3W97D

Crystal structure of human nucleosome core particle lacking h2b n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w97D00
4KGCA 5GSUC 5C3IC 3W97A 1P34A 5CPIC 5B24A 4JJNB 3W99C 5BS7A 3MGPD 3O62B 3AZMC 3C1CD 4J8XA 5CPKA 3VH5W 4H9SA 4H9NB 3A6NC 4X23C 3B6GB 4QLCD 3AZIB 4G92C 2F8NA 1P3PC 3WAAD 1M19C 5AVBD 4J8VA 5JRGA 1AOIB 5BNXB 5AV8D 3KWQA 1M1AA 1BH8B 5DNNA 1KX3B 1ID3D 2L5AA 3X1TB 1P3LA 3C1BA 1TZYB 3AZKB 3WA9A 4CAYB 2AROD 4H9OA 3REJD 4XZQC 3AV2C 5E5AD 2PYOA 4HGAB 3AYWB 3AYWC 3AZLD 3MGQB 3TU4D 3AZHB 4M6BA 3V9RB 4XUJA 4KGCB 1P3AA 1ZLAC 3X1SD 3RELA 1P34B 3W97B 2CV5C 1P3FA 4J8XB 5BT1D 3LZ1D 1HQ3D 3KXBA 3REKC 3UTAA 1KX4D 2F8NB 3AZJD 4R8PA 1P3ID 3AZND 4J8VB 5JRGB 5B2JC 5B40A 3AN2A 3NQUB 3MGSD 2NQBB 2NQBC 1N1JB 3KWQB 3LELD 1U35C 5AV5A 5B1LA 1M1AB 5B0YD 3REHA 4Z5TA 3MNNA 3AV1D 4YM6C 1P3LB 3C1BB 4J8UC 3WA9B 4WU9C 5B32A 3AZGD 3O62D 5GXQA 2F8NG 5CP6A 1P3BA 4H9OB 3B6GD 3MGRB 5B2ID 3UT9C 3MGRC 3B0DB 5AV6C 3MVDD 1WWIA 2PYOB 2HIOB 3B6FA 1HTAA 1P3MD 4NE6A 4J8WD 1F1EA 2NZDA 1KX5C 4G91B 1P3FB 3B0CW 5GSUA 4AWLC 4WU8D 3KXBB 3KUYC 4ZBJC 5CPIA 1TZYD 3MGPC 5AY8D 1F66D 3UTAB 3W99A 3AZMA 4KUDC 4LD9D 3A6NA 4R8PB 4H9NA 4X23A 4QLCC 5AV9D 1P3OD 1M18D 1BH9A 3AN2B 5DNMD 5AVBC 1P3PA 1M19A 3MGQD 5AV5B 3LJAC 3X1VB 3AZHD 3W96C 3REHB 4Z5TB 3MNNB 5AV8C 4Z66C 1AOIA 5BNXA 5B24D 5B32B 4NE3A 1KX3A 5GXQB 2LY8A 2FJ7D 5CPKD 5AVCB 5CP6B 1P3GD 4DRAA 3AFAB 3AFAC 1S32C 2AROC 3B6FB 3REJC 5JRGD 3AZFD 4XZQA 3UTBC 3AV2A 4DRBA 3AZLC 3TU4C 3AYWA 2NZDB 5F99C 3KWQD 1P3KD 5DNND 4Z2MG 3X1SC 5B32G 5B33C 4YS3C 5C3IB 5CPIB 4EO5C 3REID 3W99B 3VH6W 2CV5A 3AZMB 3WA9D 5BT1C 5B1MC 1HQ3C 3A6NB 3REKA 4X23B 2BYKA 1BH9B 4G92B 3AZJC 2PYOD 1P3PB 1P3IC 1M19B 3AZNC 4XUJD 5GT3D 1P3AD 3MGSC 5B2JA 3RELD 5JA4B 4WV4B 2IO5C 3NQUA 3LELC 2NQBA 5CPJB 1N1JA 5CPJC 1P3FD 3AV1C 4YM6A 4J8UA 4WU9A 5G49A 4KHAA 3X1UC 5B2IC 3MVDC 3UT9A 2HUEC 4XZQB 3MGRA 3AV2B 5B40D 5GT0D 2HIOA 5B1LD 3VH5T 1P3MC 2JSSA 3LZ0B 1ZLAB 3REHD 3LZ0C 4J8WC 3MNND 5B31B 5B31C 1KX5A 4E45A 3WTPD 2CV5B 4WU8C 5GXQD 4H9QB 3REKB 5B0ZD 3KUYA 1P3BD 5AY8C 1F66C 2BYKB 3MGPA 3VH5A 4KUDA 4LD9C 3KSYA 5AV9C 1P3OC 2F8NH 4WZSB 1M18C 3B6FD 4QLCA 5B2JB 5DNMC 3AZEC 5AVBA 3W98C 3WKJC 1U35B 5B31G 1KU5A 3LJAA 3X1VA 3W96A 5GSUD 4YM6B 4Z66A 4J8UB 4JJND 4WU9B 3AZMD 2FJ7C 5CPKC 1P3GC 5G49B 5AVCA 4KHAB 4X23D 3AFAA 3UT9B 1S32A 5AV6B 3AZID 1M19D 1Q9CA 2AROA 1EQZC 3AZFC 3REJA 4NE5A 3UTBA 4ZUXB 3AZLA 4ZUXC 3TU4A 1AOID 1P3KC 5F99A 1KX5B 3LZ1B 3LZ1C 4H9RB 5BO0A 1KX3D 2BYMA 4AWLB 5B33A 3NQJA 4YS3A 3X1TD 3KUYB 4ZBJB 3REIC 1A7WA 3MGPB 3AZKD 5FUGA 4KUDB 3C1CC 5B1MA 1HQ3A 4QLCB 1BFMA 3WAAB 3AZJA 3WAAC 5AVBB 3AYWD 1P3IA 1TAFA 3LJAB 3AZNA 5GT3C 3W96B 4KGCD 3MGSA 5AV8B 4Z66B 4CSRA 5JA4A 1P34D 3W97D 5CPJA 1JFIB 1ID3B 3AV1A 1ID3C 4J8XD 4E44A 3B0BA 2RVQD 1H3OA 1S32B 2F8ND 2AROB 3B0CT 5B2IA 3X1UA 3REJB 3MVDA 4J8VD 5E5AC 3UTBB 5B2JD 3AZLB 3TU4B 5GT0C 2NQBD 5F99B 1P3MA 5BO0B 1M1AD 3X1SB 2BYMB 3LZ0A 4J8WA 5B33B 1ZLAA 3NQJB 4YS3B 3WTPC 5B31A 5CHLB 4EO5B 3C1BD 1P3LD 4J8UD 5FUGB 4WU9D 4WU8A 5B1MB 1HQ3B 4WNNA 5B0ZC 4H9QA 1F66A 5AY8A 1KX4C 3UT9D 3MGRD 3AZJB 1P3IB 4H9PA 4UUZA 1TAFB 3AZNB 5AV9A 2HIOD 1P3OA 3MGSB 5DNMA 3LELB 2IO5B 4CSRB 3AZEA 3WKJA 3W98A 2YFVA 1U35A 5B0YB 5B0YC 3AV1B 4NFTA 3KUYD 1H3OB 3KXBD 4JJNC 3AZGB 3AZGC 3O62C 2FJ7A 3UTAD 4KUDD 1P3GA 4R8PD 5KDMA 5B2IB 3X1UB 3B6GC 3MVDB 2HUEB 3AZIC 5AV6A 3AN2D 3VH6T 1EQZA 3LJAD 3X1VD 5AV5D 1P3MB 3W96D 3AZFA 4J8WB 1AOIC 4Z5TD 2CWEA 4ZUXA 4Z66D 1P3KA 3LZ1A 1KX3C 4H9RA 5B32D 4WU8B 4WNNB 3X1TC 3VH6A 5AVCD 5CP6D 5AY8B 3REIA 1TZYC 3AFAD 3AZKC 1F66B 2YFWA 1S32D 4LD9B 3C1CA 4H9PB 4UUZB 5AV9B 1P3OB 1M18B 1WWSA 5DNMB 3UTBD 4HGAC 3AZEB 3WAAA 3WKJB 3W98B 3MGQC 5F99D 3AZHC 2YFVB 2NZDD 5GT3A 4KGCC 5B33D 5B24B 4YS3D 5AV8A 1P34C 5B24C 3W97C 5CPID 5BS7C 3W99D 2FJ7B 1JFIA 5CPKB 1ID3A 4J8XC 5B1MD 1P3GB 2RVQC 4H9SC 3A6ND 5KDMB 3R45A 1P3PD 1EQZB 4J8VC 3AZFB 5JRGC 5E5AA 5GT0A 1P3KB 3KWQC 5DNNB 5CPJD 1M1AC 5DNNC 3X1SA 1P3LC 3C1BC 3WTPA 3REIB 2YFWB 3WA9C 3C1CB 5B0ZA 3X1UD 1KX4A 3B0DC 2PYOC 4XZQD 3AV2D 5BNVA 1ULYA 4XUJB 2HIOC 4XUJC 5GT3B 1P3AB 3RELB 1P3AC 3LZ0D 3RELC 1ZLAD 1B67A 3LELA 1B6WA 5B31D 4G91C 1P3FC 5B0YA 2CV5D 4Z2MH 1R4VA 3KXBC 3REKD 4JJNA 3UTAC 3AZGA 3O62A 3R45B 4R8PC 3B6GA 5B40B 5E5AB 3AZIA 5B40C 3AN2C 5GT0B 3AZED 3WKJD 3W98D 5B1LB 3X1VC 5AV5C 5B1LC 3WTPE 1U35D 3REHC 4Z5TC 3MNNC 4YM6D 3WTPB 1BH8A 5B32C 5GXQC 3X1TA 5B0ZB 5AVCC 5CP6C 1P3BB 1P3BC 1TZYA 3AZKA 1KX4B 4CAYA 5BNVB 5AV6D 4LD9A 1EQZD 3B6FC 1M18A 4ZUXD 2NZDC 2F8NK 3MGQA 3AZHA 3V9RA 1KX5D 5GSUB
