3W97D

Crystal structure of human nucleosome core particle lacking h2b n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w97D00
4HGAC 3AV2A 5B40A 4CSRA 4Z5TB 5B33C 3B0DB 1P3GC 1P3LC 5AV6C 4J8WA 3AFAD 3MGSB 3AZGD 3KXBD 3AZJB 5DNNA 1P34A 4AWLC 4KGCB 2HIOD 1P3OC 3AV1B 5GT3B 5E5AA 5AY8C 1U35B 5BS7C 1ULYA 5AVBA 1P3PA 1KX4A 3W96D 4KHAB 5JRGC 3V9RB 2F8ND 3X1TC 5B0YD 2NZDC 5B32C 1N1JB 2LY8A 3O62C 3B6GA 1P3KA 3B6FC 5AV5C 1KX3A 1ID3D 5B0ZC 3LELB 3AZGB 3AZNC 1M18D 5B31D 4YM6D 5BT1D 5B1LA 5B24C 4J8XD 3MGQB 4J8UA 2HIOB 5FUGA 5AV9A 4DRAA 3AZHC 2F8NH 3W96B 5DNMD 5B2ID 1F1EA 1WWSA 1S32A 3LJAA 3A6NA 3AZFC 4Z5TC 3X1VA 1P3FD 2HUEC 1ID3B 1P3IB 1P3BC 1M18B 3AZMC 5B31B 3REIC 3WA9A 2CV5C 4XZQD 3REKA 3WAAD 4H9PA 4KGCC 5GT0D 3LZ0D 4G92B 2YFVB 1P3GA 1M1AD 3MGPB 2JSSA 5B33D 1P3FB 3AZKA 1P3LD 1KX5A 3MGRB 2FJ7C 1P3MA 3AFAC 5AVCB 4XZQB 3AZGC 5CPKD 4QLCA 3C1BD 4UUZB 3KXBC 1P3OD 5AY8D 1F66A 3UTAB 5GXQA 4HGAB 4NFTA 5GT0B 4E45A 3O62A 5CPJA 4X23D 3WTPD 3VH6A 4KUDD 3X1TD 2NZDD 1HTAA 5AV5A 5B0YC 5B33B 3AYWA 1HQ3D 4WNNA 1P3AA 1P3LB 4LD9A 1M19A 4ZUXA 3B6FD 5AV6B 5B24A 3WKJA 5B32G 1ID3C 5CP6A 4JJNC 3AZHA 5CPKB 3C1BB 4YM6C 5B31C 5BT1C 4AWLB 1P3OB 4J8XC 5AY8B 4WU9D 3B0BA 5JRGB 3AZED 5B1MD 5DNMC 5B2IC 4Z5TA 5B32B 3X1TB 4KUDB 2BYMB 3KWQD 2NZDB 4G92C 5C3IC 1HQ3B 3NQUB 3B6FB 5CPID 3C1CD 1R4VA 3MGSA 5B0ZB 5F99C 3X1SD 4J8VD 3AZNB 1P3BD 3REID 3AZID 3AZJA 4KGCA 4H9SC 2CV5D 3AN2D 5GT3A 1B6WA 3AV1A 1U35A 1TZYD 3WAAC 1AOIC 4WU9B 2PYOC 4KHAA 3V9RA 5B2JD 1N1JA 3UTBD 5GT0C 3LZ0C 3KWQB 3W98D 3AZFB 3KUYD 1M1AC 1TAFA 2NQBD 2HUEB 5JA4B 3LELA 3TU4D 3AZGA 3X1SB 4J8VB 4H9QB 1P3BB 2FJ7D 3AZMB 3REHD 3REIB 4YS3A 3MGQA 2HIOA 2CV5B 3AN2B 1TZYB 5CPKC 3C1BC 4R8PD 3W96A 1EQZD 3W99C 1BH8B 4EO5C 3UTBB 3LZ1D 4X23C 3WTPC 1WWIA 3KUYB 4KUDC 4CAYB 1ID3A 1P3IA 1HQ3C 3X1UD 1M18A 2FJ7B 5B31A 2F8NG 4Z66C 3AFAB 4JJND 3KXBB 4R8PB 4J8WD 1EQZB 2YFVA 4WU9C 1H3OB 5DNND 4M6BA 1P34D 2F8NB 5B31G 3MGPA 1A7WA 5B1MC 3AZEC 4NE5A 5B0YB 3AZLC 1P3FA 3KWQC 5AVBD 1KX4D 1P3PD 3MGRA 3UT9D 3X1UB 4ZBJB 3NQJB 3W97D 5CPIC 4WV4B 5F99D 3KSYA 5AVCA 4XZQA 3C1CC 1P3KD 3X1SC 4J8VC 4UUZA 4JJNB 4YM6B 3AZIC 4J8XB 1KX3D 2AROC 3UTAA 3AN2C 5GT0A 1AOID 4H9RB 1TZYC 2PYOD 4G91B 5DNMB 4XUJD 5B2IB 5B2JC 5B33A 3UTBC 