B 3RELD 3REHA 2F8ND 3AV1C 2HUEC 4AWLC 1P3OA 5AV5C 3VH5A 4Z66A 3AZHC 3MGRB 5B2IB 5DNNC 2CV5A 1BH9B 3AZLA 3WTPA 4WJ3C 5AVCB 2Y2KA 2L5AA 3B6FA 5JRGD 1TZYA 5B24B 5B2JD 3B0DC 3LJAB 2Y2NA 1P3LA 3UTBA 1M18B 3A1IA 5GT0B 4WNNA 5B32A 1HQ3C 5AVBD 3W98D 4CAYA 3UT9D 1P3AB 4H9QA 5KDMB 4H9PA 5B33D 3X1TD 4XUJB 5G49A 5B0YB 1H3OA 3AZGA 2RIQA 5B40A 5DNMD 5JRGC 4XZQD 1M1AB 4R8PA 1M19B 4YM6B 5B2JC 1EQZB 5GXQA 2DQNC 2YFVB 4X23A 1TAFB 1ID3A 1WWSA 5CPID 1BFMA 5BNXB 3MNNB 1P3IC 4HGAC 3AZMD 1P3MA 5AVBC 3WKJD 3W96B 3W98C 2NZDA 3NQUA 3MGPD 4H9SC 5B33C 3X1TC 3REKA 3X1UB 5AV8B 1P3GB 3O62D 1F66A 3H0RC 5FUGA 3AZFB 4LD9B 5AV6D 2AROA 5CPIC 3UTAD 3KUYC 3REHD 3AZMC 4H9OB 1U35C 4KUDA 3WKJC 1JFIB 1P3OD 5GT3C 3MGPC 4Z66D 4WZSB 3AZHA 5JA4B 5DNNA 3MGSA 2CV5D 3O62C 3WTPD 3AZLD 1P34B 3AYWB 3B6FD 3MVDB 5B0ZB 5AV6C 1TZYD 3AL0C 3EG5B 3AZJB 3AZEB 4CSRA 3AZIB 4H9NA 3LELB 4J8VC 1P3LD 3UTBD 5CPKC 4M6BA 1P3OC 1ZLAB 5B32D 1HQ3A 3NQJA 4Z66C 1AOIB 4NE5A 3REIB 1P3KB 3EPHA 2CV5C 3AZGD 3WTPC 3AZLC 1N1JB 5B40D 3WA9B 3B6FC 4NFTA 4R8PD 4KGCA 3AV2B 2IO5C 5GXQD 5CP6B 5B2IA 4X23D 4QLCA 1ID3D 3B6GB 5AVCA 1P3LC 1P3IA 5BS7A 1KX4B 4J8UD 5CPJA 1P3MD 2Y2MA 2NZDD 2Y2IA 2XD1A 5BNVB 3REKD 3AZGC 2HIOB 3LZ0A 3AZND 4Z5TC 1KX5B 4R8PC 3AFAA 1F66D 5GSUB 5B31A 4X23C 1P3BD 1KX3C 1ID3C 5B0YA 2AROD 3X1VA 2G5IC 5F99B 3KXBC 3KUYA 3X1SA 4WU9C 4J8UC 1U35A 4KUDD 4YM6A 1P3MC 1P3PB 3EPKA 2NZDC 1B67A 5B1LB 3REJB 5GT3A 1TAFA 2Y2PA 3REKC 5CHLB 4WU8B 3AZNC 2LY8A 3P5JB 3KWQC 3MGQB 5DNND 3MGSD 3AZKB 1F66C 3W97B 2XD5A 1P3BC 1P3FC 2AROC 3AV1B 2Y2HA 4JJNB 5B1MB 4AWLB 5AV5B 4KUDC 2CWEA 4J8VA 5CPKA 2FJ7A 1HQ3D 2J8PA 3V9RA 4EO5C 1R4VA 3MGSC 4Z2MG 3RELB 2F8NB 2F8NK 3VH6W 4KGCD 5B2ID 4QLCD 4G92C 5AVCD 1A7WA 3C1BB 1P3ID 5B0ZA
chains in the Genus database with same CATH topology
5CPJD 4WV4B 5AV9C 2ZY2A 5JRGB 4NE6A 3LZ0D 4Z5TA 5C3IB 1BH8A 4KGCC 3AFAD 4UUZA 1P3AD 2NQBA 5BO0B 5B31D 5B2IC 1WWIA 4QLCC 1KX3A 5B0YD 3X1VD 1N1JA 1KU5A 5AVBB 5AVCC 2F8NG 3KXBA 4WU9A 3KUYD 3X1SD 1S32B 3UT9B 3W98B 5BS7C 5B33B 4J8UA 3X1TB 1U35D 4YM6D 5CPJC 3W99A 4ZUXA 2BG1A 3LJAC 5GT3D 5DNMB 4XZQB 4H9RB 3C1CA 2BYKB 3AZNA 3LZ0C 4J8XA 3KWQA 5AY8A 4NE3A 3AFAC 1P3AC 3LZ1B 5B31C 1P3BA 5BNVA 3AZMB 4XUJC 5B0YC 1P3FA 3X1VC 3R45B 3B0BA 4J8WB 3WKJB 3A6NB 3X1SC 3WTPE 3MGPB 1M1AC 1W2EA 2PYOA 4YM6C 1EQZC 4J8VD 5CPKD 2FJ7D 3IP4C 1T3UA 3W96C 3UTAB 2ZM5A 3TU4A 2YFWA 3REHB 3X1UC 1HTAA 3AN2A 4YS3A 1P3OB 5BT1D 2ZY5A 3WAAA 3W97A 4Z66B 2FJ7C 4KHAA 5B0ZD 2CV5B 2BYMA 1ULYA 3AZLB 3WTPB 5AV9A 1TZYB 3F6TA 4Z5TD 4E45A 1P3LB 3REID 3UTBB 5E5AB 2NQBD 3MGRA 5BT1C 1BH9A 1KX3D 4WNNB 5B32B 2W8SA 1P34C 4WU9D 3KXBD 4CAYB 4H9QB 5B0ZC 2RVQD 4H9PB 5B24A 5G49B 1H3OB 3W99D 4ZUXD 5B40B 3LJAA 4DRBA 3AZEC 4R8PB 3C1BA 1M18A 3C1CD 5GXQB 5GT0A 3B0CW 3KWQD 4X23B 4J8XD 5AY8D 1ID3B 3H0MC 3REIC 1P3AA 1P3KC 5KDMA 2NQBC 4XUJA 1P3FD 1P3MB 2NZDB 3NQUB 1M1AA 2RVQC 1M19A 2PYOD 1EQZA 5B32G 3W99C 4ZUXC 2YFVA 2DF4C 5BNXA 3MNNA 1F66B 1S32A 3C1CC 5FUGB 4J8XC 5AY8C 2Y2GA 2AROB 3W96A 4G91B 3TU4D 4KUDB 3X1UA 5AV8A 2HUEB 1P3GA 3AN2D 4YS3D 1KX5C 4ZBJC 2PYOC 3WAAD 3W97D 4EO5B 3LZ1A 3AZFA 4LD9A 1Z2CB 3AZHB 5DNNB 3MGSB 2JSSA 4J8WA 3A6NA 5AV9D 4H9OA 2Y2OA 3TU4C 1JFIA 3B0DB 3A1KA 3VH5W 4CSRB 4H9NB 4G92B 1B6WA 3AN2C 4YS3C 3MGRD 5JA4A 1HQ3B 3NQJB 3WAAC 3W97C 1P34A 3AYWA 3MVDA 5B24D 4JJNC 5B1MC 3LJAD 3AZJA 3AZEA 3AZIA 3LELA 3VH6A 4KGCB 5B2JB 3C1BD 1M18D 3EPJA 5GT0D 1ZLAA 2Y2JA 4QLCB 4Z2MH 1AOIA 3REIA 1P3KA 2F2AC 3MGRC 