3W97D

Crystal structure of human nucleosome core particle lacking h2b n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w97D00
2F8NG 2NZDB 3LZ1A 3UTBC 4ZUXA 3MGSA 2PYOC 3W96C 1N1JB 1P3GA 1KX4D 2LY8A 3LZ1C 4ZUXC 3MGSC 3A6NA 1P3GC 1WWIA 1KX3B 3A6NC 1P3FD 5BT1D 3MGPA 1BH8A 1HQ3B 1M1AA 3MGPC 1M1AC 3AYWD 4KGCA 3B0DB 5B32B 3WKJB 2PYOD 3C1CB 3RELB 5GT0D 4KGCC 4NFTA 5AVCA 3LZ1D 2F8NH 3MGSD 5AVCC 1P3GD 5KDMB 1P3PB 3AZFD 3A6ND 3LJAB 3UT9B 4QLCD 3MNNB 4H9QB 1P3OA 4ZBJB 1P3OC 3X1TB 2HIOA 4J8XB 3WAAA 1P34A 1U35D 2HIOC 3WAAC 1P34C 4KGCD 3O62D 3LELD 1P3BA 3AN2A 1P3LA 4EO5B 4H9SA 4WU9A 1AOIB 1P3BC 3AN2C 3W99D 2HUEB 4H9SC 5F99A 3REKA 4WU9C 4DRAA 3LZ0A 5AY8B 5F99C 4J8WB 1P3OD 3LZ0C 3R45B 1EQZB 4H9PA 3KUYB 4XZQA 3AZGB 5CP6B 4J8UD 2HIOD 4X23A 4WU8B 3X1SA 4XZQC 3WAAD 1P34D 4HGAC 4CAYA 5B0YA 4X23C 3X1SC 4YS3C 4G92B 4G91C 3KXBB 5B0ZB 5B0YC 4J8VB 5BS7A 2BYKA 3REIB 1P3BD 3AN2D 3NQUA 5B2JA 5BS7C 4WU9D 1P3LD 3AZKD 4NE5A 1KX4B 5B2JC 3MVDA 5F99D 3REKD 5GSUA 1R4VA 3KWQA 3MVDC 3MGRD 5GSUC 4UUZA 1P3FB 3KWQC 3AZLD 2CV5B 4XZQD 4WNNA 4XUJA 3X1SD 1ZLAA 4XUJC 5B0YD 3AYWB 1H3OB 2YFVB 5B24D 1ZLAC 4CSRB 2PYOB 5GT0B 3LZ1B 4ZUXB 3MGSB 4H9RA 1P3GB 5B1LD 3MVDD 3A6NB 5GSUD 3VH6T 3KWQD 2NQBA 2RVQC 5AV9A 3X1VA 2NQBC 1BH8B 3X1VC 1M1AB 3C1BA 1U35B 2L5AA 5CPID 3C1BC 4KGCB 3O62B 3LELB 1F1EA 5B1MA 5AVCB 3W99B 5B1MC 1A7WA 1TZYA 2RVQD 3NQJB 1P3OB 1TZYC 5B33A 3AV1D 5AV9D 3REHA 5B33C 4J8UB 2HIOB 3REHC 4J8WD 1P34B 3WAAB 1P3ID 5C3IB 1WWSA 1P3LB 3AN2B 1P3BB 4WU9B 3AZKB 5F99B 3REKB 1TZYD 3MGRB 1ULYA 4NE6A 5B33D 3AZLB 4H9PB 3REHD 4KHAA 4XZQB 3B6FA 4KUDA 3X1SB 3B6FC 4G91B 4CAYB 5B0YB 4KUDC 5B24B 2CV5D 1ID3A 1JFIB 5DNNA 3X1UA 4Z66D 2BYKB 1M18D 1ID3C 5DNNC 3X1UC 1BH9A 1P3AA 5JA4A 5B1LB 3MVDB 3UTBD 3WTPA 1P3AC 5GSUB 2FJ7A 3W96D 3KWQB 3B0BA 5BO0B 4ZUXD 3WTPC 2FJ7C 4UUZB 3B6FD 4WNNB 3VH6A 1S32A 3AZIA 1S32C 3AZHA 3AZIC 5CPIB 1ID3D 3MGPD 5FUGA 3AZHC 5DNND 1M1AD 3REJA 5AV8A 3AV2A 3REJC 1P3AD 5AV8C 5BNVB 3AV2C 5B31A 2FJ7D 5AVBA 5AVCD 5B31C 3V9RB 5AVBC 3AV1B 5AV9B 3X1VB 1S32D 5CPJA 5DNMA 3C1BB 1P3IB 5E5AA 3AZHD 5CPJC 5DNMC 5E5AC 4YS3A 3AV2D 2BYMA 4R8PA 1TZYB 4H9OA 4R8PC 5B33B 3REHB 3TU4A 3LZ0D 2NZDA 3TU4C 5CPJD 1N1JA 2NZDC 3B0CT 4Z66B 4X23D 1M18B 4YS3D 3W97A 3W97C 3UTBB 1HQ3A 3VH6W 3W96B 4R8PD 5B2JD 1HQ3C 3REID 5B32A 1KX5A 4KHAB 5B32C 1KX5C 3B6FB 3WKJC 1P3MA 1P3MC 1P3PA 1B6WA 1ID3B 3MGPB 4LD9A 5B40A 4XUJD 5DNNB 3X1UB 1P3PC 3UT9C 1M19A 1ZLAD 5B40C 4LD9C 3W97D 1BH9B 1P3AB 5JA4B 1M19C 3X1TA 4J8XA 3AZMA 2AROA 2FJ7B 3X1TC 4J8XC 1BFMA 2F8NA 5AV5A 3AZMC 2AROC 5GXQA 2YFWA 3WA9A 5AV5C 4M6BA 5GXQC 3WA9C 1S32B 1AOIA 2NQBD 1TAFA 5G49A 1P3MD 4EO5C 1AOIC 3AZHB 3X1VD 4LD9D 5B40D 3WTPE 3UTAA 3C1BD 3REJB 1M19D 5B2IA 5AV8B 3AV2B 3UTAC 5B2IC 4Z5TA 4WU8A 3AZMD 2AROD 3AZEA 5B1MD 5AVBB 4Z5TC 4WU8C 5AV5D 2F8ND 3W98A 1HTAA 3AZEC 5GXQD 3WA9D 4E45A 4J8VA 3W98C 3VH5T 3LZ0B 4J8VC 5CPJB 5CPKA 5DNMB 3AFAA 3MGQA 5E5AB 1KU5A 5CPKC 4HGAB 3AFAC 1KX4C 4X23B 3MGQC 4JJNA 4YS3B 1B67A 3UTAD 1P3FA 5B2ID 4Z2MG 1F66A 4JJNC 1P3FC 1F66C 4Z5TD 4R8PB 3NQUB 5B2JB 4H9OB 3AYWA 2YFVA 3AZNA 3TU4B 3AYWC 5GT0A 3AZJA 3AZNC 2F8NK 5GT0C 3AZJC 5JRGA 5CPKD 3AFAD 3MGQD 3AZFA 5GT3A 5JRGC 4XUJB 4QLCA 4KUDD 3AZFC 4H9NA 5GT3C 4JJND 1ZLAB 3W97B 4QLCC 1F66D 5AV6A 4Z2MH 3X1UD 5AV6C 4WZSB 1U35A 4NE3A 4H9RB 1U35C 1KX5B 3AZND 3O62A 3LELA 3WTPD 4YM6A 3AZJD 3O62C 3LELC 2NQBB 1P3MB 4YM6C 5JRGD 3W99A 5GT3D 3W99C 4LD9B 5BNXA 5B40B 3AZID 3NQJA 1P3KA 2IO5C 1M19B 1P3KC 3B6GA 2CWEA 5AV6D 4J8UA 4AWLC 3B6GC 3AZMB 2AROB 3REJD 5B1MB 4J8UC 5AV8D 2F8NB 5AV5B 5GXQB 2YFWB 3WA9B 5C3IC 5B31D 4YM6D 5AVBD 3AZKA 1TAFB 5G49B 1P3LC 3B0CW 4E44A 3AZKC 3VH5A 3MGRA 3REKC 1P3KD 3UTAB 5DNMD 3MGRC 3AZLA 5B2IB 5E5AD 3B6GD 3AZLC 1KX3A 4Z5TB 3AZEB 1KX3C 3W98B 5B24A 1JFIA 5B24C 5CPKB 3WKJA 3AFAB 5B1LA 3MGQB 3TU4D 5B31G 3C1CA 3B0DC 3RELA 5B1LC 4KUDB 2NZDD 5BO0A 3C1CC 4JJNB 3RELC 5KDMA 1F66B 3LJAA 3UT9A 1KX3D 3MNNA 4H9QA 3LJAC 3MNNC 5CPIA 4ZBJC 3AZNB 1HQ3D 3WTPB 5CPIC 3AZJB 5B32D 5JRGB 1KX5D 3WKJD 5BNVA 3AZFB 3C1CD 5GT3B 3RELD 4QLCB 3AZIB 4H9NB 3V9RA 3AV1A 4WV4B 1P3PD 5AV6B 3LJAD 3UT9D 2HUEC 5AY8A 5FUGB 5AV9C 3AV1C 4J8WA 3MNND 3R45A 5AY8C 1EQZA 1P3IA 3KUYA 4J8WC 3AZGA 1EQZC 1Q9CA 5CP6A 3X1TD 4J8XD 3VH5W 1P3IC 3KUYC 3AZGC 5B31B 4YM6B 2JSSA 5CP6C 5CHLB 3KXBA 5B0ZA 3KSYA 4G92C 3REIA 2IO5B 3KXBC 5B0ZC 5BNXB 1AOID 1P3KB 5B32G 3REIC 1KX4A 4AWLB 3B6GB 5AY8D 1EQZD 3KUYD 2CV5A 2BYMB 3AZGD 5BT1C 5CP6D 4Z66A 4WU8D 2CV5C 1M18A 3AZED 4Z66C 3W98D 1H3OA 1M18C 4DRBA 3KXBD 4CSRA 5B0ZD 4J8VD 3UTBA 2PYOA 3W96A