chains in the Genus database with same CATH superfamily
4KGCA 5GSUC 5C3IC 3W97A 1P34A 5CPIC 5B24A 4JJNB 3W99C 5BS7A 3MGPD 3O62B 3AZMC 3C1CD 4J8XA 5CPKA 3VH5W 4H9SA 4H9NB 3A6NC 4X23C 3B6GB 4QLCD 3AZIB 4G92C 2F8NA 1P3PC 3WAAD 1M19C 5AVBD 4J8VA 5JRGA 1AOIB 5BNXB 5AV8D 3KWQA 1M1AA 1BH8B 5DNNA 1KX3B 1ID3D 2L5AA 3X1TB 1P3LA 3C1BA 1TZYB 3AZKB 3WA9A 2F2AC 4CAYB 2AROD 4H9OA 3REJD 4XZQC 3AV2C 5E5AD 2PYOA 4HGAB 3AYWB 3AYWC 3AZLD 3MGQB 3TU4D 3AZHB 4M6BA 3V9RB 4XUJA 4KGCB 1P3AA 1ZLAC 3X1SD 3RELA 2Y2MA 1P34B 3W97B 2CV5C 1P3FA 2FFFB 4J8XB 5BT1D 3LZ1D 1HQ3D 3KXBA 3REKC 3UTAA 1KX4D 2F8NB 3AZJD 4DQYB 4R8PA 1P3ID 3H0MC 4J8VB 3AZND 5JRGB 5B2JC 5B40A 3AN2A 3NQUB 3MGSD 3H0LC 2NQBB 2NQBC 3F6TA 1N1JB 3KWQB 3LELD 1U35C 5AV5A 5B1LA 1M1AB 5B0YD 3REHA 4Z5TA 3MNNA 3AV1D 4YM6C 1P3LB 3C1BB 4J8UC 3WA9B 4WU9C 5B32A 3AZGD 3O62D 5GXQA 2F8NG 5CP6A 1P3BA 4H9OB 3B6GD 3MGRB 5B2ID 3UT9C 3MGRC 3B0DB 5AV6C 3MVDD 1WWIA 2PYOB 2HIOB 3B6FA 1HTAA 1P3MD 4NE6A 4J8WD 1F1EA 2NZDA 1KX5C 4G91B 1P3FB 3B0CW 5GSUA 4AWLC 4WU8D 3KXBB 3KUYC 4ZBJC 5CPIA 1TZYD 3MGPC 5AY8D 1F66D 3UTAB 3W99A 3AZMA 4KUDC 2XD5A 4LD9D 3A6NA 4R8PB 4H9NA 4X23A 4QLCC 5AV9D 1P3OD 1M18D 1BH9A 3AN2B 5DNMD 5AVBC 1P3PA 1M19A 3MGQD 5AV5B 3LJAC 3X1VB 3AZHD 3W96C 3REHB 4Z5TB 3MNNB 5AV8C 4Z66C 1AOIA 5BNXA 5B24D 5B32B 4NE3A 1KX3A 5GXQB 2LY8A 2FJ7D 5CPKD 5AVCB 5CP6B 1P3GD 4DRAA 3AFAB 3AFAC 1S32C 2AROC 3B6FB 2JCHA 3REJC 5JRGD 3AZFD 4XZQA 3UTBC 3AV2A 4DRBA 3AZLC 3TU4C 3AYWA 2NZDB 5F99C 3KWQD 1P3KD 5DNND 4Z2MG 3X1SC 5B32G 5B33C 3P5JB 4YS3C 5C3IB 5CPIB 4EO5C 3REID 3W99B 3VH6W 2CV5A 3AZMB 3WA9D 5BT1C 2JE5A 5B1MC 1HQ3C 3A6NB 3REKA 4X23B 2ZM5A 2BYKA 1BH9B 4G92B 3AZJC 2PYOD 1P3PB 1P3IC 1M19B 2J8PA 2Y2LA 3AZNC 4XUJD 2G5HC 5GT3D 1P3AD 3MGSC 5B2JA 3RELD 5JA4B 4WV4B 2IO5C 3NQUA 3LELC 2NQBA 5CPJB 1N1JA 5CPJC 1P3FD 3AV1C 4UPKA 3H0RC 4YM6A 4J8UA 4WU9A 1PZRA 5G49A 1W2EA 4KHAA 5B2IC 3X1UC 3MVDC 2W8SA 2HUEC 4XZQB 3MGRA 3UT9A 5B40D 3AV2B 2DQNC 5GT0D 2HIOA 5B1LD 3VH5T 1P3MC 2JSSA 3LZ0B 1ZLAB 3REHD 3LZ0C 4J8WC 3MNND 5B31B 5B31C 1KX5A 4E45A 3WTPD 2CV5B 2VQRA 3EPKA 4WU8C 5GXQD 4H9QB 3REKB 5B0ZD 3KUYA 1P3BD 5AY8C 1F66C 2BYKB 3MGPA 3VH5A 4KUDA 4LD9C 3KSYA 2RIQA 5AV9C 1P3OC 2F8NH 4WZSB 1M18C 3B6FD 4QLCA 5B2JB 5DNMC 2ZY2A 3AZEC 5AVBA 3W98C 3WKJC 1U35B 5B31G 1KU5A 3LJAA 3X1VA 3W96A 5GSUD 4YM6B 4Z66A 4J8UB 3EPLA 4JJND 4WU9B 3AZMD 2FJ7C 5CPKC 3A1IA 3FDDA 3A1KA 1P3GC 5G49B 5AVCA 4KHAB 4X23D 3AFAA 3UT9B 1S32A 5AV6B 3AZID 1M19D 1Q9CA 2AROA 1EQZC 3AZFC 3REJA 4NE5A 3UTBA 4ZUXB 3AZLA 4ZUXC 3TU4A 1AOID 1P3KC 5F99A 1KX5B 3LZ1B 3LZ1C 4H9RB 5BO0A 1KX3D 2BYMA 4AWLB 5B33A 3NQJA 4YS3A 3X1TD 3KUYB 4ZBJB 3REIC 1A7WA 3MGPB 3AZKD 5FUGA 4KUDB 2Y2PA 2G5IC 3C1CC 5B1MA 1HQ3A 2ZY3A 4QLCB 1BFMA 3WAAB 3AZJA 3WAAC 5AVBB 3AYWD 1P3IA 1TAFA 3LJAB 3AZNA 5GT3C 3W96B 4KGCD 3MGSA 5AV8B 4Z66B 4CSRA 5JA4A 1P34D 3W97D 5CPJA 1JFIB 1ID3B 3AV1A 1ID3C 3IP4C 2Y2IA 4J8XD 4E44A 3B0BA 2RVQD 1H3OA 1S32B 2F8ND 2AROB 3B0CT 5B2IA 3X1UA 3REJB 3EPJA 3MVDA 4J8VD 5E5AC 3UTBB 5B2JD 3AZLB 3TU4B 5GT0C 2NQBD 5F99B 1P3MA 5BO0B 1M1AD 3X1SB 2BYMB 3LZ0A 4J8WA 5B33B 1ZLAA 3NQJB 4YS3B 3EPHA 3WTPC 5B31A 5CHLB 4EO5B 3C1BD 1P3LD 4J8UD 5FUGB 4WU9D 4WU8A 5B1MB 1HQ3B 4WNNA 5B0ZC 4H9QA 1F66A 5AY8A 4WJ3C 1KX4C 3UT9D 3MGRD 3AZJB 1P3IB 4H9PA 4UUZA 1TAFB 3AZNB 5AV9A 2HIOD 1P3OA 3MGSB 5DNMA 3LELB 2IO5B 4CSRB 3AZEA 3WKJA 3W98A 2YFVA 1U35A 5B0YB 5B0YC 3AV1B 4NFTA 2Y2QA 3KUYD 1H3OB 3KXBD 4JJNC 3AZGB 3AZGC 3O62C 2FJ7A 3UTAD 4KUDD 1P3GA 2Y2KA 4R8PD 5KDMA 5B2IB 3X1UB 3B6GC 3MVDB 2HUEB 3AZIC 5AV6A 3AN2D 3VH6T 2Y2HA 1EQZA 3LJAD 3X1VD 5AV5D 1P3MB 3W96D 3AZFA 4J8WB 1AOIC 4Z5TD 2CWEA 4ZUXA 4Z66D 1P3KA 3LZ1A 1KX3C 4H9RA 5B32D 4WU8B 4WNNB 3X1TC 2ZY5A 3VH6A 5AVCD 3AL0C 5CP6D 5AY8B 3REIA 1TZYC 3AFAD 3AZKC 1F66B 2YFWA 1S32D 4LD9B 3C1CA 4H9PB 4UUZB 2Y2NA 5AV9B 1P3OB 1M18B 1WWSA 5DNMB 3UTBD 4HGAC 3AZEB 3WAAA 3WKJB 3W98B 3MGQC 2Y2OA 5F99D 3AZHC 2YFVB 2NZDD 5GT3A 4KGCC 2Y2JA 5B33D 5B24B 4YS3D 5AV8A 1P34C 5B24C 3W97C 5CPID 5BS7C 3W99D 2FJ7B 1JFIA 5CPKB 1ID3A 4J8XC 5B1MD 1P3GB 2RVQC 4H9SC 3A6ND 5KDMB 3KFUG 3R45A 1P3PD 1EQZB 4J8VC 3AZFB 5JRGC 5E5AA 2Y2GA 5GT0A 1P3KB 3KWQC 5DNNB 5CPJD 1M1AC 5DNNC 3X1SA 1P3LC 3C1BC 3WTPA 3REIB 2YFWB 3WA9C 3C1CB 5B0ZA 3X1UD 1KX4A 3B0DC 2PYOC 4XZQD 3AV2D 5BNVA 1T3UA 1ULYA 4XUJB 2HIOC 4XUJC 5GT3B 1P3AB 3RELB 1P3AC 3LZ0D 3RELC 1ZLAD 1B67A 3LELA 1B6WA 5B31D 4G91C 1P3FC 5B0YA 2CV5D 4Z2MH 1R4VA 3KXBC 3REKD 4JJNA 2BG1A 3UTAC 3AZGA 3O62A 3R45B 4R8PC 3B6GA 5B40B 2XD1A 5E5AB 5B40C 3AZIA 3AN2C 5GT0B 2UWXA 3AZED 3W98D 5B1LB 3WKJD 3X1VC 5AV5C 5B1LC 3WTPE 1U35D 2ZY4A 3EG5B 3REHC 4Z5TC 3MNNC 4YM6D 3WTPB 1BH8A 5B32C 5GXQC 3X1TA 5B0ZB 5AVCC 5CP6C 1P3BB 1P3BC 1TZYA 3AZKA 1KX4B 4CAYA 2DF4C 5BNVB 5AV6D 4LD9A 1EQZD 3B6FC 1Z2CB 1M18A 4ZUXD 2NZDC 2F8NK 3MGQA 3AZHA 3V9RA 1KX5D 5GSUB