1P3IB 4HGAB 4XUJD 5CPJB 3WA9A 2G5HC 3RELC 1M1AD 1M19D 5B24C 3AV2A 1EQZD 5E5AA 5CP6A 3LZ0B 3B6GA 3MNND 3AFAB 3C1BC 1S32D 1M18C 1PZRA 5GT0C 5B31B 1KX4A 4E44A 3W96D 3X1VB 5CPIB 3KUYB 3X1SB 1F1EA 1U35B 2HIOA 3X1UD 5AV8D 2Y2QA 1P3GD 4UPKA 1KX5A 2F8NH 5GT3B 5C3IC 1M19C 5GSUA 3LZ1D 2Y2LA 3AZFD 4LD9D 4J8WD 3O62B 5F99A 3MNNC 3A6ND 1S32C 3UT9C 2ZY4A 5AV6B 1P3PA 5B1LA 3REJA 5DNMC 4XZQC 5B31G 5AV8C 4J8VB 4WU8A 1P3GC 5CPKB 2FJ7B 3MGQA 3AZKA 3V9RB 1P34D 3LZ1C 3AZFC 3AYWD 2JCHA 4LD9C 3MVDD 3AV1A 4J8WC 4JJNA 3A6NC 5B1MA 3AZJD 3AZED 5AV5A 3B6FB 3AZID 3LELD 2IO5B 2ZY3A 1ZLAD 1AOID 1P3KD 1Q9CA 3UTAC 3WA9D 3AYWC 3RELA 3MVDC 3REHC 2F8NA 3AZGB 3AV2D 2JE5A 3KFUG 5E5AD 5CP6D 3AZJC 4Z5TB 3AZIC 3B6GD 3LELC 1BH8B 3B0CT 4UUZB 2NQBB 1KX4D 1ZLAC 1KX3B 1AOIC 2VQRA 4DRAA 3KXBB 4WU9B 5JRGA 1TZYC 4J8UB 2HIOD 5B2JA 3W99B 4ZUXB 3WA9C 1KX5D 2UWXA 3EPLA 3REKB 3AV2C 3UTBC 5E5AC 5BO0A 5GSUD 5CP6C 3C1CB 3AZNB 4J8XB 3KWQB 5B32C 3B6GC 5AY8B 5AVBA 5F99D 3W98A 3UT9A 4H9SA 5B33A 3X1TA 1P3BB 1KX4C 1P3FB 1P3PD 5B40C 5B1LD 3REJD 5DNMA 4XZQA 4ZBJB 2PYOB 2HIOC 3KSYA 4H9RA 2BYKA 4WU8D 3H0LC 5GXQC 3MGQD 3AZKD 5CPIA 5GSUC 3AZMA 3AV1D 3R45A 3WKJA 5F99C 4JJND 3TU4B 5B1MD 3MGPA 3FDDA 5AV5D 2YFWB 1P3PC 4DQYB 5B1LC 3VH5T 3REJC 3AN2B 3VH6T 3AZHD 4YS3B 3O62A 3WAAB 4WU8C 2FFFB 3MGQC 3AZKC 4KHAB 5AV6A 3UTAA 2BYMB 4G91C 5AV9B 3RELD 3REHA 2F8ND 3AV1C 2HUEC 4AWLC 1P3OA 5AV5C 3VH5A 4Z66A 3AZHC 3MGRB 5B2IB 5DNNC 2CV5A 1BH9B 3AZLA 3WTPA 4WJ3C 5AVCB 2Y2KA 2L5AA 3B6FA 5JRGD 1TZYA 5B24B 5B2JD 3B0DC 3LJAB 2Y2NA 1P3LA 3UTBA 1M18B 3A1IA 5GT0B 4WNNA 5B32A 1HQ3C 5AVBD 3W98D 4CAYA 3UT9D 1P3AB 4H9QA 5KDMB 4H9PA 5B33D 3X1TD 4XUJB 5G49A 5B0YB 1H3OA 3AZGA 2RIQA 5B40A 5DNMD 5JRGC 4XZQD 1M1AB 4R8PA 1M19B 4YM6B 5B2JC 1EQZB 5GXQA 2DQNC 2YFVB 4X23A 1TAFB 1ID3A 1WWSA 5CPID 1BFMA 5BNXB 3MNNB 1P3IC 4HGAC 3AZMD 1P3MA 5AVBC 3WKJD 3W96B 3W98C 2NZDA 3NQUA 3MGPD 4H9SC 5B33C 3X1TC 3REKA 3X1UB 5AV8B 1P3GB 3O62D 1F66A 3H0RC 5FUGA 3AZFB 4LD9B 5AV6D 2AROA 5CPIC 3UTAD 3KUYC 3REHD 3AZMC 4H9OB 1U35C 4KUDA 3WKJC 1JFIB 1P3OD 5GT3C 3MGPC 4Z66D 4WZSB 3AZHA 5JA4B 5DNNA 3MGSA 2CV5D 3O62C 3WTPD 3AZLD 1P34B 3AYWB 3B6FD 3MVDB 5B0ZB 5AV6C 1TZYD 3AL0C 3EG5B 3AZJB 3AZEB 4CSRA 3AZIB 4H9NA 3LELB 4J8VC 1P3LD 3UTBD 5CPKC 4M6BA 1P3OC 1ZLAB 5B32D 1HQ3A 3NQJA 4Z66C 1AOIB 4NE5A 3REIB 1P3KB 3EPHA 2CV5C 3AZGD 3WTPC 3AZLC 1N1JB 5B40D 3WA9B 3B6FC 4NFTA 4R8PD 4KGCA 3AV2B 2IO5C 5GXQD 5CP6B 5B2IA 4X23D 4QLCA 1ID3D 3B6GB 5AVCA 1P3LC 1P3IA 5BS7A 1KX4B 4J8UD 5CPJA 1P3MD 2Y2MA 2NZDD 2Y2IA 2XD1A 5BNVB 3REKD 3AZGC 2HIOB 3LZ0A 3AZND 4Z5TC 1KX5B 4R8PC 3AFAA 1F66D 5GSUB 5B31A 4X23C 1P3BD 1KX3C 1ID3C 5B0YA 2AROD 3X1VA 2G5IC 5F99B 3KXBC 3KUYA 3X1SA 4WU9C 4J8UC 1U35A 4KUDD 4YM6A 1P3MC 1P3PB 3EPKA 2NZDC 1B67A 5B1LB 3REJB 5GT3A 1TAFA 2Y2PA 3REKC 5CHLB 4WU8B 3AZNC 2LY8A 3P5JB 3KWQC 3MGQB 5DNND 3MGSD 3AZKB 1F66C 3W97B 2XD5A 1P3BC 1P3FC 2AROC 3AV1B 2Y2HA 4JJNB 5B1MB 4AWLB 5AV5B 4KUDC 2CWEA 4J8VA 5CPKA 2FJ7A 1HQ3D 2J8PA 3V9RA 4EO5C 1R4VA 3MGSC 4Z2MG 3RELB 2F8NB 2F8NK 3VH6W 4KGCD 5B2ID 4QLCD 4G92C 5AVCD 1A7WA 3C1BB 1P3ID 5B0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ D;  4WV4 B;  5AV9 C;  5JRG B;  4NE6 A;  3LZ0 D;  4Z5T A;  5C3I B;  1BH8 A;  4KGC C;  3AFA D;  4UUZ A;  1P3A D;  2NQB A;  5BO0 B;  5B31 D;  5B2I C;  1WWI A;  4QLC C;  1KX3 A;  5B0Y D;  3X1V D;  1N1J A;  1KU5 A;  5AVB B;  5AVC C;  2F8N G;  3KXB A;  4WU9 A;  3KUY D;  3X1S D;  1S32 B;  