chains in the Genus database with same CATH superfamily
2F8NG 2NZDB 3LZ1A 3UTBC 4ZUXA 3MGSA 2PYOC 3W96C 1N1JB 2BG1A 1P3GA 1KX4D 2LY8A 3LZ1C 4ZUXC 3MGSC 3A6NA 1P3GC 1WWIA 1KX3B 2Y2PA 3A6NC 1P3FD 5BT1D 3MGPA 1BH8A 1HQ3B 1M1AA 3MGPC 1M1AC 3AYWD 4KGCA 3B0DB 5B32B 3WKJB 2PYOD 3C1CB 3RELB 2Y2QA 5GT0D 4KGCC 4NFTA 5AVCA 3LZ1D 2F8NH 3MGSD 5AVCC 1P3GD 5KDMB 1P3PB 3AZFD 3A6ND 3LJAB 3UT9B 4QLCD 3MNNB 4H9QB 1P3OA 4ZBJB 1P3OC 3X1TB 2HIOA 4J8XB 3WAAA 1P34A 1U35D 2HIOC 3AL0C 3WAAC 1P34C 4KGCD 3O62D 3LELD 1P3BA 3AN2A 1P3LA 4EO5B 4H9SA 4WU9A 1AOIB 1P3BC 3AN2C 2RIQA 2HUEB 4H9SC 3W99D 5F99A 3REKA 4DRAA 4WU9C 3LZ0A 2ZM5A 5AY8B 5F99C 4J8WB 1P3OD 3LZ0C 3R45B 1EQZB 2Y2HA 4H9PA 3KUYB 4XZQA 3AZGB 5CP6B 4J8UD 2HIOD 4X23A 2ZY3A 3X1SA 4WU8B 4XZQC 3WAAD 1P34D 4HGAC 4CAYA 5B0YA 4X23C 3X1SC 4YS3C 4G92B 4G91C 3KXBB 5B0ZB 5B0YC 4J8VB 5BS7A 2BYKA 3REIB 1P3BD 3AN2D 3NQUA 5B2JA 5BS7C 4WU9D 1P3LD 3AZKD 4NE5A 2J8PA 5B2JC 3MVDA 5F99D 3REKD 1KX4B 5GSUA 1R4VA 3KWQA 3MVDC 3MGRD 5GSUC 4UUZA 1P3FB 3KWQC 3AZLD 3H0MC 3H0LC 2CV5B 4XZQD 4WNNA 4XUJA 3X1SD 1ZLAA 4XUJC 5B0YD 3AYWB 1H3OB 2YFVB 5B24D 1ZLAC 4CSRB 3EG5B 2PYOB 5GT0B 3LZ1B 4ZUXB 3MGSB 4H9RA 1P3GB 5B1LD 3MVDD 3A6NB 1W2EA 5GSUD 3VH6T 3KWQD 2NQBA 2RVQC 5AV9A 2UWXA 3X1VA 2NQBC 1BH8B 3X1VC 1M1AB 3C1BA 1U35B 2L5AA 5CPID 3C1BC 4KGCB 3O62B 3LELB 1F1EA 5B1MA 5AVCB 3W99B 5B1MC 2JCHA 1A7WA 1TZYA 1Z2CB 2RVQD 3NQJB 1P3OB 2W8SA 1TZYC 3F6TA 5B33A 3AV1D 5AV9D 3REHA 5B33C 4J8UB 2HIOB 3REHC 4J8WD 1P34B 3WAAB 3FDDA 1P3ID 5C3IB 1WWSA 2Y2NA 1P3LB 3AN2B 1P3BB 4WU9B 3AZKB 5F99B 3REKB 2FFFB 1TZYD 2JE5A 1ULYA 4NE6A 3MGRB 5B33D 3AZLB 4H9PB 3REHD 4KHAA 4XZQB 3B6FA 4KUDA 3X1SB 3B6FC 2G5IC 4G91B 4CAYB 5B0YB 4KUDC 5B24B 2CV5D 1ID3A 1JFIB 5DNNA 3X1UA 4Z66D 2BYKB 1M18D 1ID3C 5DNNC 3X1UC 1BH9A 1P3AA 5JA4A 5B1LB 3MVDB 3UTBD 3WTPA 1P3AC 5GSUB 2FJ7A 3W96D 3KWQB 3B0BA 5BO0B 4ZUXD 3WTPC 1PZRA 2FJ7C 4UUZB 3EPHA 3B6FD 4WNNB 3VH6A 2DQNC 1S32A 3AZIA 2Y2OA 1S32C 3AZHA 3AZIC 5CPIB 1ID3D 3MGPD 5FUGA 3AZHC 5DNND 1M1AD 3REJA 5AV8A 3AV2A 3REJC 1P3AD 5AV8C 5BNVB 3AV2C 5B31A 2FJ7D 5AVBA 5AVCD 5B31C 3P5JB 3V9RB 5AVBC 3AV1B 5AV9B 3X1VB 1S32D 5CPJA 5DNMA 3C1BB 1P3IB 5E5AA 3AZHD 5CPJC 5DNMC 5E5AC 4YS3A 3AV2D 2BYMA 3KFUG 4R8PA 1TZYB 3EPKA 4H9OA 4R8PC 5B33B 2ZY2A 3REHB 3TU4A 3LZ0D 2NZDA 3TU4C 1T3UA 5CPJD 1N1JA 2Y2IA 2NZDC 3B0CT 4Z66B 4X23D 1M18B 4YS3D 3W97A 3W97C 3A1KA 3UTBB 1HQ3A 3VH6W 3W96B 4R8PD 2DF4C 5B2JD 1HQ3C 3REID 5B32A 1KX5A 4KHAB 5B32C 1KX5C 3B6FB 3WKJC 1P3MA 3IP4C 2Y2LA 1P3MC 1B6WA 1P3PA 1ID3B 3MGPB 4LD9A 5B40A 4XUJD 5DNNB 3X1UB 1P3PC 3UT9C 1M19A 1ZLAD 5B40C 4LD9C 3W97D 1BH9B 1P3AB 5JA4B 1M19C 3X1TA 4J8XA 3AZMA 2AROA 2FJ7B 3X1TC 2F2AC 4J8XC 1BFMA 2F8NA 5AV5A 3AZMC 2AROC 5GXQA 2YFWA 2G5HC 3WA9A 5AV5C 4M6BA 5GXQC 3WA9C 1S32B 1AOIA 3EPJA 1TAFA 5G49A 1P3MD 2NQBD 4EO5C 1AOIC 3AZHB 3X1VD 4LD9D 5B40D 3EPLA 3WTPE 3UTAA 3C1BD 3REJB 1M19D 5B2IA 5AV8B 3AV2B 3UTAC 5B2IC 4Z5TA 4WU8A 3AZMD 2AROD 3AZEA 5B1MD 5AVBB 4Z5TC 4WU8C 5AV5D 2F8ND 3W98A 1HTAA 3AZEC 5GXQD 3WA9D 4E45A 4J8VA 3W98C 3VH5T 3LZ0B 4J8VC 5CPJB 5CPKA 5DNMB 3AFAA 3MGQA 5E5AB 1KU5A 5CPKC 4HGAB 3AFAC 1KX4C 4X23B 3MGQC 4JJNA 4YS3B 1B67A 3UTAD 1P3FA 5B2ID 4Z2MG 1F66A 4JJNC 1P3FC 1F66C 4Z5TD 4R8PB 3NQUB 5B2JB 4H9OB 3AYWA 2YFVA 3AZNA 3TU4B 3AYWC 5GT0A 3AZJA 3AZNC 2F8NK 5GT0C 3AZJC 5JRGA 5CPKD 3AFAD 3MGQD 3AZFA 5GT3A 5JRGC 4XUJB 4QLCA 4KUDD 3AZFC 4H9NA 5GT3C 4JJND 1ZLAB 3W97B 4QLCC 1F66D 5AV6A 4Z2MH 3X1UD 5AV6C 4WZSB 1U35A 4NE3A 4H9RB 1U35C 1KX5B 3AZND 3O62A 3LELA 3WTPD 4YM6A 3AZJD 3O62C 3LELC 2NQBB 1P3MB 4YM6C 5JRGD 3W99A 5GT3D 3W99C 4LD9B 5BNXA 3H0RC 5B40B 3AZID 3NQJA 1P3KA 2IO5C 1M19B 1P3KC 3B6GA 2CWEA 5AV6D 2ZY4A 4J8UA 4AWLC 3B6GC 3AZMB 2AROB 3REJD 5B1MB 4J8UC 5AV8D 2F8NB 5AV5B 5GXQB 2YFWB 3WA9B 5C3IC 5B31D 4YM6D 5AVBD 3AZKA 1TAFB 5G49B 1P3LC 3B0CW 4E44A 3AZKC 3VH5A 3MGRA 3REKC 1P3KD 2Y2JA 3UTAB 5DNMD 3MGRC 3AZLA 5B2IB 5E5AD 3B6GD 3AZLC 1KX3A 4Z5TB 3AZEB 1KX3C 3W98B 5B24A 1JFIA 5B24C 2Y2GA 5CPKB 3WKJA 3AFAB 5B1LA 3MGQB 3TU4D 5B31G 3C1CA 3B0DC 3RELA 5B1LC 4KUDB 2NZDD 5BO0A 3C1CC 4JJNB 3RELC 5KDMA 1F66B 3LJAA 3UT9A 1KX3D 2Y2MA 4H9QA 3MNNA 3LJAC 3MNNC 5CPIA 4ZBJC 3AZNB 1HQ3D 3WTPB 5CPIC 3AZJB 5B32D 5JRGB 1KX5D 3WKJD 5BNVA 3AZFB 4WJ3C 3C1CD 5GT3B 3RELD 4QLCB 3AZIB 4H9NB 3V9RA 3AV1A 2ZY5A 4WV4B 1P3PD 2VQRA 5AV6B 3LJAD 3UT9D 2HUEC 5AY8A 5FUGB 5AV9C 3AV1C 4J8WA 3MNND 3R45A 5AY8C 1EQZA 1P3IA 3KUYA 4J8WC 3AZGA 1EQZC 4DQYB 1Q9CA 5CP6A 3X1TD 4J8XD 3VH5W 1P3IC 3KUYC 3AZGC 5B31B 4YM6B 2JSSA 5CP6C 5CHLB 4UPKA 3KXBA 5B0ZA 3KSYA 4G92C 3REIA 2IO5B 3KXBC 5B0ZC 5BNXB 1AOID 1P3KB 5B32G 3REIC 1KX4A 4AWLB 3B6GB 5AY8D 1EQZD 3KUYD 2CV5A 2BYMB 3AZGD 2XD1A 5BT1C 5CP6D 4Z66A 4WU8D 2CV5C 1M18A 3AZED 2XD5A 4Z66C 3W98D 1H3OA 2Y2KA 4DRBA 1M18C 3KXBD 4CSRA 5B0ZD 4J8VD 3UTBA 2PYOA 3W96A 3A1IA