3W98C 5C3IB 1P3LA 4Z2MH 3UT9B 3KUYC 5AV6A 3REJC 2NQBC 1BH9B 5AV8C 3W97B 5F99B 5BO0B 3TU4C 3A6ND 5CPKA 3C1BA 3REHC 1P3OA 5AY8A 2RVQD 5BS7A 4WU8C 3WAAB 1AOIB 2YFWB 2PYOB 3W99D 4R8PC 5JRGA 3WA9D 4KUDA 2IO5B 3X1TA 1EQZC 2L5AA 5B32A 4XUJB 2BYMA 2NZDA 3LZ0B 3REKD 3LZ1C 1HQ3A 1M1AB 3NQUA 3B6FA 5BNXB 5B0ZA 3AV2C 4H9NB 3AZNA 3X1UC 1ZLAD 4ZBJC 3A6NB 4Z66D 3AZKD 4WU9A 1P3MD 3W99B 4J8WC 5BNVB 3WA9B 3MVDD 4EO5B 3VH6W 3VH5A 4QLCD 4G91C 4X23B 3WTPB 3AZFA 5DNNC 1P34C 3AZLD 1F66D 5E5AC 5JA4A 2BYKB 5AVBC 1KX4C 1P3PC 3X1SA 4J8VA 4H9QA 3UT9C 1P3BA 3AZMA 3REIA 1ZLAB 4Z66B 2CV5A 3W97C 3AN2A 4WZSB 3B6GC 1TZYA 1P3KC 4LD9D 1BFMA 4NE3A 2AROD 3WKJD 1BH8A 3MNND 3VH5W 1KX3C 3MVDB 3UTBA 3KUYA 2IO5C 5B1LC 5B1MB 4CAYA 4XUJC 4J8UC 3AZEB 3AZLB 1KU5A 3R45B 3REJD 3RELD 2FJ7A 5AV8D 3AFAA 5CPIB 3C1CB 1S32C 3KXBA 5GSUD 3LJAC 3A6NC 3AZIB 4R8PA 3X1VC 2AROB 3VH6T 5KDMB 3B0CW 3MGSD 4WU8D 2RVQC 3MNNB 1EQZA 1H3OA 2F8NA 5B2JB 3WA9C 3AV1D 5B0YA 4H9OB 3W98B 3REKC 3X1UA 3REJB 3RELB 1JFIB 2NQBB 3NQJA 5AV8B 3AV2D 5B40D 3TU4B 4JJNA 4YM6A 1ZLAC 3VH5T 5GSUB 3REHB 4J8XA 4WU8B 3AZKC 4H9RA 3LELD 1KX5C 4YS3D 5DNMA 5B2IA 5G49B 3MGQD 1P3MC 3MVDC 3LZ1B 4QLCC 3UT9A 5E5AD 1BH9A 1F66C 3W97A 5GXQC 3AV2B 5F99A 5CPJC 5B40B 5BO0A 4CSRB 3B0CT 4H9SA 1TAFB 4DRBA 3AYWC 1P3ID 3B6GD 3WAAA 1AOIA 1P3AC 2YFWA 2PYOA 4LD9C 1M19C 4ZUXC 4J8WB 4YS3B 3WKJC 4XUJA 4Z2MG 3MNNC 3LZ0A 5CP6C 5B1LD 1M1AA 5DNNB 1P34B 4J8UD 5BNXA 5E5AB 5AVBB 5AV9D 1P3PB 1KX4B 4H9NA 3RELC 3MGPD 1S32D 3B6GB 1P3KB 3LJAD 3MGRD 3B0DC 2CWEA 5GSUC 3X1VD 3W99A 5BNVA 1KX3B 5AVCD 3MGSC 4X23A 3WTPA 3AZJC 5B1LB 4J8UB 3UTAD 3AV1C 5GT3C 1U35C 2BYKA 5FUGB 5AV9B 1ZLAA 4Z66A 5B40C 1S32B 1P3GD 3LJAB 5AV6D 3X1VB 4NE6A 3MVDA 1KX5D 3LELC 4YS3C 3AZEA 5B1MA 3MGQC 3AZLA 2HIOC 3KWQA 4E44A 3REKB 3R45A 4H9PB 5JRGD 3W96C 2F8NK 5B32D 5GXQD 5CPIA 5CPJD 3C1CA 3O62D 1P3GB 3AZIA 5AV5D 2AROA 5KDMA 3AYWD 5B0ZD 3MNNA 3AZKB 1P3IC 1P3AD 1KX5B 3AZND 1Q9CA 1M19D 4ZUXD 5B24D 1M18C 1P3MB 5B2JA 4H9OA 3WTPE 3W98A 5CP6D 3AZHD 4QLCB 1B67A 3REJA 3RELA 1JFIA 2NQBA 1F66B 5AV8A 5GXQB 5CPJB 3O62B 5AV9C 3TU4A 3AZFD 5GSUA 4Z5TD 3REHA 3MGPC 5AV5B 5CHLB 4WU8A 3AYWB 1P3FC 4WNNB 1P3AB 4LD9B 3MGRC 1M19B 3AZMD 4ZUXB 5B24B 5G49A 3WKJB 5AVCC 4XZQC 3LZ1A 3AZJD 5CP6B 3AZHB 4KGCD 1U35D 5GT3D 3UTAC
chains in the Genus database with same CATH superfamily
4HGAC 3AV2A 5B40A 4CSRA 1Z2CB 4Z5TB 5B33C 3B0DB 1P3GC 1P3LC 5AV6C 4J8WA 3AFAD 3MGSB 3AZGD 3KXBD 3AZJB 5DNNA 1P34A 4AWLC 4KGCB 2HIOD 1P3OC 3AV1B 5GT3B 2VQRA 5AY8C 5E5AA 5BS7C 3IP4C 1U35B 1ULYA 5AVBA 1P3PA 1KX4A 3W96D 4KHAB 5JRGC 3V9RB 2F8ND 3X1TC 5B0YD 2NZDC 5B32C 1N1JB 2LY8A 3O62C 3B6GA 1P3KA 3B6FC 5AV5C 1KX3A 1ID3D 2RIQA 5B0ZC 2Y2OA 3LELB 3AZGB 3AZNC 1M18D 5B31D 4YM6D 5BT1D 5B1LA 5B24C 4J8XD 3MGQB 4J8UA 2HIOB 5FUGA 3P5JB 5AV9A 4DRAA 3AZHC 2F8NH 3W96B 5DNMD 5B2ID 2Y2HA 1F1EA 1WWSA 1S32A 3LJAA 3A6NA 3AZFC 4Z5TC 3X1VA 1P3FD 2HUEC 1ID3B 1P3IB 2ZM5A 1P3BC 1M18B 3AZMC 5B31B 3REIC 3WA9A 2CV5C 4XZQD 3REKA 3WAAD 4H9PA 4KGCC 5GT0D 3LZ0D 4G92B 2YFVB 1P3GA 1M1AD 3H0MC 3MGPB 2JSSA 5B33D 1P3FB 3AZKA 1P3LD 1KX5A 3MGRB 2FJ7C 1P3MA 3AFAC 5AVCB 4XZQB 3AZGC 5CPKD 4QLCA 3C1BD 4UUZB 3KXBC 1P3OD 5AY8D 1F66A 3UTAB 5GXQA 4HGAB 4NFTA 5GT0B 4E45A 3O62A 5CPJA 4X23D 3WTPD 3VH6A 4KUDD 3X1TD 2NZDD 1HTAA 5AV5A 5B0YC 2ZY2A 5B33B 3AYWA 1HQ3D 4WNNA 1P3AA 1P3LB 4LD9A 1M19A 4ZUXA 3B6FD 5AV6B 5B24A 3WKJA 5B32G 1ID3C 5CP6A 4JJNC 3AZHA 5CPKB 3C1BB 5B31C 4YM6C 5BT1C 4AWLB 1P3OB 4J8XC 5AY8B 3EPHA 4WU9D 3B0BA 5JRGB 3AZED 5B1MD 5DNMC 5B2IC 4Z5TA 5B32B 3X1TB 4KUDB 2BYMB 3KWQD 3KFUG 2NZDB 4G92C 5C3IC 1HQ3B 3FDDA 3NQUB 3B6FB 5CPID 3C1CD 1R4VA 3MGSA 5B0ZB 5F99C 3X1SD 4J8VD 3AZNB 1P3BD 3REID 3AZID 3AZJA 4KGCA 4H9SC 2CV5D 3AN2D 5GT3A 1B6WA 3AV1A 1U35A 4WJ3C 1TZYD 3WAAC 1AOIC 4WU9B 2PYOC 4KHAA 3V9RA 5B2JD 1N1JA 3UTBD 5GT0C 3LZ0C 3KWQB 3W98D 3AZFB 3KUYD 1M1AC 1TAFA 2NQBD 2HUEB 5JA4B 3LELA 3TU4D 3AZGA 3X1SB 4J8VB 4H9QB 1P3BB 2FJ7D 3AZMB 3REHD 3REIB 4YS3A 3MGQA 2HIOA 2CV5B 3AN2B 1TZYB 5CPKC 3C1BC 4R8PD 3W96A 1EQZD 3W99C 1BH8B 4EO5C 3UTBB 3LZ1D 4X23C 3WTPC 1WWIA 3KUYB 4KUDC 4CAYB 1ID3A 1P3IA 1HQ3C 3X1UD 2JCHA 1M18A 2FJ7B 5B31A 3A1KA 2F8NG 4Z66C 3AFAB 2G5HC 1EQZA 4JJND 2XD5A 3KXBB 2J8PA 4R8PB 4J8WD 1EQZB 2YFVA 4WU9C 1H3OB 5DNND 4M6BA 1P34D 2F8NB 5B31G 3MGPA 1A7WA 5B1MC 3AZEC 4NE5A 5B0YB 3AZLC 1P3FA 3KWQC 5AVBD 1KX4D 1P3PD 3F6TA 3MGRA 3UT9D 3X1UB 4ZBJB 3NQJB 3W97D 5CPIC 4WV4B 5F99D 3KSYA 5AVCA 4XZQA 3C1CC 2G5IC 1P3KD 3X1SC 4J8VC 4UUZA 4JJNB 4YM6B 3AZIC 4J8XB 