3UT9 B;  3W98 B;  5BS7 C;  5B33 B;  4J8U A;  3X1T B;  1U35 D;  4YM6 D;  5CPJ C;  3W99 A;  4ZUX A;  3LJA C;  5GT3 D;  5DNM B;  4XZQ B;  4H9R B;  3C1C A;  2BYK B;  3AZN A;  3LZ0 C;  4J8X A;  3KWQ A;  5AY8 A;  4NE3 A;  3AFA C;  1P3A C;  3LZ1 B;  5B31 C;  1P3B A;  5BNV A;  3AZM B;  4XUJ C;  5B0Y C;  1P3F A;  3X1V C;  3R45 B;  3B0B A;  4J8W B;  3WKJ B;  3A6N B;  3X1S C;  3WTP E;  3MGP B;  1M1A C;  2PYO A;  4YM6 C;  1EQZ C;  4J8V D;  5CPK D;  2FJ7 D;  3W96 C;  3UTA B;  3TU4 A;  2YFW A;  3REH B;  3X1U C;  1HTA A;  3AN2 A;  4YS3 A;  1P3O B;  5BT1 D;  3WAA A;  3W97 A;  4Z66 B;  2FJ7 C;  4KHA A;  5B0Z D;  2CV5 B;  2BYM A;  1ULY A;  3AZL B;  3WTP B;  5AV9 A;  1TZY B;  4Z5T D;  4E45 A;  1P3L B;  3REI D;  3UTB B;  5E5A B;  2NQB D;  3MGR A;  5BT1 C;  1BH9 A;  1KX3 D;  4WNN B;  5B32 B;  1P34 C;  4WU9 D;  3KXB D;  4CAY B;  4H9Q B;  5B0Z C;  2RVQ D;  4H9P B;  5B24 A;  5G49 B;  1H3O B;  3W99 D;  4ZUX D;  5B40 B;  3LJA A;  4DRB A;  3AZE C;  4R8P B;  3C1B A;  1M18 A;  3C1C D;  5GXQ B;  5GT0 A;  3B0C W;  3KWQ D;  4X23 B;  4J8X D;  5AY8 D;  1ID3 B;  3REI C;  1P3A A;  1P3K C;  2NQB C;  5KDM A;  4XUJ A;  1P3F D;  1P3M B;  2NZD B;  3NQU B;  1M1A A;  2RVQ C;  1M19 A;  2PYO D;  1EQZ A;  5B32 G;  3W99 C;  4ZUX C;  2YFV A;  5BNX A;  3MNN A;  1F66 B;  1S32 A;  3C1C C;  5FUG B;  4J8X C;  5AY8 C;  3W96 A;  2ARO B;  4G91 B;  3TU4 D;  4KUD B;  3X1U A;  5AV8 A;  2HUE B;  1P3G A;  3AN2 D;  4YS3 D;  1KX5 C;  4ZBJ C;  2PYO C;  3WAA D;  3W97 D;  4EO5 B;  3LZ1 A;  3AZF A;  4LD9 A;  3AZH B;  5DNN B;  3MGS B;  2JSS A;  4J8W A;  3A6N A;  5AV9 D;  4H9O A;  3TU4 C;  1JFI A;  3B0D B;  3VH5 W;  4CSR B;  4H9N B;  4G92 B;  1B6W A;  3AN2 C;  4YS3 C;  3MGR D;  5JA4 A;  1HQ3 B;  3NQJ B;  3WAA C;  3W97 C;  1P34 A;  3AYW A;  3MVD A;  5B24 D;  4JJN C;  5B1M C;  3LJA D;  3AZJ A;  3AZE A;  3AZI A;  3LEL A;  3VH6 A;  4KGC B;  5B2J B;  3C1B D;  1M18 D;  5GT0 D;  1ZLA A;  4QLC B;  4Z2M H;  1AOI A;  3REI A;  1P3K A;  3MGR C;  1P3I B;  4HGA B;  4XUJ D;  5CPJ B;  3WA9 A;  3REL C;  1M1A D;  1M19 D;  5B24 C;  3AV2 A;  1EQZ D;  5E5A A;  5CP6 A;  3LZ0 B;  3B6G A;  3MNN D;  3AFA B;  3C1B C;  1S32 D;  1M18 C;  5GT0 C;  5B31 B;  1KX4 A;  4E44 A;  3W96 D;  3X1V B;  5CPI B;  3KUY B;  3X1S B;  1F1E A;  1U35 B;  2HIO A;  3X1U D;  5AV8 D;  1P3G D;  1KX5 A;  2F8N H;  5GT3 B;  5C3I C;  1M19 C;  5GSU A;  3LZ1 D;  3AZF D;  4LD9 D;  4J8W D;  3O62 B;  5F99 A;  3MNN C;  3A6N D;  1S32 C;  3UT9 C;  5AV6 B;  1P3P A;  5B1L A;  3REJ A;  5DNM C;  4XZQ C;  5B31 G;  5AV8 C;  4J8V B;  4WU8 A;  1P3G C;  5CPK B;  2FJ7 B;  3MGQ A;  3AZK A;  3V9R B;  1P34 D;  3LZ1 C;  3AZF C;  3AYW D;  4LD9 C;  3MVD D;  3AV1 A;  4J8W C;  4JJN A;  3A6N C;  5B1M A;  3AZJ D;  3AZE D;  5AV5 A;  3B6F B;  3AZI D;  3LEL D;  2IO5 B;  1ZLA D;  1AOI D;  1P3K D;  1Q9C A;  3UTA C;  3WA9 D;  3AYW C;  3REL A;  3MVD C;  3REH C;  2F8N A;  3AZG B;  3AV2 D;  5E5A D;  5CP6 D;  3AZJ C;  4Z5T B;  3AZI C;  3B6G D;  3LEL C;  1BH8 B;  3B0C T;  4UUZ B;  2NQB B;  1KX4 D;  1ZLA C;  1KX3 B;  1AOI C;  4DRA A;  3KXB B;  4WU9 B;  5JRG A;  1TZY C;  4J8U B;  2HIO D;  5B2J A;  3W99 B;  4ZUX B;  3WA9 C;  1KX5 D;  3REK B;  3AV2 C;  3UTB C;  5E5A C;  5BO0 A;  5GSU D;  5CP6 C;  3C1C B;  3AZN B;  4J8X B;  3KWQ B;  5B32 C;  3B6G C;  5AY8 B;  5AVB A;  5F99 D;  3W98 A;  3UT9 A;  4H9S A;  5B33 A;  3X1T A;  1P3B B;  1KX4 C;  1P3F B;  1P3P D;  5B40 C;  5B1L D;  3REJ D;  5DNM A;  4XZQ A;  4ZBJ B;  2PYO B;  2HIO C;  3KSY A;  4H9R A;  2BYK A;  4WU8 D;  5GXQ C;  3MGQ D;  3AZK D;  5CPI A;  5GSU C;  3AZM A;  3AV1 D;  3R45 A;  3WKJ A;  5F99 C;  4JJN D;  3TU4 B;  5B1M D;  3MGP A;  5AV5 D;  2YFW B;  1P3P C;  5B1L C;  3VH5 T;  3REJ C;  3AN2 B;  3VH6 T;  3AZH D;  4YS3 B;  3O62 A;  3WAA B;  4WU8 C;  3MGQ C;  3AZK C;  4KHA B;  5AV6 A;  3UTA A;  4G91 C;  2BYM B;  5AV9 B;  3REL D;  3REH A;  2F8N D;  3AV1 C;  2HUE C;  4AWL C;  1P3O A;  5AV5 C;  3VH5 A;  4Z66 A;  3AZH C;  3MGR B;  5B2I B;  5DNN C;  2CV5 A;  1BH9 B;  3AZL A;  3WTP A;  5AVC B;  2L5A A;  3B6F A;  5JRG D;  1TZY A;  5B24 B;  5B2J D;  3B0D C;  3LJA B;  1P3L A;  3UTB A;  1M18 B;  5GT0 B;  4WNN A;  5B32 A;  1HQ3 C;  5AVB D;  3W98 D;  4CAY A;  3UT9 D;  1P3A B;  4H9Q A;  5KDM B;  4H9P A;  5B33 D;  3X1T D;  5G49 A;  4XUJ B;  5B0Y B;  1H3O A;  3AZG A;  5B40 A;  5DNM D;  5JRG C;  4XZQ D;  1M1A B;  4R8P A;  1M19 B;  4YM6 B;  5B2J C;  1EQZ B;  5GXQ A;  4X23 A;  2YFV B;  1ID3 A;  1TAF B;  1WWS A;  5CPI D;  1BFM A;  5BNX B;  3MNN B;  1P3I C;  4HGA C;  3AZM D;  1P3M A;  5AVB C;  3WKJ D;  3W96 B;  3W98 C;  2NZD A;  3NQU A;  3MGP D;  4H9S C;  5B33 C;  3X1T C;  3REK A;  3X1U B;  5AV8 B;  1P3G B;  3O62 D;  1F66 A;  5FUG A;  3AZF B;  4LD9 B;  5AV6 D;  2ARO A;  5CPI C;  3UTA D;  3KUY C;  3REH D;  3AZM C;  4H9O B;  1U35 C;  4KUD A;  3WKJ C;  1JFI B;  1P3O D;  5GT3 C;  3MGP C;  4Z66 D;  4WZS B;  3AZH A;  5JA4 B;  5DNN A;  3MGS A;  2CV5 D;  3O62 C;  3WTP D;  3AZL D;  1P34 B;  3AYW B;  3B6F D;  3MVD B;  5B0Z B;  5AV6 C;  1TZY D;  3AZJ B;  3AZE B;  4CSR A;  3AZI B;  4H9N A;  3LEL B;  4J8V C;  1P3L D;  3UTB D;  5CPK C;  4M6B A;  1P3O C;  1ZLA B;  1HQ3 A;  5B32 D;  3NQJ A;  4Z66 C;  1AOI B;  4NE5 A;  3REI B;  1P3K B;  2CV5 C;  3AZG D;  3WTP C;  3AZL C;  1N1J B;  5B40 D;  3WA9 B;  3B6F C;  4NFT A;  4R8P D;  4KGC A;  3AV2 B;  2IO5 C;  5GXQ D;  5CP6 B;  5B2I A;  4X23 D;  4QLC A;  1ID3 D;  3B6G B;  5AVC A;  1P3L C;  1P3I A;  5BS7 A;  1KX4 B;  4J8U D;  5CPJ A;  1P3M D;  2NZD D;  5BNV B;  3REK D;  3AZG C;  2HIO B;  3LZ0 A;  3AZN D;  4Z5T C;  1KX5 B;  4R8P C;  3AFA A;  1F66 D;  5GSU B;  5B31 A;  4X23 C;  1P3B D;  1KX3 C;  1ID3 C;  5B0Y A;  2ARO D;  3X1V A;  5F99 B;  3KXB C;  3KUY A;  3X1S A;  4WU9 C;  4J8U C;  1U35 A;  4KUD D;  4YM6 A;  1P3M C;  1P3P B;  2NZD C;  1B67 A;  5B1L B;  3REJ B;  5GT3 A;  1TAF A;  3REK C;  5CHL B;  4WU8 B;  3AZN C;  2LY8 A;  3KWQ C;  3MGQ B;  3AZK B;  5DNN D;  3MGS D;  1F66 C;  3W97 B;  1P3B C;  1P3F C;  2ARO C;  3AV1 B;  4JJN B;  5B1M B;  4AWL B;  5AV5 B;  4KUD C;  2CWE A;  4J8V A;  5CPK A;  2FJ7 A;  1HQ3 D;  3V9R A;  4EO5 C;  1R4V A;  3MGS C;  4Z2M G;  3REL B;  2F8N B;  2F8N K;  3VH6 W;  4KGC D;  5B2I D;  4QLC D;  4G92 C;  5AVC D;  1A7W A;  3C1B B;  1P3I D;  5B0Z A; 
#chains in the Genus database with same CATH topology
 5CPJ D;  4WV4 B;  5AV9 C;  2ZY2 A;  5JRG B;  4NE6 A;  3LZ0 D;  4Z5T A;  5C3I B;  1BH8 A;  4KGC C;  3AFA D;  4UUZ A;  1P3A D;  2NQB A;  5BO0 B;  5B31 D;  5B2I C;  1WWI A;  4QLC C;  1KX3 A;  5B0Y D;  3X1V D;  1N1J A;  1KU5 A;  5AVB B;  5AVC C;  2F8N G;  3KXB A;  4WU9 A;  3KUY D;  3X1S D;  1S32 B;  3UT9 B;  3W98 B;  5BS7 C;  5B33 B;  4J8U A;  3X1T B;  1U35 D;  4YM6 D;  5CPJ C;  3W99 A;  4ZUX A;  2BG1 A;  3LJA C;  5GT3 D;  5DNM B;  4XZQ B;  4H9R B;  3C1C A;  2BYK B;  3AZN A;  3LZ0 C;  4J8X A;  3KWQ A;  5AY8 A;  4NE3 A;  