chains in the Genus database with same CATH topology
4KGCA 5GSUC 5C3IC 3W97A 1P34A 5CPIC 5B24A 4JJNB 3W99C 5BS7A 3MGPD 3O62B 3AZMC 3C1CD 4J8XA 5CPKA 3VH5W 4H9SA 4H9NB 3A6NC 4X23C 3B6GB 4QLCD 3AZIB 4G92C 2F8NA 1P3PC 3WAAD 1M19C 5AVBD 4J8VA 5JRGA 1AOIB 5BNXB 5AV8D 3KWQA 1M1AA 1BH8B 5DNNA 1KX3B 1ID3D 2L5AA 3X1TB 1P3LA 3C1BA 1TZYB 3AZKB 3WA9A 2F2AC 4CAYB 2AROD 4H9OA 3REJD 4XZQC 3AV2C 5E5AD 2PYOA 4HGAB 3AYWB 3AYWC 3AZLD 3MGQB 3TU4D 3AZHB 4M6BA 3V9RB 4XUJA 4KGCB 1P3AA 1ZLAC 3X1SD 3RELA 2Y2MA 1P34B 3W97B 2CV5C 1P3FA 2FFFB 4J8XB 5BT1D 3LZ1D 1HQ3D 3KXBA 3REKC 3UTAA 1KX4D 2F8NB 3AZJD 4DQYB 4R8PA 1P3ID 3H0MC 4J8VB 3AZND 5JRGB 5B2JC 5B40A 3AN2A 3NQUB 3MGSD 3H0LC 2NQBB 2NQBC 3F6TA 1N1JB 3KWQB 3LELD 1U35C 5AV5A 5B1LA 1M1AB 5B0YD 3REHA 4Z5TA 3MNNA 3AV1D 4YM6C 1P3LB 3C1BB 4J8UC 3WA9B 4WU9C 5B32A 3AZGD 3O62D 5GXQA 2F8NG 5CP6A 1P3BA 4H9OB 3B6GD 3MGRB 5B2ID 3UT9C 3MGRC 3B0DB 5AV6C 3MVDD 1WWIA 2PYOB 2HIOB 3B6FA 1HTAA 1P3MD 4NE6A 4J8WD 1F1EA 2NZDA 1KX5C 4G91B 1P3FB 3B0CW 5GSUA 4AWLC 4WU8D 3KXBB 3KUYC 4ZBJC 5CPIA 1TZYD 3MGPC 5AY8D 1F66D 3UTAB 3W99A 3AZMA 4KUDC 2XD5A 4LD9D 3A6NA 4R8PB 4H9NA 4X23A 4QLCC 5AV9D 1P3OD 1M18D 1BH9A 3AN2B 5DNMD 5AVBC 1P3PA 1M19A 3MGQD 5AV5B 3LJAC 3X1VB 3AZHD 3W96C 3REHB 4Z5TB 3MNNB 5AV8C 4Z66C 1AOIA 5BNXA 5B24D 5B32B 4NE3A 1KX3A 5GXQB 2LY8A 2FJ7D 5CPKD 5AVCB 5CP6B 1P3GD 4DRAA 3AFAB 3AFAC 1S32C 2AROC 3B6FB 2JCHA 3REJC 5JRGD 3AZFD 4XZQA 3UTBC 3AV2A 4DRBA 3AZLC 3TU4C 3AYWA 2NZDB 5F99C 3KWQD 1P3KD 5DNND 4Z2MG 3X1SC 5B32G 5B33C 3P5JB 4YS3C 5C3IB 5CPIB 4EO5C 3REID 3W99B 3VH6W 2CV5A 3AZMB 3WA9D 5BT1C 2JE5A 5B1MC 1HQ3C 3A6NB 3REKA 4X23B 2ZM5A 2BYKA 1BH9B 4G92B 3AZJC 2PYOD 1P3PB 1P3IC 1M19B 2J8PA 2Y2LA 3AZNC 4XUJD 2G5HC 5GT3D 1P3AD 3MGSC 5B2JA 3RELD 5JA4B 4WV4B 2IO5C 3NQUA 3LELC 2NQBA 5CPJB 1N1JA 5CPJC 1P3FD 3AV1C 4UPKA 3H0RC 4YM6A 4J8UA 4WU9A 1PZRA 5G49A 1W2EA 4KHAA 5B2IC 3X1UC 3MVDC 2W8SA 2HUEC 4XZQB 3MGRA 3UT9A 5B40D 3AV2B 2DQNC 5GT0D 2HIOA 5B1LD 3VH5T 1P3MC 2JSSA 3LZ0B 1ZLAB 3REHD 3LZ0C 4J8WC 3MNND 5B31B 5B31C 1KX5A 4E45A 3WTPD 2CV5B 2VQRA 3EPKA 4WU8C 5GXQD 4H9QB 3REKB 5B0ZD 3KUYA 1P3BD 5AY8C 1F66C 2BYKB 3MGPA 3VH5A 4KUDA 4LD9C 3KSYA 2RIQA 5AV9C 1P3OC 2F8NH 4WZSB 1M18C 3B6FD 4QLCA 5B2JB 5DNMC 2ZY2A 3AZEC 5AVBA 3W98C 3WKJC 1U35B 5B31G 1KU5A 3LJAA 3X1VA 3W96A 5GSUD 4YM6B 4Z66A 4J8UB 3EPLA 4JJND 4WU9B 3AZMD 2FJ7C 5CPKC 3A1IA 3FDDA 3A1KA 1P3GC 5G49B 5AVCA 4KHAB 4X23D 3AFAA 3UT9B 1S32A 5AV6B 3AZID 1M19D 1Q9CA 2AROA 1EQZC 3AZFC 3REJA 4NE5A 3UTBA 4ZUXB 3AZLA 4ZUXC 3TU4A 1AOID 1P3KC 5F99A 1KX5B 3LZ1B 3LZ1C 4H9RB 5BO0A 1KX3D 2BYMA 4AWLB 5B33A 3NQJA 4YS3A 3X1TD 3KUYB 4ZBJB 3REIC 1A7WA 3MGPB 3AZKD 5FUGA 4KUDB 2Y2PA 2G5IC 3C1CC 5B1MA 1HQ3A 2ZY3A 4QLCB 1BFMA 3WAAB 3AZJA 3WAAC 5AVBB 3AYWD 1P3IA 1TAFA 3LJAB 3AZNA 5GT3C 3W96B 4KGCD 3MGSA 5AV8B 4Z66B 4CSRA 5JA4A 1P34D 3W97D 5CPJA 1JFIB 1ID3B 3AV1A 1ID3C 3IP4C 2Y2IA 4J8XD 4E44A 3B0BA 2RVQD 1H3OA 1S32B 2F8ND 2AROB 3B0CT 5B2IA 3X1UA 3REJB 3EPJA 3MVDA 4J8VD 5E5AC 3UTBB 5B2JD 3AZLB 3TU4B 5GT0C 2NQBD 5F99B 1P3MA 5BO0B 1M1AD 3X1SB 2BYMB 3LZ0A 4J8WA 5B33B 1ZLAA 3NQJB 4YS3B 3EPHA 3WTPC 5B31A 5CHLB 4EO5B 3C1BD 1P3LD 4J8UD 5FUGB 4WU9D 4WU8A 5B1MB 1HQ3B 4WNNA 5B0ZC 4H9QA 1F66A 5AY8A 4WJ3C 1KX4C 3UT9D 3MGRD 3AZJB 1P3IB 4H9PA 4UUZA 1TAFB 3AZNB 5AV9A 2HIOD 1P3OA 3MGSB 5DNMA 3LELB 2IO5B 4CSRB 3AZEA 3WKJA 3W98A 2YFVA 1U35A 5B0YB 5B0YC 3AV1B 4NFTA 2Y2QA 3KUYD 1H3OB 3KXBD 4JJNC 3AZGB 3AZGC 3O62C 2FJ7A 3UTAD 4KUDD 1P3GA 2Y2KA 4R8PD 5KDMA 5B2IB 3X1UB 3B6GC 3MVDB 2HUEB 3AZIC 5AV6A 3AN2D 3VH6T 2Y2HA 1EQZA 3LJAD 3X1VD 5AV5D 1P3MB 3W96D 3AZFA 4J8WB 1AOIC 4Z5TD 2CWEA 4ZUXA 4Z66D 1P3KA 3LZ1A 1KX3C 4H9RA 5B32D 4WU8B 4WNNB 3X1TC 2ZY5A 3VH6A 5AVCD 3AL0C 5CP6D 5AY8B 3REIA 1TZYC 3AFAD 3AZKC 1F66B 2YFWA 1S32D 4LD9B 3C1CA 4H9PB 4UUZB 2Y2NA 5AV9B 1P3OB 1M18B 1WWSA 5DNMB 3UTBD 4HGAC 3AZEB 