1KX3D 2AROC 3UTAA 3AN2C 5GT0A 1AOID 4H9RB 1TZYC 2PYOD 4G91B 5DNMB 4XUJD 5B2IB 5B2JC 5B33A 3UTBC 3W98C 5C3IB 1P3LA 4Z2MH 3UT9B 3KUYC 5AV6A 3REJC 3EPLA 2NQBC 1BH9B 5AV8C 3W97B 3AL0C 5F99B 5BO0B 3TU4C 4UPKA 3A6ND 5CPKA 3C1BA 3EPKA 3REHC 1P3OA 5AY8A 2RVQD 5BS7A 4WU8C 3WAAB 1AOIB 2YFWB 2PYOB 3W99D 4R8PC 5JRGA 3WA9D 4KUDA 2IO5B 3X1TA 1EQZC 2L5AA 5B32A 4XUJB 2BYMA 2NZDA 3LZ0B 3REKD 3LZ1C 1HQ3A 1M1AB 3NQUA 3B6FA 5BNXB 2DF4C 5B0ZA 3AV2C 4H9NB 3AZNA 3X1UC 1ZLAD 4ZBJC 3A6NB 4Z66D 2Y2LA 3AZKD 4WU9A 1P3MD 3W99B 4J8WC 5BNVB 3WA9B 3MVDD 4EO5B 1T3UA 3VH6W 2DQNC 3VH5A 4QLCD 4G91C 4X23B 3WTPB 3AZFA 5DNNC 1P34C 3AZLD 1F66D 5E5AC 5JA4A 2BYKB 5AVBC 1KX4C 1P3PC 3X1SA 4J8VA 4H9QA 3UT9C 1P3BA 3AZMA 3REIA 1ZLAB 4Z66B 2CV5A 3W97C 3AN2A 4WZSB 3B6GC 1TZYA 1P3KC 4LD9D 1BFMA 4NE3A 2AROD 3WKJD 1BH8A 3MNND 3VH5W 1KX3C 3MVDB 3UTBA 3KUYA 2IO5C 5B1LC 5B1MB 4CAYA 4XUJC 4J8UC 3AZEB 3AZLB 2Y2IA 3A1IA 1KU5A 3R45B 3REJD 3RELD 2FJ7A 2Y2MA 5AV8D 3AFAA 5CPIB 3C1CB 1S32C 3KXBA 5GSUD 3LJAC 3A6NC 3AZIB 4R8PA 3X1VC 2AROB 5KDMB 3VH6T 3B0CW 3MGSD 2Y2QA 2RVQC 3MNNB 4WU8D 2Y2GA 1H3OA 2F8NA 5B2JB 3WA9C 3AV1D 5B0YA 4H9OB 3W98B 3REKC 2JE5A 2FFFB 3X1UA 2XD1A 3REJB 3RELB 2Y2KA 4DQYB 3NQJA 1JFIB 5AV8B 2NQBB 3AV2D 5B40D 3TU4B 4JJNA 4YM6A 1ZLAC 3VH5T 5GSUB 3REHB 4J8XA 4WU8B 2ZY5A 3AZKC 4H9RA 3LELD 1KX5C 4YS3D 5DNMA 5B2IA 5G49B 3MGQD 1P3MC 3MVDC 3LZ1B 4QLCC 3UT9A 5E5AD 1BH9A 1F66C 3W97A 5GXQC 3AV2B 5F99A 5CPJC 5B40B 5BO0A 2ZY4A 4CSRB 3B0CT 4H9SA 1TAFB 4DRBA 3AYWC 1P3ID 3B6GD 3WAAA 1AOIA 1P3AC 2YFWA 2PYOA 4LD9C 1M19C 4ZUXC 4J8WB 4YS3B 3WKJC 4XUJA 4Z2MG 3MNNC 3LZ0A 2BG1A 2ZY3A 5CP6C 5B1LD 1M1AA 5DNNB 1P34B 4J8UD 5BNXA 5E5AB 2UWXA 5AVBB 5AV9D 1P3PB 1KX4B 4H9NA 3RELC 3MGPD 3EPJA 1S32D 3B6GB 1P3KB 3LJAD 3MGRD 3B0DC 2CWEA 5GSUC 3X1VD 3W99A 5BNVA 1KX3B 5AVCD 3MGSC 4X23A 3WTPA 3AZJC 5B1LB 4J8UB 3UTAD 1W2EA 5GT3C 3AV1C 1U35C 2BYKA 5FUGB 5AV9B 3H0LC 2W8SA 1ZLAA 4Z66A 3H0RC 5B40C 1S32B 1P3GD 3LJAB 2Y2JA 5AV6D 3X1VB 4NE6A 3MVDA 1KX5D 3LELC 4YS3C 3AZEA 5B1MA 3MGQC 3AZLA 2HIOC 2F2AC 3KWQA 4E44A 3REKB 3R45A 4H9PB 5JRGD 3W96C 2F8NK 5B32D 5GXQD 5CPIA 5CPJD 3C1CA 3O62D 1P3GB 3AZIA 2Y2PA 3EG5B 5AV5D 2AROA 5KDMA 3AYWD 5B0ZD 3MNNA 3AZKB 1P3IC 1P3AD 1KX5B 3AZND 1Q9CA 1M19D 4ZUXD 