3AFA C;  1P3A C;  3LZ1 B;  5B31 C;  1P3B A;  5BNV A;  3AZM B;  4XUJ C;  5B0Y C;  1P3F A;  3X1V C;  3R45 B;  3B0B A;  4J8W B;  3WKJ B;  3A6N B;  3X1S C;  3WTP E;  3MGP B;  1M1A C;  1W2E A;  2PYO A;  4YM6 C;  1EQZ C;  4J8V D;  5CPK D;  2FJ7 D;  3IP4 C;  1T3U A;  3W96 C;  3UTA B;  2ZM5 A;  3TU4 A;  2YFW A;  3REH B;  3X1U C;  1HTA A;  3AN2 A;  4YS3 A;  1P3O B;  5BT1 D;  2ZY5 A;  3WAA A;  3W97 A;  4Z66 B;  2FJ7 C;  4KHA A;  5B0Z D;  2CV5 B;  2BYM A;  1ULY A;  3AZL B;  3WTP B;  5AV9 A;  1TZY B;  3F6T A;  4Z5T D;  4E45 A;  1P3L B;  3REI D;  3UTB B;  5E5A B;  2NQB D;  3MGR A;  5BT1 C;  1BH9 A;  1KX3 D;  4WNN B;  5B32 B;  2W8S A;  1P34 C;  4WU9 D;  3KXB D;  4CAY B;  4H9Q B;  5B0Z C;  2RVQ D;  4H9P B;  5B24 A;  5G49 B;  1H3O B;  3W99 D;  4ZUX D;  5B40 B;  3LJA A;  4DRB A;  3AZE C;  4R8P B;  3C1B A;  1M18 A;  3C1C D;  5GXQ B;  5GT0 A;  3B0C W;  3KWQ D;  4X23 B;  4J8X D;  5AY8 D;  1ID3 B;  3H0M C;  3REI C;  1P3A A;  1P3K C;  5KDM A;  2NQB C;  4XUJ A;  1P3F D;  1P3M B;  2NZD B;  3NQU B;  1M1A A;  2RVQ C;  1M19 A;  2PYO D;  1EQZ A;  5B32 G;  3W99 C;  4ZUX C;  2YFV A;  2DF4 C;  5BNX A;  3MNN A;  1F66 B;  1S32 A;  3C1C C;  5FUG B;  4J8X C;  5AY8 C;  2Y2G A;  2ARO B;  3W96 A;  4G91 B;  3TU4 D;  4KUD B;  3X1U A;  5AV8 A;  2HUE B;  1P3G A;  3AN2 D;  4YS3 D;  1KX5 C;  4ZBJ C;  2PYO C;  3WAA D;  3W97 D;  4EO5 B;  3LZ1 A;  3AZF A;  4LD9 A;  1Z2C B;  3AZH B;  5DNN B;  3MGS B;  2JSS A;  4J8W A;  3A6N A;  5AV9 D;  4H9O A;  2Y2O A;  3TU4 C;  1JFI A;  3B0D B;  3A1K A;  3VH5 W;  4CSR B;  4H9N B;  4G92 B;  1B6W A;  3AN2 C;  4YS3 C;  3MGR D;  5JA4 A;  1HQ3 B;  3NQJ B;  3WAA C;  3W97 C;  1P34 A;  3AYW A;  3MVD A;  5B24 D;  4JJN C;  5B1M C;  3LJA D;  3AZJ A;  3AZE A;  3AZI A;  3LEL A;  3VH6 A;  4KGC B;  5B2J B;  3C1B D;  1M18 D;  3EPJ A;  5GT0 D;  1ZLA A;  2Y2J A;  4QLC B;  4Z2M H;  1AOI A;  3REI A;  1P3K A;  2F2A C;  3MGR C;  1P3I B;  4HGA B;  4XUJ D;  5CPJ B;  3WA9 A;  2G5H C;  3REL C;  1M1A D;  1M19 D;  5B24 C;  3AV2 A;  1EQZ D;  5E5A A;  5CP6 A;  3LZ0 B;  3B6G A;  3MNN D;  3AFA B;  3C1B C;  1S32 D;  1M18 C;  1PZR A;  5GT0 C;  5B31 B;  1KX4 A;  4E44 A;  3W96 D;  3X1V B;  5CPI B;  3KUY B;  3X1S B;  1F1E A;  1U35 B;  2HIO A;  3X1U D;  5AV8 D;  2Y2Q A;  1P3G D;  4UPK A;  1KX5 A;  2F8N H;  5GT3 B;  5C3I C;  1M19 C;  5GSU A;  3LZ1 D;  2Y2L A;  3AZF D;  4LD9 D;  4J8W D;  3O62 B;  5F99 A;  3MNN C;  3A6N D;  1S32 C;  3UT9 C;  2ZY4 A;  5AV6 B;  1P3P A;  5B1L A;  3REJ A;  5DNM C;  4XZQ C;  5B31 G;  5AV8 C;  4J8V B;  4WU8 A;  1P3G C;  5CPK B;  2FJ7 B;  3MGQ A;  3AZK A;  3V9R B;  1P34 D;  3LZ1 C;  3AZF C;  3AYW D;  2JCH A;  4LD9 C;  3MVD D;  3AV1 A;  4J8W C;  4JJN A;  3A6N C;  5B1M A;  3AZJ D;  3AZE D;  5AV5 A;  3B6F B;  3AZI D;  3LEL D;  2IO5 B;  2ZY3 A;  1ZLA D;  1AOI D;  1P3K D;  1Q9C A;  3UTA C;  3WA9 D;  3AYW C;  3REL A;  3MVD C;  3REH C;  2F8N A;  3AZG B;  3AV2 D;  2JE5 A;  3KFU G;  5E5A D;  5CP6 D;  3AZJ C;  4Z5T B;  3AZI C;  3B6G D;  3LEL C;  1BH8 B;  3B0C T;  4UUZ B;  2NQB B;  1KX4 D;  1ZLA C;  1KX3 B;  1AOI C;  2VQR A;  4DRA A;  3KXB B;  4WU9 B;  5JRG A;  1TZY C;  4J8U B;  2HIO D;  5B2J A;  3W99 B;  4ZUX B;  3WA9 C;  1KX5 D;  2UWX A;  3EPL A;  3REK B;  3AV2 C;  3UTB C;  5E5A C;  5BO0 A;  5GSU D;  5CP6 C;  3C1C B;  3AZN B;  4J8X B;  3KWQ B;  5B32 C;  3B6G C;  5AY8 B;  5AVB A;  5F99 D;  3W98 A;  3UT9 A;  4H9S A;  5B33 A;  3X1T A;  1P3B B;  1KX4 