3WAAA 3WKJB 3W98B 3MGQC 2Y2OA 5F99D 3AZHC 2YFVB 2NZDD 5GT3A 4KGCC 2Y2JA 5B33D 5B24B 4YS3D 5AV8A 1P34C 5B24C 3W97C 5CPID 5BS7C 3W99D 2FJ7B 1JFIA 5CPKB 1ID3A 4J8XC 5B1MD 1P3GB 2RVQC 4H9SC 3A6ND 5KDMB 3KFUG 3R45A 1P3PD 1EQZB 4J8VC 3AZFB 5JRGC 5E5AA 2Y2GA 5GT0A 1P3KB 3KWQC 5DNNB 5CPJD 1M1AC 5DNNC 3X1SA 1P3LC 3C1BC 3WTPA 3REIB 2YFWB 3WA9C 3C1CB 5B0ZA 3X1UD 1KX4A 3B0DC 2PYOC 4XZQD 3AV2D 5BNVA 1T3UA 1ULYA 4XUJB 2HIOC 4XUJC 5GT3B 1P3AB 3RELB 1P3AC 3LZ0D 3RELC 1ZLAD 1B67A 3LELA 1B6WA 5B31D 4G91C 1P3FC 5B0YA 2CV5D 4Z2MH 1R4VA 3KXBC 3REKD 4JJNA 2BG1A 3UTAC 3AZGA 3O62A 3R45B 4R8PC 3B6GA 5B40B 2XD1A 5E5AB 5B40C 3AZIA 3AN2C 5GT0B 2UWXA 3AZED 3W98D 5B1LB 3WKJD 3X1VC 5AV5C 5B1LC 3WTPE 1U35D 2ZY4A 3EG5B 3REHC 4Z5TC 3MNNC 4YM6D 3WTPB 1BH8A 5B32C 5GXQC 3X1TA 5B0ZB 5AVCC 5CP6C 1P3BB 1P3BC 1TZYA 3AZKA 1KX4B 4CAYA 2DF4C 5BNVB 5AV6D 4LD9A 1EQZD 3B6FC 1Z2CB 1M18A 4ZUXD 2NZDC 2F8NK 3MGQA 3AZHA 3V9RA 1KX5D 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC A;  5GSU C;  5C3I C;  3W97 A;  1P34 A;  5CPI C;  5B24 A;  4JJN B;  3W99 C;  5BS7 A;  3MGP D;  3O62 B;  3AZM C;  3C1C D;  4J8X A;  5CPK A;  3VH5 W;  4H9S A;  4H9N B;  3A6N C;  4X23 C;  3B6G B;  4QLC D;  3AZI B;  4G92 C;  2F8N A;  1P3P C;  3WAA D;  1M19 C;  5AVB D;  4J8V A;  5JRG A;  1AOI B;  5BNX B;  5AV8 D;  3KWQ A;  1M1A A;  1BH8 B;  5DNN A;  1KX3 B;  1ID3 D;  2L5A A;  3X1T B;  1P3L A;  3C1B A;  1TZY B;  3AZK B;  3WA9 A;  4CAY B;  2ARO D;  4H9O A;  3REJ D;  4XZQ C;  3AV2 C;  5E5A D;  2PYO A;  4HGA B;  3AYW B;  3AYW C;  3AZL D;  3MGQ B;  3TU4 D;  3AZH B;  4M6B A;  3V9R B;  4XUJ A;  4KGC B;  1P3A A;  1ZLA C;  3X1S D;  3REL A;  1P34 B;  3W97 B;  2CV5 C;  1P3F A;  4J8X B;  5BT1 D;  3LZ1 D;  1HQ3 D;  3KXB A;  3REK C;  3UTA A;  1KX4 D;  2F8N B;  3AZJ D;  4R8P A;  1P3I D;  3AZN D;  4J8V B;  5JRG B;  5B2J C;  5B40 A;  3AN2 A;  3NQU B;  3MGS D;  2NQB B;  2NQB C;  1N1J B;  3KWQ B;  3LEL D;  1U35 C;  5AV5 A;  5B1L A;  1M1A B;  5B0Y D;  3REH A;  4Z5T A;  3MNN A;  3AV1 D;  4YM6 C;  1P3L B;  3C1B B;  4J8U C;  3WA9 B;  4WU9 C;  5B32 A;  3AZG D;  3O62 D;  5GXQ A;  2F8N G;  5CP6 A;  1P3B A;  4H9O B;  3B6G D;  3MGR B;  5B2I D;  3UT9 C;  3MGR C;  3B0D B;  5AV6 C;  3MVD D;  1WWI A;  2PYO B;  2HIO B;  3B6F A;  1HTA A;  1P3M D;  4NE6 A;  4J8W D;  1F1E A;  2NZD A;  1KX5 C;  4G91 B;  1P3F B;  3B0C W;  5GSU A;  4AWL C;  4WU8 D;  3KXB B;  3KUY C;  4ZBJ C;  5CPI A;  1TZY D;  3MGP C;  5AY8 D;  1F66 D;  3UTA B;  3W99 A;  3AZM A;  4KUD C;  4LD9 D;  3A6N A;  4R8P B;  4H9N A;  4X23 A;  4QLC C;  5AV9 D;  1P3O D;  1M18 D;  1BH9 A;  3AN2 B;  5DNM D;  5AVB C;  1P3P A;  1M19 A;  3MGQ D;  5AV5 B;  3LJA C;  3X1V B;  3AZH D;  3W96 C;  3REH B;  4Z5T B;  3MNN B;  5AV8 C;  4Z66 C;  1AOI A;  5BNX A;  5B24 D;  5B32 B;  4NE3 A;  1KX3 A;  5GXQ B;  2LY8 A;  2FJ7 D;  5CPK D;  5AVC B;  5CP6 B;  1P3G D;  4DRA A;  3AFA B;  3AFA C;  1S32 C;  2ARO C;  3B6F B;  3REJ C;  5JRG D;  3AZF D;  4XZQ A;  3UTB C;  3AV2 A;  4DRB A;  3AZL C;  3TU4 C;  3AYW A;  2NZD B;  5F99 C;  3KWQ D;  1P3K D;  5DNN D;  4Z2M G;  3X1S C;  5B32 G;  5B33 C;  4YS3 C;  5C3I B;  5CPI B;  4EO5 C;  3REI D;  3W99 B;  3VH6 W;  2CV5 A;  3AZM B;  3WA9 D;  5BT1 C;  5B1M C;  1HQ3 C;  3A6N B;  3REK A;  4X23 B;  2BYK A;  1BH9 B;  4G92 B;  3AZJ C;  2PYO D;  1P3P B;  1P3I C;  1M19 B;  3AZN C;  4XUJ D;  5GT3 D;  1P3A D;  3MGS C;  5B2J A;  3REL D;  5JA4 B;  4WV4 B;  2IO5 C;  3NQU A;  3LEL C;  2NQB A;  5CPJ B;  1N1J A;  5CPJ C;  1P3F D;  3AV1 C;  4YM6 A;  4J8U A;  4WU9 A;  5G49 A;  4KHA A;  3X1U C;  5B2I C;  3MVD C;  3UT9 A;  2HUE C;  4XZQ B;  3MGR A;  3AV2 B;  5B40 D;  5GT0 D;  2HIO A;  5B1L D;  3VH5 T;  1P3M C;  2JSS A;  3LZ0 B;  1ZLA B;  3REH D;  3LZ0 C;  4J8W C;  3MNN D;  5B31 B;  5B31 C;  1KX5 A;  4E45 A;  3WTP D;  2CV5 B;  4WU8 C;  5GXQ D;  4H9Q B;  3REK B;  5B0Z D;  3KUY A;  1P3B D;  5AY8 C;  1F66 C;  2BYK B;  3MGP A;  3VH5 A;  4KUD A;  4LD9 C;  3KSY A;  5AV9 C;  1P3O C;  2F8N H;  4WZS B;  1M18 C;  3B6F D;  4QLC A;  5B2J B;  5DNM C;  3AZE C;  5AVB A;  3W98 C;  3WKJ C;  1U35 B;  5B31 G;  1KU5 A;  3LJA A;  3X1V A;  3W96 A;  5GSU D;  4YM6 B;  4Z66 A;  4J8U B;  4JJN D;  4WU9 B;  3AZM D;  2FJ7 C;  5CPK C;  1P3G C;  5G49 B;  5AVC A;  4KHA B;  4X23 D;  3AFA A;  3UT9 B;  1S32 A;  5AV6 B;  3AZI D;  1M19 D;  1Q9C A;  2ARO A;  1EQZ C;  3AZF C;  3REJ A;  4NE5 A;  3UTB