chains in the Genus database with same CATH topology
2F8NG 2NZDB 3LZ1A 3UTBC 4ZUXA 3MGSA 2PYOC 3W96C 1N1JB 2BG1A 1P3GA 1KX4D 2LY8A 3LZ1C 4ZUXC 3MGSC 3A6NA 1P3GC 1WWIA 1KX3B 2Y2PA 3A6NC 1P3FD 5BT1D 3MGPA 1BH8A 1HQ3B 1M1AA 3MGPC 1M1AC 3AYWD 4KGCA 3B0DB 5B32B 3WKJB 2PYOD 3C1CB 3RELB 2Y2QA 5GT0D 4KGCC 4NFTA 5AVCA 3LZ1D 2F8NH 3MGSD 5AVCC 1P3GD 5KDMB 1P3PB 3AZFD 3A6ND 3LJAB 3UT9B 4QLCD 3MNNB 4H9QB 1P3OA 4ZBJB 1P3OC 3X1TB 2HIOA 4J8XB 3WAAA 1P34A 1U35D 2HIOC 3AL0C 3WAAC 1P34C 4KGCD 3O62D 3LELD 1P3BA 3AN2A 1P3LA 4EO5B 4H9SA 4WU9A 1AOIB 1P3BC 3AN2C 2RIQA 2HUEB 4H9SC 3W99D 5F99A 3REKA 4DRAA 4WU9C 3LZ0A 2ZM5A 5AY8B 5F99C 4J8WB 1P3OD 3LZ0C 3R45B 1EQZB 2Y2HA 4H9PA 3KUYB 4XZQA 3AZGB 5CP6B 4J8UD 2HIOD 4X23A 2ZY3A 3X1SA 4WU8B 4XZQC 3WAAD 1P34D 4HGAC 4CAYA 5B0YA 4X23C 3X1SC 4YS3C 4G92B 4G91C 3KXBB 5B0ZB 5B0YC 4J8VB 5BS7A 2BYKA 3REIB 1P3BD 3AN2D 3NQUA 5B2JA 5BS7C 4WU9D 1P3LD 3AZKD 4NE5A 2J8PA 5B2JC 3MVDA 5F99D 3REKD 1KX4B 5GSUA 1R4VA 3KWQA 3MVDC 3MGRD 5GSUC 4UUZA 1P3FB 3KWQC 3AZLD 3H0MC 3H0LC 2CV5B 4XZQD 4WNNA 4XUJA 3X1SD 1ZLAA 4XUJC 5B0YD 3AYWB 1H3OB 2YFVB 5B24D 1ZLAC 4CSRB 3EG5B 2PYOB 5GT0B 3LZ1B 4ZUXB 3MGSB 4H9RA 1P3GB 5B1LD 3MVDD 3A6NB 1W2EA 5GSUD 3VH6T 3KWQD 2NQBA 2RVQC 5AV9A 2UWXA 3X1VA 2NQBC 1BH8B 3X1VC 1M1AB 3C1BA 1U35B 2L5AA 5CPID 3C1BC 4KGCB 3O62B 3LELB 1F1EA 5B1MA 5AVCB 3W99B 5B1MC 2JCHA 1A7WA 1TZYA 1Z2CB 2RVQD 3NQJB 1P3OB 2W8SA 1TZYC 3F6TA 5B33A 3AV1D 5AV9D 3REHA 5B33C 4J8UB 2HIOB 3REHC 4J8WD 1P34B 3WAAB 3FDDA 1P3ID 5C3IB 1WWSA 2Y2NA 1P3LB 3AN2B 1P3BB 4WU9B 3AZKB 5F99B 3REKB 2FFFB 1TZYD 2JE5A 1ULYA 4NE6A 3MGRB 5B33D 3AZLB 4H9PB 3REHD 4KHAA 4XZQB 3B6FA 4KUDA 3X1SB 3B6FC 2G5IC 4G91B 4CAYB 5B0YB 4KUDC 5B24B 2CV5D 1ID3A 1JFIB 5DNNA 3X1UA 4Z66D 2BYKB 1M18D 1ID3C 5DNNC 3X1UC 1BH9A 1P3AA 5JA4A 5B1LB 3MVDB 3UTBD 3WTPA 1P3AC 5GSUB 2FJ7A 3W96D 3KWQB 3B0BA 5BO0B 4ZUXD 3WTPC 1PZRA 2FJ7C 4UUZB 3EPHA 3B6FD 4WNNB 3VH6A 2DQNC 1S32A 3AZIA 2Y2OA 1S32C 3AZHA 3AZIC 5CPIB 1ID3D 3MGPD 5FUGA 3AZHC 5DNND 1M1AD 3REJA 5AV8A 3AV2A 3REJC 1P3AD 5AV8C 5BNVB 3AV2C 5B31A 2FJ7D 5AVBA 5AVCD 5B31C 3P5JB 3V9RB 5AVBC 3AV1B 5AV9B 3X1VB 1S32D 5CPJA 5DNMA 3C1BB 1P3IB 5E5AA 3AZHD 5CPJC 5DNMC 5E5AC 4YS3A 3AV2D 2BYMA 3KFUG 4R8PA 1TZYB 3EPKA 4H9OA 4R8PC 5B33B 2ZY2A 3REHB 3TU4A 3LZ0D 2NZDA 3TU4C 1T3UA 5CPJD 1N1JA 2Y2IA 2NZDC 3B0CT 4Z66B 4X23D 1M18B 4YS3D 3W97A 3W97C 3A1KA 3UTBB 1HQ3A 3VH6W 3W96B 4R8PD 2DF4C 5B2JD 1HQ3C 3REID 5B32A 1KX5A 4KHAB 5B32C 1KX5C 3B6FB 3WKJC 1P3MA 3IP4C 2Y2LA 1P3MC 1B6WA 1P3PA 1ID3B 3MGPB 4LD9A 5B40A 4XUJD 5DNNB 3X1UB 1P3PC 3UT9C 1M19A 1ZLAD 5B40C 4LD9C 3W97D 1BH9B 1P3AB 5JA4B 1M19C 3X1TA 4J8XA 3AZMA 2AROA 2FJ7B 3X1TC 2F2AC 4J8XC 1BFMA 2F8NA 5AV5A 3AZMC 2AROC 5GXQA 2YFWA 2G5HC 3WA9A 5AV5C 4M6BA 5GXQC 3WA9C 1S32B 1AOIA 3EPJA 1TAFA 5G49A 1P3MD 2NQBD 4EO5C 1AOIC 3AZHB 3X1VD 4LD9D 5B40D 3EPLA 3WTPE 3UTAA 3C1BD 3REJB 1M19D 5B2IA 5AV8B 3AV2B 3UTAC 5B2IC 4Z5TA 4WU8A 3AZMD 2AROD 3AZEA 5B1MD 5AVBB 4Z5TC 4WU8C 5AV5D 2F8ND 3W98A 1HTAA 3AZEC 5GXQD 3WA9D 4E45A 4J8VA 3W98C 3VH5T 3LZ0B 4J8VC 5CPJB 5CPKA 5DNMB 3AFAA 3MGQA 5E5AB 1KU5A 5CPKC 4HGAB 3AFAC 1KX4C 4X23B 3MGQC 4JJNA 4YS3B 1B67A 3UTAD 1P3FA 5B2ID 4Z2MG 1F66A 4JJNC 1P3FC 1F66C 4Z5TD 4R8PB 3NQUB 5B2JB 4H9OB 3AYWA 2YFVA 3AZNA 3TU4B 3AYWC 5GT0A 3AZJA 3AZNC 2F8NK 5GT0C 3AZJC 5JRGA 5CPKD 3AFAD 3MGQD 3AZFA 5GT3A 5JRGC 4XUJB 4QLCA 4KUDD 3AZFC 4H9NA 5GT3C 4JJND 1ZLAB 3W97B 4QLCC 1F66D 5AV6A 4Z2MH 3X1UD 5AV6C 4WZSB 1U35A 4NE3A 4H9RB 1U35C 1KX5B 3AZND 3O62A 3LELA 3WTPD 4YM6A 3AZJD 3O62C 3LELC 2NQBB 1P3MB 4YM6C 5JRGD 3W99A 5GT3D 3W99C 4LD9B 5BNXA 3H0RC 5B40B 3AZID 3NQJA 1P3KA 2IO5C 1M19B 1P3KC 3B6GA 2CWEA 5AV6D 2ZY4A 4J8UA 4AWLC 3B6GC 3AZMB 2AROB 3REJD 5B1MB 4J8UC 5AV8D 2F8NB 5AV5B 5GXQB 2YFWB 3WA9B 5C3IC 5B31D 4YM6D 5AVBD 3AZKA 1TAFB 5G49B 1P3LC 3B0CW 4E44A 3AZKC 3VH5A 3MGRA 3REKC 1P3KD 