C;  1P3F B;  1P3P D;  5B40 C;  5B1L D;  3REJ D;  5DNM A;  4XZQ A;  4ZBJ B;  2PYO B;  2HIO C;  3KSY A;  4H9R A;  2BYK A;  4WU8 D;  3H0L C;  5GXQ C;  3MGQ D;  3AZK D;  5CPI A;  5GSU C;  3AZM A;  3AV1 D;  3R45 A;  3WKJ A;  5F99 C;  4JJN D;  3TU4 B;  5B1M D;  3MGP A;  3FDD A;  5AV5 D;  2YFW B;  1P3P C;  4DQY B;  5B1L C;  3VH5 T;  3REJ C;  3AN2 B;  3VH6 T;  3AZH D;  4YS3 B;  3O62 A;  3WAA B;  4WU8 C;  2FFF B;  3MGQ C;  3AZK C;  4KHA B;  5AV6 A;  3UTA A;  2BYM B;  4G91 C;  5AV9 B;  3REL D;  3REH A;  2F8N D;  3AV1 C;  2HUE C;  4AWL C;  1P3O A;  5AV5 C;  3VH5 A;  4Z66 A;  3AZH C;  3MGR B;  5B2I B;  5DNN C;  2CV5 A;  1BH9 B;  3AZL A;  3WTP A;  4WJ3 C;  5AVC B;  2Y2K A;  2L5A A;  3B6F A;  5JRG D;  1TZY A;  5B24 B;  5B2J D;  3B0D C;  3LJA B;  2Y2N A;  1P3L A;  3UTB A;  1M18 B;  3A1I A;  5GT0 B;  4WNN A;  5B32 A;  1HQ3 C;  5AVB D;  3W98 D;  4CAY A;  3UT9 D;  1P3A B;  4H9Q A;  5KDM B;  4H9P A;  5B33 D;  3X1T D;  4XUJ B;  5G49 A;  5B0Y B;  1H3O A;  3AZG A;  2RIQ A;  5B40 A;  5DNM D;  5JRG C;  4XZQ D;  1M1A B;  4R8P A;  1M19 B;  4YM6 B;  5B2J C;  1EQZ B;  5GXQ A;  2DQN C;  2YFV B;  4X23 A;  1TAF B;  1ID3 A;  1WWS A;  5CPI D;  1BFM A;  5BNX B;  3MNN B;  1P3I C;  4HGA C;  3AZM D;  1P3M A;  5AVB C;  3WKJ D;  3W96 B;  3W98 C;  2NZD A;  3NQU A;  3MGP D;  4H9S C;  5B33 C;  3X1T C;  3REK A;  3X1U B;  5AV8 B;  1P3G B;  3O62 D;  1F66 A;  3H0R C;  5FUG A;  3AZF B;  4LD9 B;  5AV6 D;  2ARO A;  5CPI C;  3UTA D;  3KUY C;  3REH D;  3AZM C;  4H9O B;  1U35 C;  4KUD A;  3WKJ C;  1JFI B;  1P3O D;  5GT3 C;  3MGP C;  4Z66 D;  4WZS B;  3AZH A;  5JA4 B;  5DNN A;  3MGS A;  2CV5 D;  3O62 C;  3WTP D;  3AZL D;  1P34 B;  3AYW B;  3B6F D;  3MVD B;  5B0Z B;  5AV6 C;  1TZY D;  3AL0 C;  3EG5 B;  3AZJ B;  3AZE B;  4CSR A;  3AZI B;  4H9N A;  3LEL B;  4J8V C;  1P3L D;  3UTB D;  5CPK C;  4M6B A;  1P3O C;  1ZLA B;  5B32 D;  1HQ3 A;  3NQJ A;  4Z66 C;  1AOI B;  4NE5 A;  3REI B;  1P3K B;  3EPH A;  2CV5 C;  3AZG D;  3WTP C;  3AZL C;  1N1J B;  5B40 D;  3WA9 B;  3B6F C;  4NFT A;  4R8P D;  4KGC A;  3AV2 B;  2IO5 C;  5GXQ D;  5CP6 B;  5B2I A;  4X23 D;  4QLC A;  1ID3 D;  3B6G B;  5AVC A;  1P3L C;  1P3I A;  5BS7 A;  1KX4 B;  4J8U D;  5CPJ A;  1P3M D;  2Y2M A;  2NZD D;  2Y2I A;  2XD1 A;  5BNV B;  3REK D;  3AZG C;  2HIO B;  3LZ0 A;  3AZN D;  4Z5T C;  1KX5 B;  4R8P C;  3AFA A;  1F66 D;  5GSU B;  5B31 A;  4X23 C;  1P3B D;  1KX3 C;  1ID3 C;  5B0Y A;  2ARO D;  3X1V A;  2G5I C;  5F99 B;  3KXB C;  3KUY A;  3X1S A;  4WU9 C;  4J8U C;  1U35 A;  4KUD D;  4YM6 A;  1P3M C;  1P3P B;  3EPK A;  2NZD C;  1B67 A;  5B1L B;  3REJ B;  5GT3 A;  1TAF A;  2Y2P A;  3REK C;  5CHL B;  4WU8 B;  3AZN C;  2LY8 A;  3P5J B;  3KWQ C;  3MGQ B;  5DNN D;  3MGS D;  3AZK B;  1F66 C;  3W97 B;  2XD5 A;  1P3B C;  1P3F C;  2ARO C;  3AV1 B;  2Y2H A;  4JJN B;  5B1M B;  4AWL B;  5AV5 B;  4KUD C;  2CWE A;  4J8V A;  5CPK A;  2FJ7 A;  1HQ3 D;  2J8P A;  3V9R A;  4EO5 C;  1R4V A;  3MGS C;  4Z2M G;  3REL B;  2F8N B;  2F8N K;  3VH6 W;  4KGC D;  5B2I D;  4QLC D;  4G92 C;  5AVC D;  1A7W A;  3C1B B;  1P3I D;  5B0Z A; 
#chains in the Genus database with same CATH homology