A;  4ZUX B;  3AZL A;  4ZUX C;  3TU4 A;  1AOI D;  1P3K C;  5F99 A;  1KX5 B;  3LZ1 B;  3LZ1 C;  4H9R B;  5BO0 A;  1KX3 D;  2BYM A;  4AWL B;  5B33 A;  3NQJ A;  4YS3 A;  3X1T D;  3KUY B;  4ZBJ B;  3REI C;  1A7W A;  3MGP B;  3AZK D;  5FUG A;  4KUD B;  3C1C C;  5B1M A;  1HQ3 A;  4QLC B;  1BFM A;  3WAA B;  3AZJ A;  3WAA C;  5AVB B;  3AYW D;  1P3I A;  1TAF A;  3LJA B;  3AZN A;  5GT3 C;  3W96 B;  4KGC D;  3MGS A;  5AV8 B;  4Z66 B;  4CSR A;  5JA4 A;  1P34 D;  3W97 D;  5CPJ A;  1JFI B;  1ID3 B;  3AV1 A;  1ID3 C;  4J8X D;  4E44 A;  3B0B A;  2RVQ D;  1H3O A;  1S32 B;  2F8N D;  2ARO B;  3B0C T;  5B2I A;  3X1U A;  3REJ B;  3MVD A;  4J8V D;  5E5A C;  3UTB B;  5B2J D;  3AZL B;  3TU4 B;  5GT0 C;  2NQB D;  5F99 B;  1P3M A;  5BO0 B;  1M1A D;  3X1S B;  2BYM B;  3LZ0 A;  4J8W A;  5B33 B;  1ZLA A;  3NQJ B;  4YS3 B;  3WTP C;  5B31 A;  5CHL B;  4EO5 B;  3C1B D;  1P3L D;  4J8U D;  5FUG B;  4WU9 D;  4WU8 A;  5B1M B;  1HQ3 B;  4WNN A;  5B0Z C;  4H9Q A;  1F66 A;  5AY8 A;  1KX4 C;  3UT9 D;  3MGR D;  3AZJ B;  1P3I B;  4H9P A;  4UUZ A;  1TAF B;  3AZN B;  5AV9 A;  2HIO D;  1P3O A;  3MGS B;  5DNM A;  3LEL B;  2IO5 B;  4CSR B;  3AZE A;  3WKJ A;  3W98 A;  2YFV A;  1U35 A;  5B0Y B;  5B0Y C;  3AV1 B;  4NFT A;  3KUY D;  1H3O B;  3KXB D;  4JJN C;  3AZG B;  3AZG C;  3O62 C;  2FJ7 A;  3UTA D;  4KUD D;  1P3G A;  4R8P D;  5KDM A;  5B2I B;  3X1U B;  3B6G C;  3MVD B;  2HUE B;  3AZI C;  5AV6 A;  3AN2 D;  3VH6 T;  1EQZ A;  3LJA D;  3X1V D;  5AV5 D;  1P3M B;  3W96 D;  3AZF A;  4J8W B;  1AOI C;  4Z5T D;  2CWE A;  4ZUX A;  4Z66 D;  1P3K A;  3LZ1 A;  1KX3 C;  4H9R A;  5B32 D;  4WU8 B;  4WNN B;  3X1T C;  3VH6 A;  5AVC D;  5CP6 D;  5AY8 B;  3REI A;  1TZY C;  3AFA D;  3AZK C;  1F66 B;  2YFW A;  1S32 D;  4LD9 B;  3C1C A;  4H9P B;  4UUZ B;  5AV9 B;  1P3O B;  1M18 B;  1WWS A;  5DNM B;  3UTB D;  4HGA C;  3AZE B;  3WAA A;  3WKJ B;  3W98 B;  3MGQ C;  5F99 D;  3AZH C;  2YFV B;  2NZD D;  5GT3 A;  4KGC C;  5B33 D;  5B24 B;  4YS3 D;  5AV8 A;  1P34 C;  5B24 C;  3W97 C;  5CPI D;  5BS7 C;  3W99 D;  2FJ7 B;  1JFI A;  5CPK B;  1ID3 A;  4J8X C;  5B1M D;  1P3G B;  2RVQ C;  4H9S C;  3A6N D;  5KDM B;  3R45 A;  1P3P D;  1EQZ B;  4J8V C;  3AZF B;  5JRG C;  5E5A A;  5GT0 A;  1P3K B;  3KWQ C;  5DNN B;  5CPJ D;  1M1A C;  5DNN C;  3X1S A;  1P3L C;  3C1B C;  3WTP A;  3REI B;  2YFW B;  3WA9 C;  3C1C B;  5B0Z A;  3X1U D;  1KX4 A;  3B0D C;  2PYO C;  4XZQ D;  3AV2 D;  5BNV A;  1ULY A;  4XUJ B;  2HIO C;  4XUJ C;  5GT3 B;  1P3A B;  3REL B;  1P3A C;  3LZ0 D;  3REL C;  1ZLA D;  1B67 A;  3LEL A;  1B6W A;  5B31 D;  4G91 C;  1P3F C;  5B0Y A;  2CV5 D;  4Z2M H;  1R4V A;  3KXB C;  3REK D;  4JJN A;  3UTA C;  3AZG A;  3O62 A;  3R45 B;  4R8P C;  3B6G A;  5B40 B;  5E5A B;  3AZI A;  5B40 C;  3AN2 C;  5GT0 B;  3AZE D;  3WKJ D;  3W98 D;  5B1L B;  3X1V C;  5AV5 C;  5B1L C;  3WTP E;  1U35 D;  3REH C;  4Z5T C;  3MNN C;  4YM6 D;  3WTP B;  1BH8 A;  5B32 C;  5GXQ C;  3X1T A;  5B0Z B;  5AVC C;  5CP6 C;  1P3B B;  1P3B C;  1TZY A;  3AZK A;  1KX4 B;  4CAY A;  5BNV B;  5AV6 D;  4LD9 A;  1EQZ D;  3B6F C;  1M18 A;  4ZUX D;  2NZD C;  2F8N K;  3MGQ A;  3AZH A;  3V9R A;  1KX5 D;  5GSU B; 
#chains in the Genus database with same CATH topology
 4KGC A;  5GSU C;  5C3I C;  3W97 A;  1P34 A;  5CPI C;  5B24 A;  4JJN B;  3W99 C;  5BS7 A;  3MGP D;  3O62 B;  3AZM C;  3C1C D;  4J8X A;  5CPK A;  3VH5 W;  4H9S A;  4H9N B;  3A6N C;  4X23 C;  3B6G B;  4QLC D;  3AZI B;  4G92 C;  2F8N A;  1P3P C;  3WAA D;  1M19 C;  5AVB D;  4J8V A;  5JRG A;  1AOI B;  5BNX B;  5AV8 D;  3KWQ A;  1M1A A;  1BH8 B;  5DNN A;  1KX3 B;  1ID3 D;  2L5A A;  3X1T B;  1P3L A;  3C1B A;  1TZY B;  3AZK B;  3WA9 A;  2F2A C;  4CAY B;  2ARO D;  4H9O A;  3REJ D;  4XZQ C;  3AV2 C;  5E5A D;  2PYO A;  4HGA B;  3AYW B;  3AYW C;  3AZL D;  3MGQ B;  3TU4 D;  3AZH B;  4M6B A;  3V9R B;  4XUJ A;  4KGC B;  1P3A A;  1ZLA C;  3X1S D;  3REL A;  2Y2M A;  1P34 B;  3W97 B;  2CV5 C;  1P3F A;  2FFF B;  4J8X B;  5BT1 D;  3LZ1 D;  1HQ3 D;  3KXB A;  3REK C;  3UTA A;  1KX4 D;  2F8N B;  3AZJ D;  4DQY B;  4R8P A;  1P3I D;  3H0M C;  4J8V B;  3AZN D;  5JRG B;  5B2J C;  5B40 A;  3AN2 A;  3NQU B;  3MGS D;  3H0L C;  2NQB B;  2NQB C;  3F6T A;  1N1J B;  3KWQ B;  3LEL D;  1U35 C;  5AV5 A;  5B1L A;  1M1A B;  5B0Y D;  3REH A;  4Z5T A;  3MNN A;  3AV1 D;  4YM6 C;  1P3L B;  3C1B B;  4J8U C;  3WA9 B;  