5B24D 1M18C 1P3MB 5B2JA 4H9OA 3WTPE 3W98A 5CP6D 3AZHD 4QLCB 1B67A 3REJA 3RELA 1JFIA 2NQBA 1F66B 5AV8A 5GXQB 5CPJB 3O62B 5AV9C 3TU4A 3AZFD 5GSUA 4Z5TD 3REHA 3MGPC 5AV5B 5CHLB 4WU8A 3AYWB 1P3FC 4WNNB 1P3AB 4LD9B 3MGRC 1M19B 3AZMD 2Y2NA 4ZUXB 5B24B 5G49A 3WKJB 1PZRA 5AVCC 4XZQC 3LZ1A 3AZJD 5CP6B 3AZHB 4KGCD 1U35D 5GT3D 3UTAC
chains in the Genus database with same CATH topology
4HGAC 3AV2A 5B40A 4CSRA 1Z2CB 4Z5TB 5B33C 3B0DB 1P3GC 1P3LC 5AV6C 4J8WA 3AFAD 3MGSB 3AZGD 3KXBD 3AZJB 5DNNA 1P34A 4AWLC 4KGCB 2HIOD 1P3OC 3AV1B 5GT3B 2VQRA 5AY8C 5E5AA 5BS7C 3IP4C 1U35B 1ULYA 5AVBA 1P3PA 1KX4A 3W96D 4KHAB 5JRGC 3V9RB 2F8ND 3X1TC 5B0YD 2NZDC 5B32C 1N1JB 2LY8A 3O62C 3B6GA 1P3KA 3B6FC 5AV5C 1KX3A 1ID3D 2RIQA 5B0ZC 2Y2OA 3LELB 3AZGB 3AZNC 1M18D 5B31D 4YM6D 5BT1D 5B1LA 5B24C 4J8XD 3MGQB 4J8UA 2HIOB 5FUGA 3P5JB 5AV9A 4DRAA 3AZHC 2F8NH 3W96B 5DNMD 5B2ID 2Y2HA 1F1EA 1WWSA 1S32A 3LJAA 3A6NA 3AZFC 4Z5TC 3X1VA 1P3FD 2HUEC 1ID3B 1P3IB 2ZM5A 1P3BC 1M18B 3AZMC 5B31B 3REIC 3WA9A 2CV5C 4XZQD 3REKA 3WAAD 4H9PA 4KGCC 5GT0D 3LZ0D 4G92B 2YFVB 1P3GA 1M1AD 3H0MC 3MGPB 2JSSA 5B33D 1P3FB 3AZKA 1P3LD 1KX5A 3MGRB 2FJ7C 1P3MA 3AFAC 5AVCB 4XZQB 3AZGC 5CPKD 4QLCA 3C1BD 4UUZB 3KXBC 1P3OD 5AY8D 1F66A 3UTAB 5GXQA 4HGAB 4NFTA 5GT0B 4E45A 3O62A 5CPJA 4X23D 3WTPD 3VH6A 4KUDD 3X1TD 2NZDD 1HTAA 5AV5A 5B0YC 2ZY2A 5B33B 3AYWA 1HQ3D 4WNNA 1P3AA 1P3LB 4LD9A 1M19A 4ZUXA 3B6FD 5AV6B 5B24A 3WKJA 5B32G 1ID3C 5CP6A 4JJNC 3AZHA 5CPKB 3C1BB 5B31C 4YM6C 5BT1C 4AWLB 1P3OB 4J8XC 5AY8B 3EPHA 4WU9D 3B0BA 5JRGB 3AZED 5B1MD 5DNMC 5B2IC 4Z5TA 5B32B 3X1TB 4KUDB 2BYMB 3KWQD 3KFUG 2NZDB 4G92C 5C3IC 1HQ3B 3FDDA 3NQUB 3B6FB 5CPID 3C1CD 1R4VA 3MGSA 5B0ZB 5F99C 3X1SD 4J8VD 3AZNB 1P3BD 3REID 3AZID 3AZJA 4KGCA 4H9SC 2CV5D 3AN2D 5GT3A 1B6WA 3AV1A 1U35A 4WJ3C 1TZYD 3WAAC 1AOIC 4WU9B 2PYOC 4KHAA 3V9RA 5B2JD 1N1JA 3UTBD 5GT0C 3LZ0C 3KWQB 3W98D 3AZFB 3KUYD 1M1AC 1TAFA 2NQBD 2HUEB 5JA4B 3LELA 3TU4D 3AZGA 3X1SB 4J8VB 4H9QB 1P3BB 2FJ7D 3AZMB 3REHD 3REIB 4YS3A 3MGQA 2HIOA 2CV5B 3AN2B 1TZYB 5CPKC 3C1BC 4R8PD 3W96A 1EQZD 3W99C 1BH8B 4EO5C 3UTBB 3LZ1D 4X23C 3WTPC 1WWIA 3KUYB 4KUDC 4CAYB 1ID3A 1P3IA 1HQ3C 3X1UD 2JCHA 1M18A 2FJ7B 5B31A 3A1KA 2F8NG 4Z66C 3AFAB 2G5HC 1EQZA 4JJND 2XD5A 3KXBB 