2Y2JA 3UTAB 5DNMD 3MGRC 3AZLA 5B2IB 5E5AD 3B6GD 3AZLC 1KX3A 4Z5TB 3AZEB 1KX3C 3W98B 5B24A 1JFIA 5B24C 2Y2GA 5CPKB 3WKJA 3AFAB 5B1LA 3MGQB 3TU4D 5B31G 3C1CA 3B0DC 3RELA 5B1LC 4KUDB 2NZDD 5BO0A 3C1CC 4JJNB 3RELC 5KDMA 1F66B 3LJAA 3UT9A 1KX3D 2Y2MA 4H9QA 3MNNA 3LJAC 3MNNC 5CPIA 4ZBJC 3AZNB 1HQ3D 3WTPB 5CPIC 3AZJB 5B32D 5JRGB 1KX5D 3WKJD 5BNVA 3AZFB 4WJ3C 3C1CD 5GT3B 3RELD 4QLCB 3AZIB 4H9NB 3V9RA 3AV1A 2ZY5A 4WV4B 1P3PD 2VQRA 5AV6B 3LJAD 3UT9D 2HUEC 5AY8A 5FUGB 5AV9C 3AV1C 4J8WA 3MNND 3R45A 5AY8C 1EQZA 1P3IA 3KUYA 4J8WC 3AZGA 1EQZC 4DQYB 1Q9CA 5CP6A 3X1TD 4J8XD 3VH5W 1P3IC 3KUYC 3AZGC 5B31B 4YM6B 2JSSA 5CP6C 5CHLB 4UPKA 3KXBA 5B0ZA 3KSYA 4G92C 3REIA 2IO5B 3KXBC 5B0ZC 5BNXB 1AOID 1P3KB 5B32G 3REIC 1KX4A 4AWLB 3B6GB 5AY8D 1EQZD 3KUYD 2CV5A 2BYMB 3AZGD 2XD1A 5BT1C 5CP6D 4Z66A 4WU8D 2CV5C 1M18A 3AZED 2XD5A 4Z66C 3W98D 1H3OA 2Y2KA 4DRBA 1M18C 3KXBD 4CSRA 5B0ZD 4J8VD 3UTBA 2PYOA 3W96A 3A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N G;  2NZD B;  3LZ1 A;  3UTB C;  4ZUX A;  3MGS A;  2PYO C;  3W96 C;  1N1J B;  1P3G A;  1KX4 D;  2LY8 A;  3LZ1 C;  4ZUX C;  3MGS C;  3A6N A;  1P3G C;  1WWI A;  1KX3 B;  3A6N C;  1P3F D;  5BT1 D;  3MGP A;  1BH8 A;  1HQ3 B;  1M1A A;  3MGP C;  1M1A C;  3AYW D;  4KGC A;  3B0D B;  5B32 B;  3WKJ B;  2PYO D;  3C1C B;  3REL B;  5GT0 D;  4KGC C;  4NFT A;  5AVC A;  3LZ1 D;  2F8N H;  3MGS D;  5AVC C;  1P3G D;  5KDM B;  1P3P B;  3AZF D;  3A6N D;  3LJA B;  3UT9 B;  4QLC D;  3MNN B;  4H9Q B;  1P3O A;  4ZBJ B;  1P3O C;  3X1T B;  2HIO A;  4J8X B;  3WAA A;  1P34 A;  1U35 D;  2HIO C;  3WAA C;  1P34 C;  4KGC D;  3O62 D;  3LEL D;  1P3B A;  3AN2 A;  1P3L A;  4EO5 B;  4H9S A;  4WU9 A;  1AOI B;  1P3B C;  3AN2 C;  3W99 D;  2HUE B;  4H9S C;  5F99 A;  3REK A;  4WU9 C;  4DRA A;  3LZ0 A;  5AY8 B;  5F99 C;  4J8W B;  1P3O D;  3LZ0 C;  3R45 B;  1EQZ B;  4H9P A;  3KUY B;  4XZQ A;  3AZG B;  5CP6 B;  4J8U D;  2HIO D;  4X23 A;  4WU8 B;  3X1S A;  4XZQ C;  3WAA D;  1P34 D;  4HGA C;  4CAY A;  5B0Y A;  4X23 C;  3X1S C;  4YS3 C;  4G92 B;  4G91 C;  3KXB B;  5B0Z B;  5B0Y C;  4J8V B;  5BS7 A;  2BYK A;  3REI B;  1P3B D;  3AN2 D;  3NQU A;  5B2J A;  5BS7 C;  4WU9 D;  1P3L D;  3AZK D;  4NE5 A;  1KX4 B;  5B2J C;  3MVD A;  5F99 D;  3REK D;  5GSU A;  1R4V A;  3KWQ A;  3MVD C;  3MGR D;  5GSU C;  4UUZ A;  1P3F B;  3KWQ C;  3AZL D;  2CV5 B;  4XZQ D;  4WNN A;  4XUJ A;  3X1S D;  1ZLA A;  4XUJ C;  5B0Y D;  3AYW B;  1H3O B;  2YFV B;  5B24 D;  1ZLA C;  4CSR B;  2PYO B;  5GT0 B;  3LZ1 B;  4ZUX B;  3MGS B;  4H9R A;  1P3G B;  5B1L D;  3MVD D;  3A6N B;  5GSU D;  3VH6 T;  3KWQ D;  2NQB A;  2RVQ C;  5AV9 A;  3X1V A;  2NQB C;  1BH8 B;  3X1V C;  1M1A B;  3C1B A;  1U35 B;  2L5A A;  5CPI D;  3C1B C;  4KGC B;  3O62 B;  3LEL B;  1F1E A;  5B1M A;  5AVC B;  3W99 B;  5B1M C;  1A7W A;  1TZY A;  2RVQ D;  3NQJ B;  1P3O B;  1TZY C;  5B33 A;  3AV1 D;  5AV9 D;  3REH A;  5B33 C;  4J8U B;  2HIO B;  3REH C;  4J8W D;  1P34 B;  3WAA B;  1P3I D;  5C3I B;  1WWS A;  1P3L B;  3AN2 B;  1P3B B;  4WU9 B;  3AZK B;  5F99 B;  3REK B;  1TZY D;  3MGR B;  1ULY A;  4NE6 A;  5B33 D;  3AZL B;  4H9P B;  3REH D;  4KHA A;  4XZQ B;  3B6F A;  4KUD A;  3X1S B;  3B6F C;  4G91 B;  4CAY B;  5B0Y B;  4KUD C;  5B24 B;  2CV5 D;  1ID3 A;  1JFI B;  5DNN A;  3X1U A;  4Z66 D;  2BYK B;  1M18 D;  1ID3 C;  5DNN C;  3X1U C;  1BH9 A;  1P3A A;  5JA4 A;  5B1L B;  3MVD B;  3UTB D;  3WTP A;  1P3A C;  5GSU B;  2FJ7 A;  3W96 D;  3KWQ B;  3B0B A;  5BO0 B;  4ZUX D;  3WTP C;  2FJ7 C;  4UUZ B;  3B6F D;  4WNN B;  3VH6 A;  1S32 A;  3AZI A;  1S32 C;  3AZH A;  3AZI C;  5CPI B;  1ID3 D;  3MGP D;  5FUG A;  3AZH C;  5DNN D;  1M1A D;  3REJ A;  5AV8 A;  3AV2 A;  3REJ C;  1P3A D;  5AV8 C;  5BNV B;  3AV2 C;  5B31 A;  2FJ7 D;  5AVB A;  5AVC D;  5B31 C;  3V9R B;  5AVB C;  3AV1 B;  5AV9 B;  3X1V B;  1S32 D;  5CPJ A;  5DNM A;  3C1B B;  1P3I B;  5E5A A;  3AZH D;  5CPJ C;  5DNM C;  5E5A C;  4YS3 A;  3AV2 D;  2BYM A;  4R8P A;  1TZY B;  4H9O A;  4R8P C;  5B33 B;  3REH B;  3TU4 A;  3LZ0 D;  2NZD A;  3TU4 C;  5CPJ D;  1N1J A;  2NZD C;  3B0C T;  4Z66 B;  4X23 D;  1M18 B;  4YS3 D;  3W97 A;  3W97 C;  3UTB B;  1HQ3 A;  3VH6 W;  3W96 B;  4R8P D;  5B2J D;  1HQ3 C;  3REI D;  5B32 A;  1KX5 A;  4KHA B;  5B32 C;  1KX5 C;  3B6F B;  3WKJ C;  1P3M A;  1P3M C;  1P3P A;  1B6W A;  1ID3 B;  3MGP B;  4LD9 A;  5B40 A;  4XUJ D;  5DNN