4WU9 C;  5B32 A;  3AZG D;  3O62 D;  5GXQ A;  2F8N G;  5CP6 A;  1P3B A;  4H9O B;  3B6G D;  3MGR B;  5B2I D;  3UT9 C;  3MGR C;  3B0D B;  5AV6 C;  3MVD D;  1WWI A;  2PYO B;  2HIO B;  3B6F A;  1HTA A;  1P3M D;  4NE6 A;  4J8W D;  1F1E A;  2NZD A;  1KX5 C;  4G91 B;  1P3F B;  3B0C W;  5GSU A;  4AWL C;  4WU8 D;  3KXB B;  3KUY C;  4ZBJ C;  5CPI A;  1TZY D;  3MGP C;  5AY8 D;  1F66 D;  3UTA B;  3W99 A;  3AZM A;  4KUD C;  2XD5 A;  4LD9 D;  3A6N A;  4R8P B;  4H9N A;  4X23 A;  4QLC C;  5AV9 D;  1P3O D;  1M18 D;  1BH9 A;  3AN2 B;  5DNM D;  5AVB C;  1P3P A;  1M19 A;  3MGQ D;  5AV5 B;  3LJA C;  3X1V B;  3AZH D;  3W96 C;  3REH B;  4Z5T B;  3MNN B;  5AV8 C;  4Z66 C;  1AOI A;  5BNX A;  5B24 D;  5B32 B;  4NE3 A;  1KX3 A;  5GXQ B;  2LY8 A;  2FJ7 D;  5CPK D;  5AVC B;  5CP6 B;  1P3G D;  4DRA A;  3AFA B;  3AFA C;  1S32 C;  2ARO C;  3B6F B;  2JCH A;  3REJ C;  5JRG D;  3AZF D;  4XZQ A;  3UTB C;  3AV2 A;  4DRB A;  3AZL C;  3TU4 C;  3AYW A;  2NZD B;  5F99 C;  3KWQ D;  1P3K D;  5DNN D;  4Z2M G;  3X1S C;  5B32 G;  5B33 C;  3P5J B;  4YS3 C;  5C3I B;  5CPI B;  4EO5 C;  3REI D;  3W99 B;  3VH6 W;  2CV5 A;  3AZM B;  3WA9 D;  5BT1 C;  2JE5 A;  5B1M C;  1HQ3 C;  3A6N B;  3REK A;  4X23 B;  2ZM5 A;  2BYK A;  1BH9 B;  4G92 B;  3AZJ C;  2PYO D;  1P3P B;  1P3I C;  1M19 B;  2J8P A;  2Y2L A;  3AZN C;  4XUJ D;  2G5H C;  5GT3 D;  1P3A D;  3MGS C;  5B2J A;  3REL D;  5JA4 B;  4WV4 B;  2IO5 C;  3NQU A;  3LEL C;  2NQB A;  5CPJ B;  1N1J A;  5CPJ C;  1P3F D;  3AV1 C;  4UPK A;  3H0R C;  4YM6 A;  4J8U A;  4WU9 A;  1PZR A;  5G49 A;  1W2E A;  4KHA A;  5B2I C;  3X1U C;  3MVD C;  2W8S A;  2HUE C;  4XZQ B;  3MGR A;  3UT9 A;  5B40 D;  3AV2 B;  2DQN C;  5GT0 D;  2HIO A;  5B1L D;  3VH5 T;  1P3M C;  2JSS A;  3LZ0 B;  1ZLA B;  3REH D;  3LZ0 C;  4J8W C;  3MNN D;  5B31 B;  5B31 C;  1KX5 A;  4E45 A;  3WTP D;  2CV5 B;  2VQR A;  3EPK A;  4WU8 C;  5GXQ D;  4H9Q B;  3REK B;  5B0Z D;  3KUY A;  1P3B D;  5AY8 C;  1F66 C;  2BYK B;  3MGP A;  3VH5 A;  4KUD A;  4LD9 C;  3KSY A;  2RIQ A;  5AV9 C;  1P3O C;  2F8N H;  4WZS B;  1M18 C;  3B6F D;  4QLC A;  5B2J B;  5DNM C;  2ZY2 A;  3AZE C;  5AVB A;  3W98 C;  3WKJ C;  1U35 B;  5B31 G;  1KU5 A;  3LJA A;  3X1V A;  3W96 A;  5GSU D;  4YM6 B;  4Z66 A;  4J8U B;  3EPL A;  4JJN D;  4WU9 B;  3AZM D;  2FJ7 C;  5CPK C;  3A1I A;  3FDD A;  3A1K A;  1P3G C;  5G49 B;  5AVC A;  4KHA B;  4X23 D;  3AFA A;  3UT9 B;  1S32 A;  5AV6 B;  3AZI D;  1M19 D;  1Q9C A;  2ARO A;  1EQZ C;  3AZF C;  3REJ A;  4NE5 A;  3UTB A;  4ZUX B;  3AZL A;  4ZUX C;  3TU4 A;  1AOI D;  1P3K C;  5F99 A;  1KX5 B;  3LZ1 B;  3LZ1 C;  4H9R B;  5BO0 A;  1KX3 D;  2BYM A;  4AWL B;  5B33 A;  3NQJ A;  4YS3 A;  3X1T D;  3KUY B;  4ZBJ B;  3REI C;  1A7W A;  3MGP B;  3AZK D;  5FUG A;  4KUD B;  2Y2P A;  2G5I C;  3C1C C;  5B1M A;  1HQ3 A;  2ZY3 A;  4QLC B;  1BFM A;  3WAA B;  3AZJ A;  3WAA C;  5AVB B;  3AYW D;  1P3I A;  1TAF A;  3LJA B;  3AZN A;  5GT3 C;  3W96 B;  4KGC D;  3MGS A;  5AV8 B;  4Z66 B;  4CSR A;  5JA4 A;  1P34 D;  3W97 D;  5CPJ A;  1JFI B;  1ID3 B;  3AV1 A;  1ID3 C;  3IP4 C;  2Y2I A;  4J8X D;  4E44 A;  3B0B A;  2RVQ D;  1H3O A;  1S32 B;  2F8N D;  2ARO B;  3B0C T;  5B2I A;  3X1U A;  3REJ B;  3EPJ A;  3MVD A;  4J8V D;  5E5A C;  3UTB B;  5B2J D;  3AZL B;  3TU4 B;  5GT0 C;  2NQB D;  5F99 B;  1P3M A;  5BO0 B;  1M1A D;  3X1S B;  2BYM B;  3LZ0 A;  4J8W A;  5B33 B;  1ZLA A;  3NQJ B;  4YS3 B;  3EPH A;  3WTP C;  5B31 A;  5CHL B;  4EO5 B;  3C1B D;  1P3L D;  4J8U D;  5FUG B;  4WU9 D;  4WU8 A;  5B1M B;  1HQ3 B;  4WNN A;  5B0Z C;  4H9Q A;  1F66 A;  5AY8 A;  4WJ3 C;  1KX4 C;  3UT9 D;  3MGR D;  3AZJ B;  1P3I B;  4H9P A;  4UUZ A;  1TAF B;  3AZN B;  5AV9 A;  2HIO D;  1P3O A;  3MGS B;  5DNM A;  3LEL B;  2IO5 B;  4CSR B;  3AZE A;  3WKJ A;  3W98 A;  2YFV A;  1U35 A;  5B0Y B;  5B0Y C;  3AV1 B;  4NFT A;  2Y2Q A;  3KUY D;  1H3O B;  3KXB D;  4JJN C;  3AZG B;  3AZG C;  3O62 C;  2FJ7 A;  3UTA D;  4KUD D;  1P3G A;  2Y2K A;  4R8P D;  5KDM A;  5B2I B;  3X1U B;  3B6G C;  3MVD B;  2HUE B;  3AZI C;  5AV6 A;  3AN2 D;  3VH6 T;  2Y2H A;  1EQZ A;  3LJA D;  3X1V D;  5AV5 D;  1P3M B;  3W96 D;  3AZF A;  4J8W B;  1AOI C;  4Z5T D;  2CWE A;  4ZUX A;  4Z66 D;  1P3K A;  3LZ1 A;  1KX3 C;  4H9R A;  5B32 D;  4WU8 B;  4WNN B;  3X1T C;  2ZY5 A;  3VH6 A;  5AVC D;  3AL0 C;  5CP6 D;  5AY8 B;  3REI A;  1TZY C;  3AFA D;  3AZK C;  1F66 