2J8PA 4R8PB 4J8WD 1EQZB 2YFVA 4WU9C 1H3OB 5DNND 4M6BA 1P34D 2F8NB 5B31G 3MGPA 1A7WA 5B1MC 3AZEC 4NE5A 5B0YB 3AZLC 1P3FA 3KWQC 5AVBD 1KX4D 1P3PD 3F6TA 3MGRA 3UT9D 3X1UB 4ZBJB 3NQJB 3W97D 5CPIC 4WV4B 5F99D 3KSYA 5AVCA 4XZQA 3C1CC 2G5IC 1P3KD 3X1SC 4J8VC 4UUZA 4JJNB 4YM6B 3AZIC 4J8XB 1KX3D 2AROC 3UTAA 3AN2C 5GT0A 1AOID 4H9RB 1TZYC 2PYOD 4G91B 5DNMB 4XUJD 5B2IB 5B2JC 5B33A 3UTBC 3W98C 5C3IB 1P3LA 4Z2MH 3UT9B 3KUYC 5AV6A 3REJC 3EPLA 2NQBC 1BH9B 5AV8C 3W97B 3AL0C 5F99B 5BO0B 3TU4C 4UPKA 3A6ND 5CPKA 3C1BA 3EPKA 3REHC 1P3OA 5AY8A 2RVQD 5BS7A 4WU8C 3WAAB 1AOIB 2YFWB 2PYOB 3W99D 4R8PC 5JRGA 3WA9D 4KUDA 2IO5B 3X1TA 1EQZC 2L5AA 5B32A 4XUJB 2BYMA 2NZDA 3LZ0B 3REKD 3LZ1C 1HQ3A 1M1AB 3NQUA 3B6FA 5BNXB 2DF4C 5B0ZA 3AV2C 4H9NB 3AZNA 3X1UC 1ZLAD 4ZBJC 3A6NB 4Z66D 2Y2LA 3AZKD 4WU9A 1P3MD 3W99B 4J8WC 5BNVB 3WA9B 3MVDD 4EO5B 1T3UA 3VH6W 2DQNC 3VH5A 4QLCD 4G91C 4X23B 3WTPB 3AZFA 5DNNC 1P34C 3AZLD 1F66D 5E5AC 5JA4A 2BYKB 5AVBC 1KX4C 1P3PC 3X1SA 4J8VA 4H9QA 3UT9C 1P3BA 3AZMA 3REIA 1ZLAB 4Z66B 2CV5A 3W97C 3AN2A 4WZSB 3B6GC 1TZYA 1P3KC 4LD9D 1BFMA 4NE3A 2AROD 3WKJD 1BH8A 3MNND 3VH5W 1KX3C 3MVDB 3UTBA 3KUYA 2IO5C 5B1LC 5B1MB 4CAYA 4XUJC 4J8UC 3AZEB 3AZLB 2Y2IA 3A1IA 1KU5A 3R45B 3REJD 3RELD 2FJ7A 2Y2MA 5AV8D 3AFAA 5CPIB 3C1CB 1S32C 3KXBA 5GSUD 3LJAC 3A6NC 3AZIB 4R8PA 3X1VC 2AROB 5KDMB 3VH6T 3B0CW 3MGSD 2Y2QA 2RVQC 3MNNB 4WU8D 2Y2GA 1H3OA 2F8NA 5B2JB 3WA9C 3AV1D 5B0YA 4H9OB 3W98B 3REKC 2JE5A 2FFFB 3X1UA 2XD1A 3REJB 3RELB 2Y2KA 4DQYB 3NQJA 1JFIB 5AV8B 2NQBB 3AV2D 5B40D 3TU4B 4JJNA 4YM6A 1ZLAC 3VH5T 5GSUB 3REHB 4J8XA 4WU8B 2ZY5A 3AZKC 4H9RA 3LELD 1KX5C 4YS3D 5DNMA 5B2IA 5G49B 3MGQD 1P3MC 3MVDC 3LZ1B 4QLCC 3UT9A 5E5AD 1BH9A 1F66C 3W97A 5GXQC 3AV2B 5F99A 5CPJC 5B40B 5BO0A 2ZY4A 4CSRB 3B0CT 4H9SA 1TAFB 4DRBA 3AYWC 1P3ID 3B6GD 3WAAA 1AOIA 1P3AC 2YFWA 2PYOA 4LD9C 1M19C 4ZUXC 4J8WB 4YS3B 3WKJC 4XUJA 4Z2MG 3MNNC 3LZ0A 2BG1A 2ZY3A 5CP6C 5B1LD 1M1AA 5DNNB 1P34B 4J8UD 5BNXA 5E5AB 2UWXA 5AVBB 5AV9D 1P3PB 1KX4B 4H9NA 3RELC 3MGPD 3EPJA 1S32D 3B6GB 1P3KB 3LJAD 3MGRD 3B0DC 2CWEA 5GSUC 3X1VD 3W99A 5BNVA 1KX3B 5AVCD 3MGSC 4X23A 3WTPA 3AZJC 5B1LB 4J8UB 3UTAD 1W2EA 5GT3C 3AV1C 1U35C 2BYKA 5FUGB 5AV9B 3H0LC 2W8SA 1ZLAA 4Z66A 3H0RC 5B40C 1S32B 