B;  3X1U B;  1P3P C;  3UT9 C;  1M19 A;  1ZLA D;  5B40 C;  4LD9 C;  3W97 D;  1BH9 B;  1P3A B;  5JA4 B;  1M19 C;  3X1T A;  4J8X A;  3AZM A;  2ARO A;  2FJ7 B;  3X1T C;  4J8X C;  1BFM A;  2F8N A;  5AV5 A;  3AZM C;  2ARO C;  5GXQ A;  2YFW A;  3WA9 A;  5AV5 C;  4M6B A;  5GXQ C;  3WA9 C;  1S32 B;  1AOI A;  2NQB D;  1TAF A;  5G49 A;  1P3M D;  4EO5 C;  1AOI C;  3AZH B;  3X1V D;  4LD9 D;  5B40 D;  3WTP E;  3UTA A;  3C1B D;  3REJ B;  1M19 D;  5B2I A;  5AV8 B;  3AV2 B;  3UTA C;  5B2I C;  4Z5T A;  4WU8 A;  3AZM D;  2ARO D;  3AZE A;  5B1M D;  5AVB B;  4Z5T C;  4WU8 C;  5AV5 D;  2F8N D;  3W98 A;  1HTA A;  3AZE C;  5GXQ D;  3WA9 D;  4E45 A;  4J8V A;  3W98 C;  3VH5 T;  3LZ0 B;  4J8V C;  5CPJ B;  5CPK A;  5DNM B;  3AFA A;  3MGQ A;  5E5A B;  1KU5 A;  5CPK C;  4HGA B;  3AFA C;  1KX4 C;  4X23 B;  3MGQ C;  4JJN A;  4YS3 B;  1B67 A;  3UTA D;  1P3F A;  5B2I D;  4Z2M G;  1F66 A;  4JJN C;  1P3F C;  1F66 C;  4Z5T D;  4R8P B;  3NQU B;  5B2J B;  4H9O B;  3AYW A;  2YFV A;  3AZN A;  3TU4 B;  3AYW C;  5GT0 A;  3AZJ A;  3AZN C;  2F8N K;  5GT0 C;  3AZJ C;  5JRG A;  5CPK D;  3AFA D;  3MGQ D;  3AZF A;  5GT3 A;  5JRG C;  4XUJ B;  4QLC A;  4KUD D;  3AZF C;  4H9N A;  5GT3 C;  4JJN D;  1ZLA B;  3W97 B;  4QLC C;  1F66 D;  5AV6 A;  4Z2M H;  3X1U D;  5AV6 C;  4WZS B;  1U35 A;  4NE3 A;  4H9R B;  1U35 C;  1KX5 B;  3AZN D;  3O62 A;  3LEL A;  3WTP D;  4YM6 A;  3AZJ D;  3O62 C;  3LEL C;  2NQB B;  1P3M B;  4YM6 C;  5JRG D;  3W99 A;  5GT3 D;  3W99 C;  4LD9 B;  5BNX A;  5B40 B;  3AZI D;  3NQJ A;  1P3K A;  2IO5 C;  1M19 B;  1P3K C;  3B6G A;  2CWE A;  5AV6 D;  4J8U A;  4AWL C;  3B6G C;  3AZM B;  2ARO B;  3REJ D;  5B1M B;  4J8U C;  5AV8 D;  2F8N B;  5AV5 B;  5GXQ B;  2YFW B;  3WA9 B;  5C3I C;  5B31 D;  4YM6 D;  5AVB D;  3AZK A;  1TAF B;  5G49 B;  1P3L C;  3B0C W;  4E44 A;  3AZK C;  3VH5 A;  3MGR A;  3REK C;  1P3K D;  3UTA B;  5DNM D;  3MGR C;  3AZL A;  5B2I B;  5E5A D;  3B6G D;  3AZL C;  1KX3 A;  4Z5T B;  3AZE B;  1KX3 C;  3W98 B;  5B24 A;  1JFI A;  5B24 C;  5CPK B;  3WKJ A;  3AFA B;  5B1L A;  3MGQ B;  3TU4 D;  5B31 G;  3C1C A;  3B0D C;  3REL A;  5B1L C;  4KUD B;  2NZD D;  5BO0 A;  3C1C C;  4JJN B;  3REL C;  5KDM A;  1F66 B;  3LJA A;  3UT9 A;  1KX3 D;  3MNN A;  4H9Q A;  3LJA C;  3MNN C;  5CPI A;  4ZBJ C;  3AZN B;  1HQ3 D;  3WTP B;  5CPI C;  3AZJ B;  5B32 D;  5JRG B;  1KX5 D;  3WKJ D;  5BNV A;  3AZF B;  3C1C D;  5GT3 B;  3REL D;  4QLC B;  3AZI B;  4H9N B;  3V9R A;  3AV1 A;  4WV4 B;  1P3P D;  5AV6 B;  3LJA D;  3UT9 D;  2HUE C;  5AY8 A;  5FUG B;  5AV9 C;  3AV1 C;  4J8W A;  3MNN D;  3R45 A;  5AY8 C;  1EQZ A;  1P3I A;  3KUY A;  4J8W C;  3AZG A;  1EQZ C;  1Q9C A;  5CP6 A;  3X1T D;  4J8X D;  3VH5 W;  1P3I C;  3KUY C;  3AZG C;  5B31 B;  4YM6 B;  2JSS A;  5CP6 C;  5CHL B;  3KXB A;  5B0Z A;  3KSY A;  4G92 C;  3REI A;  2IO5 B;  3KXB C;  5B0Z C;  5BNX B;  1AOI D;  1P3K B;  5B32 G;  3REI C;  1KX4 A;  4AWL B;  3B6G B;  5AY8 D;  1EQZ D;  3KUY D;  2CV5 A;  2BYM B;  3AZG D;  5BT1 C;  5CP6 D;  4Z66 A;  4WU8 D;  2CV5 C;  1M18 A;  3AZE D;  4Z66 C;  3W98 D;  1H3O A;  1M18 C;  4DRB A;  3KXB D;  4CSR A;  5B0Z D;  4J8V D;  3UTB A;  2PYO A;  3W96 A; 
#chains in the Genus database with same CATH topology
 2F8N G;  2NZD B;  3LZ1 A;  3UTB C;  4ZUX A;  3MGS A;  2PYO C;  3W96 C;  1N1J B;  2BG1 A;  1P3G A;  1KX4 D;  2LY8 A;  3LZ1 C;  4ZUX C;  3MGS C;  3A6N A;  1P3G C;  1WWI A;  1KX3 B;  2Y2P A;  3A6N C;  1P3F D;  5BT1 D;  3MGP A;  1BH8 A;  1HQ3 B;  1M1A A;  3MGP C;  1M1A C;  3AYW D;  4KGC A;  3B0D B;  5B32 B;  3WKJ B;  2PYO D;  3C1C B;  3REL B;  2Y2Q A;  5GT0 D;  4KGC C;  4NFT A;  5AVC A;  3LZ1 D;  2F8N H;  3MGS D;  5AVC C;  1P3G D;  5KDM B;  1P3P B;  3AZF D;  3A6N D;  3LJA B;  3UT9 B;  4QLC D;  3MNN B;  4H9Q B;  1P3O A;  4ZBJ B;  1P3O C;  3X1T B;  2HIO A;  4J8X B;  3WAA A;  1P34 A;  1U35 D;  2HIO C;  3AL0 C;  3WAA C;  1P34 C;  4KGC D;  3O62 D;  3LEL D;  1P3B A;  3AN2 A;  1P3L A;  4EO5 B;  4H9S A;  4WU9 A;  1AOI B;  1P3B C;  3AN2 C;  2RIQ A;  2HUE B;  4H9S C;  3W99 D;  5F99 A;  3REK A;  4DRA A;  4WU9 C;  3LZ0 A;  2ZM5 A;  5AY8 B;  5F99 C;  4J8W B;  1P3O D;  3LZ0 C;  3R45 B;  1EQZ B;  2Y2H A;  4H9P A;  3KUY B;  4XZQ A;  3AZG B;  5CP6 B;  4J8U D;  2HIO D;  4X23 A;  2ZY3 A;  3X1S A;  4WU8 B;  4XZQ C;  3WAA D;  1P34 D;  4HGA C;  4CAY A;  5B0Y A;  4X23 C;  3X1S C;  4YS3 C;  4G92 B;  