B;  2YFW A;  1S32 D;  4LD9 B;  3C1C A;  4H9P B;  4UUZ B;  2Y2N A;  5AV9 B;  1P3O B;  1M18 B;  1WWS A;  5DNM B;  3UTB D;  4HGA C;  3AZE B;  3WAA A;  3WKJ B;  3W98 B;  3MGQ C;  2Y2O A;  5F99 D;  3AZH C;  2YFV B;  2NZD D;  5GT3 A;  4KGC C;  2Y2J A;  5B33 D;  5B24 B;  4YS3 D;  5AV8 A;  1P34 C;  5B24 C;  3W97 C;  5CPI D;  5BS7 C;  3W99 D;  2FJ7 B;  1JFI A;  5CPK B;  1ID3 A;  4J8X C;  5B1M D;  1P3G B;  2RVQ C;  4H9S C;  3A6N D;  5KDM B;  3KFU G;  3R45 A;  1P3P D;  1EQZ B;  4J8V C;  3AZF B;  5JRG C;  5E5A A;  2Y2G A;  5GT0 A;  1P3K B;  3KWQ C;  5DNN B;  5CPJ D;  1M1A C;  5DNN C;  3X1S A;  1P3L C;  3C1B C;  3WTP A;  3REI B;  2YFW B;  3WA9 C;  3C1C B;  5B0Z A;  3X1U D;  1KX4 A;  3B0D C;  2PYO C;  4XZQ D;  3AV2 D;  5BNV A;  1T3U A;  1ULY A;  4XUJ B;  2HIO C;  4XUJ C;  5GT3 B;  1P3A B;  3REL B;  1P3A C;  3LZ0 D;  3REL C;  1ZLA D;  1B67 A;  3LEL A;  1B6W A;  5B31 D;  4G91 C;  1P3F C;  5B0Y A;  2CV5 D;  4Z2M H;  1R4V A;  3KXB C;  3REK D;  4JJN A;  2BG1 A;  3UTA C;  3AZG A;  3O62 A;  3R45 B;  4R8P C;  3B6G A;  5B40 B;  2XD1 A;  5E5A B;  5B40 C;  3AZI A;  3AN2 C;  5GT0 B;  2UWX A;  3AZE D;  3W98 D;  5B1L B;  3WKJ D;  3X1V C;  5AV5 C;  5B1L C;  3WTP E;  1U35 D;  2ZY4 A;  3EG5 B;  3REH C;  4Z5T C;  3MNN C;  4YM6 D;  3WTP B;  1BH8 A;  5B32 C;  5GXQ C;  3X1T A;  5B0Z B;  5AVC C;  5CP6 C;  1P3B B;  1P3B C;  1TZY A;  3AZK A;  1KX4 B;  4CAY A;  2DF4 C;  5BNV B;  5AV6 D;  4LD9 A;  1EQZ D;  3B6F C;  1Z2C B;  1M18 A;  4ZUX D;  2NZD C;  2F8N K;  3MGQ A;  3AZH A;  3V9R A;  1KX5 D;  5GSU B; 
#chains in the Genus database with same CATH homology
 4KGC A;  5GSU C;  5C3I C;  3W97 A;  1P34 A;  5CPI C;  5B24 A;  4JJN B;  3W99 C;  5BS7 A;  3MGP D;  3O62 B;  3AZM C;  3C1C D;  4J8X A;  5CPK A;  3VH5 W;  4H9S A;  4H9N B;  3A6N C;  4X23 C;  3B6G B;  4QLC D;  3AZI B;  4G92 C;  2F8N A;  1P3P C;  3WAA D;  1M19 C;  5AVB D;  4J8V A;  5JRG A;  1AOI B;  5BNX B;  5AV8 D;  3KWQ A;  1M1A A;  1BH8 B;  5DNN A;  1KX3 B;  1ID3 D;  2L5A A;  3X1T B;  1P3L A;  3C1B A;  1TZY B;  3AZK B;  3WA9 A;  2F2A C;  4CAY B;  2ARO D;  4H9O A;  3REJ D;  4XZQ C;  3AV2 C;  5E5A D;  2PYO A;  4HGA B;  3AYW B;  3AYW C;  3AZL D;  3MGQ B;  3TU4 D;  3AZH B;  4M6B A;  3V9R B;  4XUJ A;  4KGC B;  1P3A A;  1ZLA C;  3X1S D;  3REL A;  2Y2M A;  1P34 B;  3W97 B;  2CV5 C;  1P3F A;  2FFF B;  4J8X B;  5BT1 D;  3LZ1 D;  1HQ3 D;  3KXB A;  3REK C;  3UTA A;  1KX4 D;  2F8N B;  3AZJ D;  4DQY B;  4R8P A;  1P3I D;  3H0M C;  4J8V B;  3AZN D;  5JRG B;  5B2J C;  5B40 A;  3AN2 A;  3NQU B;  3MGS D;  3H0L C;  2NQB B;  2NQB C;  3F6T A;  1N1J B;  3KWQ B;  3LEL D;  1U35 C;  5AV5 A;  5B1L A;  1M1A B;  5B0Y D;  3REH A;  4Z5T A;  3MNN A;  3AV1 D;  4YM6 C;  1P3L B;  3C1B B;  4J8U C;  3WA9 B;  4WU9 C;  5B32 A;  3AZG D;  3O62 D;  5GXQ A;  2F8N G;  5CP6 A;  1P3B A;  4H9O B;  3B6G D;  3MGR B;  5B2I D;  3UT9 C;  3MGR C;  3B0D B;  5AV6 C;  3MVD D;  1WWI A;  2PYO B;  2HIO B;  3B6F A;  1HTA A;  1P3M D;  4NE6 A;  4J8W D;  1F1E A;  2NZD A;  1KX5 C;  4G91 B;  1P3F B;  3B0C W;  5GSU A;  4AWL C;  4WU8 D;  3KXB B;  3KUY C;  4ZBJ C;  5CPI A;  1TZY D;  3MGP C;  5AY8 D;  1F66 D;  3UTA B;  3W99 A;  3AZM A;  4KUD C;  2XD5 A;  4LD9 D;  3A6N A;  4R8P B;  4H9N A;  4X23 A;  4QLC C;  5AV9 D;  1P3O D;  1M18 D;  1BH9 A;  3AN2 B;  5DNM D;  5AVB C;  1P3P A;  1M19 A;  3MGQ D;  5AV5 B;  3LJA C;  3X1V B;  3AZH D;  3W96 C;  3REH B;  4Z5T B;  3MNN B;  5AV8 C;  4Z66 C;  1AOI A;  5BNX A;  5B24 D;  5B32 B;  4NE3 A;  1KX3 A;  5GXQ B;  2LY8 A;  2FJ7 D;  5CPK D;  5AVC B;  5CP6 B;  1P3G D;  4DRA A;  3AFA B;  3AFA C;  1S32 C;  2ARO C;  3B6F B;  2JCH A;  3REJ C;  5JRG D;  3AZF D;  4XZQ A;  3UTB C;  3AV2 A;  4DRB A;  3AZL C;  3TU4 C;  3AYW A;  2NZD B;  5F99 C;  3KWQ D;  1P3K D;  5DNN D;  4Z2M G;  3X1S C;  5B32 G;  5B33 C;  3P5J B;  4YS3 C;  5C3I B;  5CPI B;  4EO5 C;  3REI D;  3W99 B;  3VH6 W;  2CV5 A;  3AZM B;  3WA9 D;  5BT1 C;  2JE5 A;  5B1M C;  1HQ3 C;  3A6N B;  3REK A;  4X23 B;  2ZM5 A;  2BYK A;  1BH9 B;  4G92 B;  3AZJ C;  2PYO D;  1P3P B;  1P3I C;  1M19 B;  2J8P A;  2Y2L A;  3AZN C;  4XUJ D;  2G5H C;  5GT3 D;  1P3A D;  3MGS C;  5B2J A;  3REL D;  5JA4 B;  4WV4 B;  2IO5 C;  3NQU A;  3LEL C;  2NQB A;  5CPJ B;  1N1J A;  5CPJ C;  1P3F D;  3AV1 C;  4UPK A;  3H0R C;  4YM6 A;  4J8U A;  4WU9 A;  1PZR A;  5G49 A;  1W2E A;  4KHA A;  5B2I C;  3X1U