 5CPJ D;  4WV4 B;  5AV9 C;  2ZY2 A;  5JRG B;  4NE6 A;  3LZ0 D;  4Z5T A;  5C3I B;  1BH8 A;  4KGC C;  3AFA D;  4UUZ A;  1P3A D;  2NQB A;  5BO0 B;  5B31 D;  5B2I C;  1WWI A;  4QLC C;  1KX3 A;  5B0Y D;  3X1V D;  1N1J A;  1KU5 A;  5AVB B;  5AVC C;  2F8N G;  3KXB A;  4WU9 A;  3KUY D;  3X1S D;  1S32 B;  3UT9 B;  3W98 B;  5BS7 C;  5B33 B;  4J8U A;  3X1T B;  1U35 D;  4YM6 D;  5CPJ C;  3W99 A;  4ZUX A;  2BG1 A;  3LJA C;  5GT3 D;  5DNM B;  4XZQ B;  4H9R B;  3C1C A;  2BYK B;  3AZN A;  3LZ0 C;  4J8X A;  3KWQ A;  5AY8 A;  4NE3 A;  3AFA C;  1P3A C;  3LZ1 B;  5B31 C;  1P3B A;  5BNV A;  3AZM B;  4XUJ C;  5B0Y C;  1P3F A;  3X1V C;  3R45 B;  3B0B A;  4J8W B;  3WKJ B;  3A6N B;  3X1S C;  3WTP E;  3MGP B;  1M1A C;  1W2E A;  2PYO A;  4YM6 C;  1EQZ C;  4J8V D;  5CPK D;  2FJ7 D;  3IP4 C;  1T3U A;  3W96 C;  3UTA B;  2ZM5 A;  3TU4 A;  2YFW A;  3REH B;  3X1U C;  1HTA A;  3AN2 A;  4YS3 A;  1P3O B;  5BT1 D;  2ZY5 A;  3WAA A;  3W97 A;  4Z66 B;  2FJ7 C;  4KHA A;  5B0Z D;  2CV5 B;  2BYM A;  1ULY A;  3AZL B;  3WTP B;  5AV9 A;  1TZY B;  3F6T A;  4Z5T D;  4E45 A;  1P3L B;  3REI D;  3UTB B;  5E5A B;  2NQB D;  3MGR A;  5BT1 C;  1BH9 A;  1KX3 D;  4WNN B;  5B32 B;  2W8S A;  1P34 C;  4WU9 D;  3KXB D;  4CAY B;  4H9Q B;  5B0Z C;  2RVQ D;  4H9P B;  5B24 A;  5G49 B;  1H3O B;  3W99 D;  4ZUX D;  5B40 B;  3LJA A;  4DRB A;  3AZE C;  4R8P B;  3C1B A;  1M18 A;  3C1C D;  5GXQ B;  5GT0 A;  3B0C W;  3KWQ D;  4X23 B;  4J8X D;  5AY8 D;  1ID3 B;  3H0M C;  3REI C;  1P3A A;  1P3K C;  5KDM A;  2NQB C;  4XUJ A;  1P3F D;  1P3M B;  2NZD B;  3NQU B;  1M1A A;  2RVQ C;  1M19 A;  2PYO D;  1EQZ A;  5B32 G;  3W99 C;  4ZUX C;  2YFV A;  2DF4 C;  5BNX A;  3MNN A;  1F66 B;  1S32 A;  3C1C C;  5FUG B;  4J8X C;  5AY8 C;  2Y2G A;  2ARO B;  3W96 A;  4G91 B;  3TU4 D;  4KUD B;  3X1U A;  5AV8 A;  2HUE B;  1P3G A;  3AN2 D;  4YS3 D;  1KX5 C;  4ZBJ C;  2PYO C;  3WAA D;  3W97 D;  4EO5 B;  3LZ1 A;  3AZF A;  4LD9 A;  1Z2C B;  3AZH B;  5DNN B;  3MGS B;  2JSS A;  4J8W A;  3A6N A;  5AV9 D;  4H9O A;  2Y2O A;  3TU4 C;  1JFI A;  3B0D B;  3A1K A;  3VH5 W;  4CSR B;  4H9N B;  4G92 B;  1B6W A;  3AN2 C;  4YS3 C;  3MGR D;  5JA4 A;  1HQ3 B;  3NQJ B;  3WAA C;  3W97 C;  1P34 A;  3AYW A;  3MVD A;  5B24 D;  4JJN C;  5B1M C;  3LJA D;  3AZJ A;  3AZE A;  3AZI A;  3LEL A;  3VH6 A;  4KGC B;  5B2J B;  3C1B D;  1M18 D;  3EPJ A;  5GT0 D;  1ZLA A;  2Y2J A;  4QLC B;  4Z2M H;  1AOI A;  3REI A;  1P3K A;  2F2A C;  3MGR C;  1P3I B;  4HGA B;  4XUJ D;  5CPJ B;  3WA9 A;  2G5H C;  3REL C;  1M1A D;  1M19 D;  5B24 C;  3AV2 A;  1EQZ D;  5E5A A;  5CP6 A;  3LZ0 B;  3B6G A;  3MNN D;  3AFA B;  3C1B C;  1S32 D;  1M18 C;  1PZR A;  5GT0 C;  5B31 B;  1KX4 A;  4E44 A;  3W96 D;  3X1V B;  5CPI B;  3KUY B;  3X1S B;  1F1E A;  1U35 B;  2HIO A;  3X1U D;  5AV8 D;  2Y2Q A;  1P3G D;  4UPK A;  1KX5 A;  2F8N H;  5GT3 B;  5C3I C;  1M19 C;  5GSU A;  3LZ1 D;  2Y2L A;  3AZF D;  4LD9 D;  4J8W D;  3O62 B;  5F99 A;  3MNN C;  3A6N D;  1S32 C;  3UT9 C;  2ZY4 A;  5AV6 B;  1P3P A;  5B1L A;  3REJ A;  5DNM C;  4XZQ C;  5B31 G;  5AV8 C;  4J8V B;  4WU8 A;  1P3G C;  5CPK B;  2FJ7 B;  3MGQ A;  3AZK A;  3V9R B;  1P34 D;  3LZ1 C;  3AZF C;  3AYW D;  2JCH A;  4LD9 C;  3MVD D;  3AV1 A;  4J8W C;  4JJN A;  3A6N C;  5B1M A;  3AZJ D;  3AZE D;  5AV5 A;  3B6F B;  3AZI D;  3LEL D;  2IO5 B;  2ZY3 A;  1ZLA D;  1AOI D;  1P3K D;  1Q9C A;  3UTA C;  3WA9 D;  3AYW C;  3REL A;  3MVD C;  3REH C;  2F8N A;  3AZG B;  3AV2 D;  2JE5 A;  3KFU G;  5E5A D;  5CP6 D;  3AZJ C;  4Z5T B;  3AZI C;  3B6G D;  3LEL C;  1BH8 B;  3B0C T;  4UUZ B;  2NQB B;  1KX4 D;  1ZLA C;  1KX3 B;  1AOI C;  2VQR A;  4DRA A;  3KXB B;  4WU9 B;  5JRG A;  1TZY C;  4J8U B;  2HIO D;  