1P3GD 3LJAB 2Y2JA 5AV6D 3X1VB 4NE6A 3MVDA 1KX5D 3LELC 4YS3C 3AZEA 5B1MA 3MGQC 3AZLA 2HIOC 2F2AC 3KWQA 4E44A 3REKB 3R45A 4H9PB 5JRGD 3W96C 2F8NK 5B32D 5GXQD 5CPIA 5CPJD 3C1CA 3O62D 1P3GB 3AZIA 2Y2PA 3EG5B 5AV5D 2AROA 5KDMA 3AYWD 5B0ZD 3MNNA 3AZKB 1P3IC 1P3AD 1KX5B 3AZND 1Q9CA 1M19D 4ZUXD 5B24D 1M18C 1P3MB 5B2JA 4H9OA 3WTPE 3W98A 5CP6D 3AZHD 4QLCB 1B67A 3REJA 3RELA 1JFIA 2NQBA 1F66B 5AV8A 5GXQB 5CPJB 3O62B 5AV9C 3TU4A 3AZFD 5GSUA 4Z5TD 3REHA 3MGPC 5AV5B 5CHLB 4WU8A 3AYWB 1P3FC 4WNNB 1P3AB 4LD9B 3MGRC 1M19B 3AZMD 2Y2NA 4ZUXB 5B24B 5G49A 3WKJB 1PZRA 5AVCC 4XZQC 3LZ1A 3AZJD 5CP6B 3AZHB 4KGCD 1U35D 5GT3D 3UTAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA C;  3AV2 A;  5B40 A;  4CSR A;  4Z5T B;  5B33 C;  3B0D B;  1P3G C;  1P3L C;  5AV6 C;  4J8W A;  3AFA D;  3MGS B;  3AZG D;  3KXB D;  3AZJ B;  5DNN A;  1P34 A;  4AWL C;  4KGC B;  2HIO D;  1P3O C;  3AV1 B;  5GT3 B;  5E5A A;  5AY8 C;  1U35 B;  5BS7 C;  1ULY A;  5AVB A;  1P3P A;  1KX4 A;  3W96 D;  4KHA B;  5JRG C;  3V9R B;  2F8N D;  3X1T C;  5B0Y D;  2NZD C;  5B32 C;  1N1J B;  2LY8 A;  3O62 C;  3B6G A;  1P3K A;  3B6F C;  5AV5 C;  1KX3 A;  1ID3 D;  5B0Z C;  3LEL B;  3AZG B;  3AZN C;  1M18 D;  5B31 D;  4YM6 D;  5BT1 D;  5B1L A;  5B24 C;  4J8X D;  3MGQ B;  4J8U A;  2HIO B;  5FUG A;  5AV9 A;  4DRA A;  3AZH C;  2F8N H;  3W96 B;  5DNM D;  5B2I D;  1F1E A;  1WWS A;  1S32 A;  3LJA A;  3A6N A;  3AZF C;  4Z5T C;  3X1V A;  1P3F D;  2HUE C;  1ID3 B;  1P3I B;  1P3B C;  1M18 B;  3AZM C;  5B31 B;  3REI C;  3WA9 A;  2CV5 C;  4XZQ D;  3REK A;  3WAA D;  4H9P A;  4KGC C;  5GT0 D;  3LZ0 D;  4G92 B;  2YFV B;  1P3G A;  1M1A D;  3MGP B;  2JSS A;  5B33 D;  1P3F B;  3AZK A;  1P3L D;  1KX5 A;  3MGR B;  2FJ7 C;  1P3M A;  3AFA C;  5AVC B;  4XZQ B;  3AZG C;  5CPK D;  4QLC A;  3C1B D;  4UUZ B;  3KXB C;  1P3O D;  5AY8 D;  1F66 A;  3UTA B;  5GXQ A;  4HGA B;  4NFT A;  5GT0 B;  4E45 A;  3O62 A;  5CPJ A;  4X23 D;  3WTP D;  3VH6 A;  4KUD D;  3X1T D;  2NZD D;  1HTA A;  5AV5 A;  5B0Y C;  5B33 B;  3AYW A;  1HQ3 D;  4WNN A;  1P3A A;  1P3L B;  4LD9 A;  1M19 A;  4ZUX A;  3B6F D;  5AV6 B;  5B24 A;  3WKJ A;  5B32 G;  1ID3 C;  5CP6 A;  4JJN C;  3AZH A;  5CPK B;  3C1B B;  4YM6 C;  5B31 C;  5BT1 