C;  3MVD C;  2W8S A;  2HUE C;  4XZQ B;  3MGR A;  3UT9 A;  5B40 D;  3AV2 B;  2DQN C;  5GT0 D;  2HIO A;  5B1L D;  3VH5 T;  1P3M C;  2JSS A;  3LZ0 B;  1ZLA B;  3REH D;  3LZ0 C;  4J8W C;  3MNN D;  5B31 B;  5B31 C;  1KX5 A;  4E45 A;  3WTP D;  2CV5 B;  2VQR A;  3EPK A;  4WU8 C;  5GXQ D;  4H9Q B;  3REK B;  5B0Z D;  3KUY A;  1P3B D;  5AY8 C;  1F66 C;  2BYK B;  3MGP A;  3VH5 A;  4KUD A;  4LD9 C;  3KSY A;  2RIQ A;  5AV9 C;  1P3O C;  2F8N H;  4WZS B;  1M18 C;  3B6F D;  4QLC A;  5B2J B;  5DNM C;  2ZY2 A;  3AZE C;  5AVB A;  3W98 C;  3WKJ C;  1U35 B;  5B31 G;  1KU5 A;  3LJA A;  3X1V A;  3W96 A;  5GSU D;  4YM6 B;  4Z66 A;  4J8U B;  3EPL A;  4JJN D;  4WU9 B;  3AZM D;  2FJ7 C;  5CPK C;  3A1I A;  3FDD A;  3A1K A;  1P3G C;  5G49 B;  5AVC A;  4KHA B;  4X23 D;  3AFA A;  3UT9 B;  1S32 A;  5AV6 B;  3AZI D;  1M19 D;  1Q9C A;  2ARO A;  1EQZ C;  3AZF C;  3REJ A;  4NE5 A;  3UTB A;  4ZUX B;  3AZL A;  4ZUX C;  3TU4 A;  1AOI D;  1P3K C;  5F99 A;  1KX5 B;  3LZ1 B;  3LZ1 C;  4H9R B;  5BO0 A;  1KX3 D;  2BYM A;  4AWL B;  5B33 A;  3NQJ A;  4YS3 A;  3X1T D;  3KUY B;  4ZBJ B;  3REI C;  1A7W A;  3MGP B;  3AZK D;  5FUG A;  4KUD B;  2Y2P A;  2G5I C;  3C1C C;  5B1M A;  1HQ3 A;  2ZY3 A;  4QLC B;  1BFM A;  3WAA B;  3AZJ A;  3WAA C;  5AVB B;  3AYW D;  1P3I A;  1TAF A;  3LJA B;  3AZN A;  5GT3 C;  3W96 B;  4KGC D;  3MGS A;  5AV8 B;  4Z66 B;  4CSR A;  5JA4 A;  1P34 D;  3W97 D;  5CPJ A;  1JFI B;  1ID3 B;  3AV1 A;  1ID3 C;  3IP4 C;  2Y2I A;  4J8X D;  4E44 A;  3B0B A;  2RVQ D;  1H3O A;  1S32 B;  2F8N D;  2ARO B;  3B0C T;  5B2I A;  3X1U A;  3REJ B;  3EPJ A;  3MVD A;  4J8V D;  5E5A C;  3UTB B;  5B2J D;  3AZL B;  3TU4 B;  5GT0 C;  2NQB D;  5F99 B;  1P3M A;  5BO0 B;  1M1A D;  3X1S B;  2BYM B;  3LZ0 A;  4J8W A;  5B33 B;  1ZLA A;  3NQJ B;  4YS3 B;  3EPH A;  3WTP C;  5B31 A;  5CHL B;  4EO5 B;  3C1B D;  1P3L D;  4J8U D;  5FUG B;  4WU9 D;  4WU8 A;  5B1M B;  1HQ3 B;  4WNN A;  5B0Z C;  4H9Q A;  1F66 A;  5AY8 A;  4WJ3 C;  1KX4 C;  3UT9 D;  3MGR D;  3AZJ B;  1P3I B;  4H9P A;  4UUZ A;  1TAF B;  3AZN B;  5AV9 A;  2HIO D;  1P3O A;  3MGS B;  5DNM A;  3LEL B;  2IO5 B;  4CSR B;  3AZE A;  3WKJ A;  3W98 A;  2YFV A;  1U35 A;  5B0Y B;  5B0Y C;  3AV1 B;  4NFT A;  2Y2Q A;  3KUY D;  1H3O B;  3KXB D;  4JJN C;  3AZG B;  3AZG C;  3O62 C;  2FJ7 A;  3UTA D;  4KUD D;  1P3G A;  2Y2K A;  4R8P D;  5KDM A;  5B2I B;  3X1U B;  3B6G C;  3MVD B;  2HUE B;  3AZI C;  5AV6 A;  3AN2 D;  3VH6 T;  2Y2H A;  1EQZ A;  3LJA D;  3X1V D;  5AV5 D;  1P3M B;  3W96 D;  3AZF A;  4J8W B;  1AOI C;  4Z5T D;  2CWE A;  4ZUX A;  4Z66 D;  1P3K A;  3LZ1 A;  1KX3 C;  4H9R A;  5B32 D;  4WU8 B;  4WNN B;  3X1T C;  2ZY5 A;  3VH6 A;  5AVC D;  3AL0 C;  5CP6 D;  5AY8 B;  3REI A;  1TZY C;  3AFA D;  3AZK C;  1F66 B;  2YFW A;  1S32 D;  4LD9 B;  3C1C A;  4H9P B;  4UUZ B;  2Y2N A;  5AV9 B;  1P3O B;  1M18 B;  1WWS A;  5DNM B;  3UTB D;  4HGA C;  3AZE B;  3WAA A;  3WKJ B;  3W98 B;  3MGQ C;  2Y2O A;  5F99 D;  3AZH C;  2YFV B;  2NZD D;  5GT3 A;  4KGC C;  2Y2J A;  5B33 D;  5B24 B;  4YS3 D;  5AV8 A;  1P34 C;  5B24 C;  3W97 C;  5CPI D;  5BS7 C;  3W99 D;  2FJ7 B;  1JFI A;  5CPK B;  1ID3 A;  4J8X C;  5B1M D;  1P3G B;  2RVQ C;  4H9S C;  3A6N D;  5KDM B;  3KFU G;  3R45 A;  1P3P D;  1EQZ B;  4J8V C;  3AZF B;  5JRG C;  5E5A A;  2Y2G A;  5GT0 A;  1P3K B;  3KWQ C;  5DNN B;  5CPJ D;  1M1A C;  5DNN C;  3X1S A;  1P3L C;  3C1B C;  3WTP A;  3REI B;  2YFW B;  3WA9 C;  3C1C B;  5B0Z A;  3X1U D;  1KX4 A;  3B0D C;  2PYO C;  4XZQ D;  3AV2 D;  5BNV A;  1T3U A;  1ULY A;  4XUJ B;  2HIO C;  4XUJ C;  5GT3 B;  1P3A B;  3REL B;  1P3A C;  3LZ0 D;  3REL C;  1ZLA D;  1B67 A;  3LEL A;  1B6W A;  5B31 D;  4G91 C;  1P3F C;  5B0Y A;  2CV5 D;  4Z2M H;  1R4V A;  3KXB C;  3REK D;  4JJN A;  2BG1 A;  3UTA C;  3AZG A;  3O62 A;  3R45 B;  4R8P C;  3B6G A;  5B40 B;  2XD1 A;  5E5A B;  5B40 C;  3AZI A;  3AN2 C;  5GT0 B;  2UWX A;  3AZE D;  3W98 D;  5B1L B;  3WKJ D;  3X1V C;  5AV5 C;  5B1L C;  3WTP E;  1U35 D;  2ZY4 A;  3EG5 B;  3REH C;  4Z5T C;  3MNN C;  4YM6 D;  3WTP B;  1BH8 A;  5B32 C;  5GXQ C;  3X1T A;  5B0Z B;  5AVC C;  5CP6 C;  1P3B B;  1P3B C;  1TZY A;  3AZK A;  1KX4 B;  4CAY A;  2DF4 C;  5BNV B;  5AV6 D;  4LD9 A;  1EQZ D;  3B6F C;  1Z2C B;  1M18 A;  4ZUX D;  2NZD C;  2F8N K;  3MGQ A;  3AZH A;  3V9R A;  1KX5 D;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...