5B2J A;  3W99 B;  4ZUX B;  3WA9 C;  1KX5 D;  2UWX A;  3EPL A;  3REK B;  3AV2 C;  3UTB C;  5E5A C;  5BO0 A;  5GSU D;  5CP6 C;  3C1C B;  3AZN B;  4J8X B;  3KWQ B;  5B32 C;  3B6G C;  5AY8 B;  5AVB A;  5F99 D;  3W98 A;  3UT9 A;  4H9S A;  5B33 A;  3X1T A;  1P3B B;  1KX4 C;  1P3F B;  1P3P D;  5B40 C;  5B1L D;  3REJ D;  5DNM A;  4XZQ A;  4ZBJ B;  2PYO B;  2HIO C;  3KSY A;  4H9R A;  2BYK A;  4WU8 D;  3H0L C;  5GXQ C;  3MGQ D;  3AZK D;  5CPI A;  5GSU C;  3AZM A;  3AV1 D;  3R45 A;  3WKJ A;  5F99 C;  4JJN D;  3TU4 B;  5B1M D;  3MGP A;  3FDD A;  5AV5 D;  2YFW B;  1P3P C;  4DQY B;  5B1L C;  3VH5 T;  3REJ C;  3AN2 B;  3VH6 T;  3AZH D;  4YS3 B;  3O62 A;  3WAA B;  4WU8 C;  2FFF B;  3MGQ C;  3AZK C;  4KHA B;  5AV6 A;  3UTA A;  2BYM B;  4G91 C;  5AV9 B;  3REL D;  3REH A;  2F8N D;  3AV1 C;  2HUE C;  4AWL C;  1P3O A;  5AV5 C;  3VH5 A;  4Z66 A;  3AZH C;  3MGR B;  5B2I B;  5DNN C;  2CV5 A;  1BH9 B;  3AZL A;  3WTP A;  4WJ3 C;  5AVC B;  2Y2K A;  2L5A A;  3B6F A;  5JRG D;  1TZY A;  5B24 B;  5B2J D;  3B0D C;  3LJA B;  2Y2N A;  1P3L A;  3UTB A;  1M18 B;  3A1I A;  5GT0 B;  4WNN A;  5B32 A;  1HQ3 C;  5AVB D;  3W98 D;  4CAY A;  3UT9 D;  1P3A B;  4H9Q A;  5KDM B;  4H9P A;  5B33 D;  3X1T D;  4XUJ B;  5G49 A;  5B0Y B;  1H3O A;  3AZG A;  2RIQ A;  5B40 A;  5DNM D;  5JRG C;  4XZQ D;  1M1A B;  4R8P A;  1M19 B;  4YM6 B;  5B2J C;  1EQZ B;  5GXQ A;  2DQN C;  2YFV B;  4X23 A;  1TAF B;  1ID3 A;  1WWS A;  5CPI D;  1BFM A;  5BNX B;  3MNN B;  1P3I C;  4HGA C;  3AZM D;  1P3M A;  5AVB C;  3WKJ D;  3W96 B;  3W98 C;  2NZD A;  3NQU A;  3MGP D;  4H9S C;  5B33 C;  3X1T C;  3REK A;  3X1U B;  5AV8 B;  1P3G B;  3O62 D;  1F66 A;  3H0R C;  5FUG A;  3AZF B;  4LD9 B;  5AV6 D;  2ARO A;  5CPI C;  3UTA D;  3KUY C;  3REH D;  3AZM C;  4H9O B;  1U35 C;  4KUD A;  3WKJ C;  1JFI B;  1P3O D;  5GT3 C;  3MGP C;  4Z66 D;  4WZS B;  3AZH A;  5JA4 B;  5DNN A;  3MGS A;  2CV5 D;  3O62 C;  3WTP D;  3AZL D;  1P34 B;  3AYW B;  3B6F D;  3MVD B;  5B0Z B;  5AV6 C;  1TZY D;  3AL0 C;  3EG5 B;  3AZJ B;  3AZE B;  4CSR A;  3AZI B;  4H9N A;  3LEL B;  4J8V C;  1P3L D;  3UTB D;  5CPK C;  4M6B A;  1P3O C;  1ZLA B;  5B32 D;  1HQ3 A;  3NQJ A;  4Z66 C;  1AOI B;  4NE5 A;  3REI B;  1P3K B;  3EPH A;  2CV5 C;  3AZG D;  3WTP C;  3AZL C;  1N1J B;  5B40 D;  3WA9 B;  3B6F C;  4NFT A;  4R8P D;  4KGC A;  3AV2 B;  2IO5 C;  5GXQ D;  5CP6 B;  5B2I A;  4X23 D;  4QLC A;  1ID3 D;  3B6G B;  5AVC A;  1P3L C;  1P3I A;  5BS7 A;  1KX4 B;  4J8U D;  5CPJ A;  1P3M D;  2Y2M A;  2NZD D;  2Y2I A;  2XD1 A;  5BNV B;  3REK D;  3AZG C;  2HIO B;  3LZ0 A;  3AZN D;  4Z5T C;  1KX5 B;  4R8P C;  3AFA A;  1F66 D;  5GSU B;  5B31 A;  4X23 C;  1P3B D;  1KX3 C;  1ID3 C;  5B0Y A;  2ARO D;  3X1V A;  2G5I C;  5F99 B;  3KXB C;  3KUY A;  3X1S A;  4WU9 C;  4J8U C;  1U35 A;  4KUD D;  4YM6 A;  1P3M C;  1P3P B;  3EPK A;  2NZD C;  1B67 A;  5B1L B;  3REJ B;  5GT3 A;  1TAF A;  2Y2P A;  3REK C;  5CHL B;  4WU8 B;  3AZN C;  2LY8 A;  3P5J B;  3KWQ C;  3MGQ B;  5DNN D;  3MGS D;  3AZK B;  1F66 C;  3W97 B;  2XD5 A;  1P3B C;  1P3F C;  2ARO C;  3AV1 B;  2Y2H A;  4JJN B;  5B1M B;  4AWL B;  5AV5 B;  4KUD C;  2CWE A;  4J8V A;  5CPK A;  2FJ7 A;  1HQ3 D;  2J8P A;  3V9R A;  4EO5 C;  1R4V A;  3MGS C;  4Z2M G;  3REL B;  2F8N B;  2F8N K;  3VH6 W;  4KGC D;  5B2I D;  4QLC D;  4G92 C;  5AVC D;  1A7W A;  3C1B B;  1P3I D;  5B0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...