4G91 C;  3KXB B;  5B0Z B;  5B0Y C;  4J8V B;  5BS7 A;  2BYK A;  3REI B;  1P3B D;  3AN2 D;  3NQU A;  5B2J A;  5BS7 C;  4WU9 D;  1P3L D;  3AZK D;  4NE5 A;  2J8P A;  5B2J C;  3MVD A;  5F99 D;  3REK D;  1KX4 B;  5GSU A;  1R4V A;  3KWQ A;  3MVD C;  3MGR D;  5GSU C;  4UUZ A;  1P3F B;  3KWQ C;  3AZL D;  3H0M C;  3H0L C;  2CV5 B;  4XZQ D;  4WNN A;  4XUJ A;  3X1S D;  1ZLA A;  4XUJ C;  5B0Y D;  3AYW B;  1H3O B;  2YFV B;  5B24 D;  1ZLA C;  4CSR B;  3EG5 B;  2PYO B;  5GT0 B;  3LZ1 B;  4ZUX B;  3MGS B;  4H9R A;  1P3G B;  5B1L D;  3MVD D;  3A6N B;  1W2E A;  5GSU D;  3VH6 T;  3KWQ D;  2NQB A;  2RVQ C;  5AV9 A;  2UWX A;  3X1V A;  2NQB C;  1BH8 B;  3X1V C;  1M1A B;  3C1B A;  1U35 B;  2L5A A;  5CPI D;  3C1B C;  4KGC B;  3O62 B;  3LEL B;  1F1E A;  5B1M A;  5AVC B;  3W99 B;  5B1M C;  2JCH A;  1A7W A;  1TZY A;  1Z2C B;  2RVQ D;  3NQJ B;  1P3O B;  2W8S A;  1TZY C;  3F6T A;  5B33 A;  3AV1 D;  5AV9 D;  3REH A;  5B33 C;  4J8U B;  2HIO B;  3REH C;  4J8W D;  1P34 B;  3WAA B;  3FDD A;  1P3I D;  5C3I B;  1WWS A;  2Y2N A;  1P3L B;  3AN2 B;  1P3B B;  4WU9 B;  3AZK B;  5F99 B;  3REK B;  2FFF B;  1TZY D;  2JE5 A;  1ULY A;  4NE6 A;  3MGR B;  5B33 D;  3AZL B;  4H9P B;  3REH D;  4KHA A;  4XZQ B;  3B6F A;  4KUD A;  3X1S B;  3B6F C;  2G5I C;  4G91 B;  4CAY B;  5B0Y B;  4KUD C;  5B24 B;  2CV5 D;  1ID3 A;  1JFI B;  5DNN A;  3X1U A;  4Z66 D;  2BYK B;  1M18 D;  1ID3 C;  5DNN C;  3X1U C;  1BH9 A;  1P3A A;  5JA4 A;  5B1L B;  3MVD B;  3UTB D;  3WTP A;  1P3A C;  5GSU B;  2FJ7 A;  3W96 D;  3KWQ B;  3B0B A;  5BO0 B;  4ZUX D;  3WTP C;  1PZR A;  2FJ7 C;  4UUZ B;  3EPH A;  3B6F D;  4WNN B;  3VH6 A;  2DQN C;  1S32 A;  3AZI A;  2Y2O A;  1S32 C;  3AZH A;  3AZI C;  5CPI B;  1ID3 D;  3MGP D;  5FUG A;  3AZH C;  5DNN D;  1M1A D;  3REJ A;  5AV8 A;  3AV2 A;  3REJ C;  1P3A D;  5AV8 C;  5BNV B;  3AV2 C;  5B31 A;  2FJ7 D;  5AVB A;  5AVC D;  5B31 C;  3P5J B;  3V9R B;  5AVB C;  3AV1 B;  5AV9 B;  3X1V B;  1S32 D;  5CPJ A;  5DNM A;  3C1B B;  1P3I B;  5E5A A;  3AZH D;  5CPJ C;  5DNM C;  5E5A C;  4YS3 A;  3AV2 D;  2BYM A;  3KFU G;  4R8P A;  1TZY B;  3EPK A;  4H9O A;  4R8P C;  5B33 B;  2ZY2 A;  3REH B;  3TU4 A;  3LZ0 D;  2NZD A;  3TU4 C;  1T3U A;  5CPJ D;  1N1J A;  2Y2I A;  2NZD C;  3B0C T;  4Z66 B;  4X23 D;  1M18 B;  4YS3 D;  3W97 A;  3W97 C;  3A1K A;  3UTB B;  1HQ3 A;  3VH6 W;  3W96 B;  4R8P D;  2DF4 C;  5B2J D;  1HQ3 C;  3REI D;  5B32 A;  1KX5 A;  4KHA B;  5B32 C;  1KX5 C;  3B6F B;  3WKJ C;  1P3M A;  3IP4 C;  2Y2L A;  1P3M C;  1B6W A;  1P3P A;  1ID3 B;  3MGP B;  4LD9 A;  5B40 A;  4XUJ D;  5DNN B;  3X1U B;  1P3P C;  3UT9 C;  1M19 A;  1ZLA D;  5B40 C;  4LD9 C;  3W97 D;  1BH9 B;  1P3A B;  5JA4 B;  1M19 C;  3X1T A;  4J8X A;  3AZM A;  2ARO A;  2FJ7 B;  3X1T C;  2F2A C;  4J8X C;  1BFM A;  2F8N A;  5AV5 A;  3AZM C;  2ARO C;  5GXQ A;  2YFW A;  2G5H C;  3WA9 A;  5AV5 C;  4M6B A;  5GXQ C;  3WA9 C;  1S32 B;  1AOI A;  3EPJ A;  1TAF A;  5G49 A;  1P3M D;  2NQB D;  4EO5 C;  1AOI C;  3AZH B;  3X1V D;  4LD9 D;  5B40 D;  3EPL A;  3WTP E;  3UTA A;  3C1B D;  3REJ B;  1M19 D;  5B2I A;  5AV8 B;  3AV2 B;  3UTA C;  5B2I C;  4Z5T A;  4WU8 A;  3AZM D;  2ARO D;  3AZE A;  5B1M D;  5AVB B;  4Z5T C;  4WU8 C;  5AV5 D;  2F8N D;  3W98 A;  1HTA A;  3AZE C;  5GXQ D;  3WA9 D;  4E45 A;  4J8V A;  3W98 C;  3VH5 T;  3LZ0 B;  4J8V C;  5CPJ B;  5CPK A;  5DNM B;  3AFA A;  3MGQ A;  5E5A B;  1KU5 A;  5CPK C;  4HGA B;  3AFA C;  1KX4 C;  4X23 B;  3MGQ C;  4JJN A;  4YS3 B;  1B67 A;  3UTA D;  1P3F A;  5B2I D;  4Z2M G;  1F66 A;  4JJN C;  1P3F C;  1F66 C;  4Z5T D;  4R8P B;  3NQU B;  5B2J B;  4H9O B;  3AYW A;  2YFV A;  3AZN A;  3TU4 B;  3AYW C;  5GT0 A;  3AZJ A;  3AZN C;  2F8N K;  5GT0 C;  3AZJ C;  5JRG A;  5CPK D;  3AFA D;  3MGQ D;  3AZF A;  5GT3 A;  5JRG C;  4XUJ B;  4QLC A;  4KUD D;  3AZF C;  4H9N A;  5GT3 C;  4JJN D;  1ZLA B;  3W97 B;  4QLC C;  1F66 D;  5AV6 A;  4Z2M H;  3X1U D;  5AV6 C;  4WZS B;  1U35 A;  4NE3 A;  4H9R B;  1U35 C;  1KX5 B;  3AZN D;  3O62 A;  3LEL A;  3WTP D;  4YM6 A;  3AZJ D;  3O62 C;  3LEL C;  2NQB B;  1P3M B;  4YM6 C;  5JRG D;  3W99 A;  5GT3 D;  3W99 C;  4LD9 B;  5BNX A;  3H0R C;  5B40 B;  3AZI D;  3NQJ A;  1P3K A;  2IO5 C;  1M19 B;  1P3K C;  3B6G A;  2CWE A;  5AV6 D;  2ZY4 A;  4J8U A;  4AWL C;  3B6G C;  3AZM B;  2ARO B;  3REJ D;  5B1M B;  4J8U C;  5AV8 D;  2F8N B;  5AV5 B;  5GXQ B;  2YFW B;  3WA9 B;  5C3I C;  5B31 D;  4YM6 D;  5AVB D;  3AZK A;  1TAF B;  5G49 B;  1P3L C;  3B0C W;  4E44 A;  3AZK C;  3VH5 A;  3MGR A;  3REK C;  1P3K D;  2Y2J A;  3UTA B;  5DNM D;  3MGR C;  3AZL A;  5B2I B;  5E5A D;  3B6G D;  3AZL C;  1KX3 A;  4Z5T B;  3AZE B;  1KX3 C;  3W98 B;  5B24 A;  1JFI A;  5B24 C;  2Y2G A;  5CPK B;  3WKJ A;  3AFA B;  5B1L A;  3MGQ B;  3TU4 D;  5B31 G;  3C1C A;  3B0D C;  3REL A;  5B1L C;  4KUD B;  2NZD D;  5BO0 A;  3C1C C;  4JJN B;  3REL C;  5KDM A;  1F66 B;  3LJA A;  3UT9 A;  1KX3 D;  2Y2M A;  4H9Q A;  3MNN A;  3LJA C;  3MNN C;  5CPI A;  4ZBJ C;  3AZN B;  1HQ3 D;  3WTP B;  5CPI C;  3AZJ B;  5B32 D;  5JRG B;  1KX5 D;  3WKJ D;  5BNV A;  3AZF B;  4WJ3 C;  3C1C D;  5GT3 B;  3REL D;  4QLC B;  3AZI B;  4H9N B;  3V9R A;  3AV1 A;  2ZY5 A;  4WV4 B;  1P3P D;  2VQR A;  5AV6 B;  3LJA D;  3UT9 D;  2HUE C;  5AY8 A;  5FUG B;  5AV9 C;  3AV1 C;  4J8W A;  3MNN D;  3R45 A;  5AY8 C;  1EQZ A;  1P3I A;  3KUY A;  4J8W C;  3AZG A;  1EQZ C;  4DQY B;  1Q9C A;  5CP6 A;  3X1T D;  4J8X D;  3VH5 W;  1P3I C;  3KUY C;  3AZG C;  5B31 B;  4YM6 B;  2JSS A;  5CP6 C;  5CHL B;  4UPK A;  3KXB A;  5B0Z A;  3KSY A;  4G92 C;  3REI A;  2IO5 B;  3KXB C;  5B0Z C;  5BNX B;  1AOI D;  1P3K B;  5B32 G;  3REI C;  1KX4 A;  4AWL B;  3B6G B;  5AY8 D;  1EQZ D;  3KUY D;  2CV5 A;  2BYM B;  3AZG D;  2XD1 A;  5BT1 C;  5CP6 D;  4Z66 A;  4WU8 D;  2CV5 C;  1M18 A;  3AZE D;  2XD5 A;  4Z66 C;  3W98 D;  1H3O A;  2Y2K A;  4DRB A;  1M18 C;  3KXB D;  4CSR A;  5B0Z D;  4J8V D;  3UTB A;  2PYO A;  3W96 A;  3A1I A; 
#chains in the Genus database with same CATH homology
 2F8N G;  2NZD B;  3LZ1 A;  3UTB C;  4ZUX A;  3MGS A;  2PYO C;  3W96 C;  1N1J B;  2BG1 A;  1P3G A;  1KX4 D;  2LY8 A;  3LZ1 C;  4ZUX C;  3MGS C;  3A6N A;  1P3G C;  1WWI A;  1KX3 B;  2Y2P A;  3A6N C;  1P3F D;  5BT1 D;  3MGP A;  1BH8 A;  1HQ3 B;  1M1A A;  3MGP C;  1M1A C;  3AYW D;  4KGC A;  3B0D B;  5B32 B;  3WKJ B;  2PYO D;  3C1C B;  3REL B;  2Y2Q A;  5GT0 D;  4KGC C;  4NFT A;  5AVC A;  3LZ1 D;  2F8N H;  3MGS D;  5AVC C;  1P3G D;  5KDM B;  1P3P B;  3AZF D;  3A6N D;  3LJA B;  3UT9 B;  4QLC D;  3MNN B;  4H9Q B;  1P3O A;  4ZBJ B;  1P3O C;  3X1T B;  2HIO A;  4J8X B;  3WAA A;  1P34 A;  1U35 D;  2HIO C;  3AL0 C;  3WAA C;  1P34 C;  4KGC D;  3O62 D;  3LEL D;  1P3B A;  3AN2 A;  1P3L A;  4EO5 B;  4H9S A;  4WU9 A;  1AOI B;  1P3B C;  3AN2 C;  2RIQ A;  2HUE B;  4H9S C;  3W99 D;  5F99 A;  3REK A;  4DRA A;  4WU9 C;  3LZ0 A;  2ZM5 A;  5AY8 B;  5F99 C;  4J8W B;  1P3O D;  3LZ0 C;  3R45 B;  1EQZ B;  2Y2H A;  4H9P A;  3KUY B;  4XZQ A;  3AZG B;  5CP6 B;  4J8U D;  2HIO D;  4X23 A;  2ZY3 A;  3X1S A;  4WU8 B;  4XZQ C;  3WAA D;  1P34 D;  4HGA C;  4CAY A;  5B0Y A;  4X23 C;  3X1S C;  4YS3 C;  4G92 B;  4G91 C;  3KXB B;  5B0Z B;  5B0Y C;  4J8V B;  5BS7 A;  2BYK A;  3REI B;  1P3B D;  3AN2 D;  3NQU A;  5B2J A;  5BS7 C;  4WU9 D;  1P3L D;  3AZK D;  4NE5 A;  2J8P A;  5B2J C;  3MVD A;  5F99 D;  3REK D;  1KX4 B;  5GSU A;  1R4V A;  3KWQ A;  3MVD C;  3MGR D;  5GSU C;  4UUZ A;  1P3F B;  3KWQ C;  3AZL D;  3H0M C;  3H0L C;  2CV5 B;  4XZQ D;  4WNN A;  4XUJ A;  3X1S D;  1ZLA A;  4XUJ C;  5B0Y D;  3AYW B;  1H3O B;  2YFV B;  5B24 D;  1ZLA C;  4CSR B;  3EG5 B;  2PYO B;  5GT0 B;  3LZ1 B;  4ZUX B;  3MGS B;  4H9R A;  1P3G B;  5B1L D;  3MVD D;  3A6N B;  1W2E A;  5GSU D;  3VH6 T;  3KWQ D;  2NQB A;  2RVQ C;  5AV9 A;  2UWX A;  3X1V A;  2NQB C;  1BH8 B;  3X1V C;  1M1A B;  3C1B A;  1U35 B;  2L5A A;  5CPI D;  3C1B C;  4KGC B;  3O62 B;  3LEL B;  1F1E A;  5B1M A;  5AVC B;  3W99 B;  5B1M C;  2JCH A;  1A7W A;  1TZY A;  1Z2C B;  2RVQ D;  3NQJ B;  1P3O B;  2W8S A;  1TZY C;  3F6T A;  5B33 A;  3AV1 D;  5AV9 D;  3REH A;  5B33 C;  4J8U B;  2HIO B;  3REH C;  4J8W D;  1P34 B;  3WAA B;  3FDD A;  1P3I D;  5C3I B;  1WWS A;  2Y2N A;  1P3L B;  3AN2 B;  1P3B B;  4WU9 B;  3AZK B;  5F99 B;  3REK B;  2FFF B;  1TZY D;  2JE5 A;  1ULY A;  4NE6 A;  3MGR B;  5B33 D;  3AZL B;  4H9P B;  3REH D;  4KHA A;  4XZQ B;  3B6F A;  4KUD A;  3X1S B;  3B6F C;  2G5I C;  4G91 B;  4CAY B;  5B0Y B;  4KUD C;  5B24 B;  2CV5 D;  1ID3 A;  1JFI B;  5DNN A;  3X1U A;  4Z66 D;  2BYK B;  1M18 D;  1ID3 C;  5DNN C;  3X1U C;  1BH9 A;  1P3A A;  5JA4 A;  5B1L B;  3MVD B;  3UTB D;  3WTP A;  1P3A C;  5GSU B;  2FJ7 A;  3W96 D;  3KWQ B;  3B0B A;  5BO0 B;  4ZUX D;  3WTP C;  1PZR A;  2FJ7 C;  4UUZ B;  3EPH A;  3B6F D;  4WNN B;  3VH6 A;  2DQN C;  1S32 A;  3AZI A;  2Y2O A;  1S32 C;  3AZH A;  3AZI C;  5CPI B;  1ID3 D;  3MGP D;  5FUG A;  3AZH C;  5DNN D;  1M1A D;  3REJ A;  5AV8 A;  3AV2 A;  3REJ C;  1P3A D;  5AV8 C;  5BNV B;  3AV2 C;  5B31 A;  2FJ7 D;  5AVB A;  5AVC D;  5B31 C;  3P5J B;  3V9R B;  5AVB C;  3AV1 B;  5AV9 B;  3X1V B;  1S32 D;  5CPJ A;  5DNM A;  3C1B B;  1P3I B;  5E5A A;  3AZH D;  5CPJ C;  5DNM C;  5E5A C;  4YS3 A;  3AV2 D;  2BYM A;  3KFU G;  4R8P A;  1TZY B;  3EPK A;  4H9O A;  4R8P C;  5B33 B;  2ZY2 A;  3REH B;  3TU4 A;  3LZ0 D;  2NZD A;  3TU4 C;  1T3U A;  5CPJ D;  1N1J A;  2Y2I A;  2NZD C;  3B0C T;  4Z66 B;  4X23 D;  1M18 B;  4YS3 D;  3W97 A;  3W97 C;  3A1K A;  3UTB B;  1HQ3 A;  3VH6 W;  3W96 B;  4R8P D;  2DF4 C;  5B2J D;  1HQ3 C;  3REI D;  5B32 A;  1KX5 A;  4KHA B;  5B32 C;  1KX5 C;  3B6F B;  3WKJ C;  1P3M A;  3IP4 C;  2Y2L A;  1P3M C;  1B6W A;  1P3P A;  1ID3 B;  3MGP B;  4LD9 A;  5B40 A;  4XUJ D;  5DNN B;  3X1U B;  1P3P C;  3UT9 C;  1M19 A;  1ZLA D;  5B40 C;  4LD9 C;  3W97 D;  1BH9 B;  1P3A B;  5JA4 B;  1M19 C;  3X1T A;  4J8X A;  3AZM A;  2ARO A;  2FJ7 B;  3X1T C;  2F2A C;  4J8X C;  1BFM A;  2F8N A;  5AV5 A;  3AZM C;  2ARO C;  5GXQ A;  2YFW A;  2G5H C;  3WA9 A;  5AV5 C;  4M6B A;  5GXQ C;  3WA9 C;  1S32 B;  1AOI A;  3EPJ A;  1TAF A;  5G49 A;  1P3M D;  2NQB D;  4EO5 C;  1AOI C;  3AZH B;  3X1V D;  4LD9 D;  5B40 D;  3EPL A;  3WTP E;  3UTA A;  3C1B D;  3REJ B;  1M19 D;  5B2I A;  5AV8 B;  3AV2 B;  3UTA C;  5B2I C;  4Z5T A;  4WU8 A;  3AZM D;  2ARO D;  3AZE A;  5B1M D;  5AVB B;  4Z5T C;  4WU8 C;  5AV5 D;  2F8N D;  3W98 A;  1HTA A;  3AZE C;  5GXQ D;  3WA9 D;  4E45 A;  4J8V A;  3W98 C;  3VH5 T;  3LZ0 B;  4J8V C;  5CPJ B;  5CPK A;  5DNM B;  3AFA A;  3MGQ A;  5E5A B;  1KU5 A;  5CPK C;  4HGA B;  3AFA C;  1KX4 C;  4X23 B;  3MGQ C;  4JJN A;  4YS3 B;  1B67 A;  3UTA D;  1P3F A;  5B2I D;  4Z2M G;  1F66 A;  4JJN C;  1P3F C;  1F66 C;  4Z5T D;  4R8P B;  3NQU B;  5B2J B;  4H9O B;  3AYW A;  2YFV A;  3AZN A;  3TU4 B;  3AYW C;  5GT0 A;  3AZJ A;  3AZN C;  2F8N K;  5GT0 C;  3AZJ C;  5JRG A;  5CPK D;  3AFA D;  3MGQ D;  3AZF A;  5GT3 A;  5JRG C;  4XUJ B;  4QLC A;  4KUD D;  3AZF C;  4H9N A;  5GT3 C;  4JJN D;  1ZLA B;  3W97 B;  4QLC C;  1F66 D;  5AV6 A;  4Z2M H;  3X1U D;  5AV6 C;  4WZS B;  1U35 A;  4NE3 A;  4H9R B;  1U35 C;  1KX5 B;  3AZN D;  3O62 A;  3LEL A;  3WTP D;  4YM6 A;  3AZJ D;  3O62 C;  3LEL C;  2NQB B;  1P3M B;  4YM6 C;  5JRG D;  3W99 A;  5GT3 D;  3W99 C;  4LD9 B;  5BNX A;  3H0R C;  5B40 B;  3AZI D;  3NQJ A;  1P3K A;  2IO5 C;  1M19 B;  1P3K C;  3B6G A;  2CWE A;  5AV6 D;  2ZY4 A;  4J8U A;  4AWL C;  3B6G C;  3AZM B;  2ARO B;  3REJ D;  5B1M B;  4J8U C;  5AV8 D;  2F8N B;  5AV5 B;  5GXQ B;  2YFW B;  3WA9 B;  5C3I C;  5B31 D;  4YM6 D;  5AVB D;  3AZK A;  1TAF B;  5G49 B;  1P3L C;  3B0C W;  4E44 A;  3AZK C;  3VH5 A;  3MGR A;  3REK C;  1P3K D;  2Y2J A;  3UTA B;  5DNM D;  3MGR C;  3AZL A;  5B2I B;  5E5A D;  3B6G D;  3AZL C;  1KX3 A;  4Z5T B;  3AZE B;  1KX3 C;  3W98 B;  5B24 A;  1JFI A;  5B24 C;  2Y2G A;  5CPK B;  3WKJ A;  3AFA B;  5B1L A;  3MGQ B;  3TU4 D;  5B31 G;  3C1C A;  3B0D C;  3REL A;  5B1L C;  4KUD B;  2NZD D;  5BO0 A;  3C1C C;  4JJN B;  3REL C;  5KDM A;  1F66 B;  3LJA A;  3UT9 A;  1KX3 D;  2Y2M A;  4H9Q A;  3MNN A;  3LJA C;  3MNN C;  5CPI A;  4ZBJ C;  3AZN B;  1HQ3 D;  3WTP B;  5CPI C;  3AZJ B;  5B32 D;  5JRG B;  1KX5 D;  3WKJ D;  5BNV A;  3AZF B;  4WJ3 C;  3C1C D;  5GT3 B;  3REL D;  4QLC B;  3AZI B;  4H9N B;  3V9R A;  3AV1 A;  2ZY5 A;  4WV4 B;  1P3P D;  2VQR A;  5AV6 B;  3LJA D;  3UT9 D;  2HUE C;  5AY8 A;  5FUG B;  5AV9 C;  3AV1 C;  4J8W A;  3MNN D;  3R45 A;  5AY8 C;  1EQZ A;  1P3I A;  3KUY A;  4J8W C;  3AZG A;  1EQZ C;  4DQY B;  1Q9C A;  5CP6 A;  3X1T D;  4J8X D;  3VH5 W;  1P3I C;  3KUY C;  3AZG C;  5B31 B;  4YM6 B;  2JSS A;  5CP6 C;  5CHL B;  4UPK A;  3KXB A;  5B0Z A;  3KSY A;  4G92 C;  3REI A;  2IO5 B;  3KXB C;  5B0Z C;  5BNX B;  1AOI D;  1P3K B;  5B32 G;  3REI C;  1KX4 A;  4AWL B;  3B6G B;  5AY8 D;  1EQZ D;  3KUY D;  2CV5 A;  2BYM B;  3AZG D;  2XD1 A;  5BT1 C;  5CP6 D;  4Z66 A;  4WU8 D;  2CV5 C;  1M18 A;  3AZE D;  2XD5 A;  4Z66 C;  3W98 D;  1H3O A;  2Y2K A;  4DRB A;  1M18 C;  3KXB D;  4CSR A;  5B0Z D;  4J8V D;  3UTB A;  2PYO A;  3W96 A;  3A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...