C;  4AWL B;  1P3O B;  4J8X C;  5AY8 B;  4WU9 D;  3B0B A;  5JRG B;  3AZE D;  5B1M D;  5DNM C;  5B2I C;  4Z5T A;  5B32 B;  3X1T B;  4KUD B;  2BYM B;  3KWQ D;  2NZD B;  4G92 C;  5C3I C;  1HQ3 B;  3NQU B;  3B6F B;  5CPI D;  3C1C D;  1R4V A;  3MGS A;  5B0Z B;  5F99 C;  3X1S D;  4J8V D;  3AZN B;  1P3B D;  3REI D;  3AZI D;  3AZJ A;  4KGC A;  4H9S C;  2CV5 D;  3AN2 D;  5GT3 A;  1B6W A;  3AV1 A;  1U35 A;  1TZY D;  3WAA C;  1AOI C;  4WU9 B;  2PYO C;  4KHA A;  3V9R A;  5B2J D;  1N1J A;  3UTB D;  5GT0 C;  3LZ0 C;  3KWQ B;  3W98 D;  3AZF B;  3KUY D;  1M1A C;  1TAF A;  2NQB D;  2HUE B;  5JA4 B;  3LEL A;  3TU4 D;  3AZG A;  3X1S B;  4J8V B;  4H9Q B;  1P3B B;  2FJ7 D;  3AZM B;  3REH D;  3REI B;  4YS3 A;  3MGQ A;  2HIO A;  2CV5 B;  3AN2 B;  1TZY B;  5CPK C;  3C1B C;  4R8P D;  3W96 A;  1EQZ D;  3W99 C;  1BH8 B;  4EO5 C;  3UTB B;  3LZ1 D;  4X23 C;  3WTP C;  1WWI A;  3KUY B;  4KUD C;  4CAY B;  1ID3 A;  1P3I A;  1HQ3 C;  3X1U D;  1M18 A;  2FJ7 B;  5B31 A;  2F8N G;  4Z66 C;  3AFA B;  4JJN D;  3KXB B;  4R8P B;  4J8W D;  1EQZ B;  2YFV A;  4WU9 C;  1H3O B;  5DNN D;  4M6B A;  1P34 D;  2F8N B;  5B31 G;  3MGP A;  1A7W A;  5B1M C;  3AZE C;  4NE5 A;  5B0Y B;  3AZL C;  1P3F A;  3KWQ C;  5AVB D;  1KX4 D;  1P3P D;  3MGR A;  3UT9 D;  3X1U B;  4ZBJ B;  3NQJ B;  3W97 D;  5CPI C;  4WV4 B;  5F99 D;  3KSY A;  5AVC A;  4XZQ A;  3C1C C;  1P3K D;  3X1S C;  4J8V C;  4UUZ A;  4JJN B;  4YM6 B;  3AZI C;  4J8X B;  1KX3 D;  2ARO C;  3UTA A;  3AN2 C;  5GT0 A;  1AOI D;  4H9R B;  1TZY C;  2PYO D;  4G91 B;  5DNM B;  4XUJ D;  5B2I B;  5B2J C;  5B33 A;  3UTB C;  3W98 C;  5C3I B;  1P3L A;  4Z2M H;  3UT9 B;  3KUY C;  5AV6 A;  3REJ C;  2NQB C;  1BH9 B;  5AV8 C;  3W97 B;  5F99 B;  5BO0 B;  3TU4 C;  3A6N D;  5CPK A;  3C1B A;  3REH C;  1P3O A;  5AY8 A;  2RVQ D;  5BS7 A;  4WU8 C;  3WAA B;  1AOI B;  2YFW B;  2PYO B;  3W99 D;  4R8P C;  5JRG A;  3WA9 D;  4KUD A;  2IO5 B;  3X1T A;  1EQZ C;  2L5A A;  5B32 A;  4XUJ B;  2BYM A;  2NZD A;  3LZ0 B;  3REK D;  3LZ1 C;  1HQ3 A;  1M1A B;  3NQU A;  3B6F A;  5BNX B;  5B0Z A;  3AV2 C;  4H9N B;  3AZN A;  3X1U C;  1ZLA D;  4ZBJ C;  3A6N B;  4Z66 D;  3AZK D;  4WU9 A;  1P3M D;  3W99 B;  4J8W C;  5BNV B;  3WA9 B;  3MVD D;  4EO5 B;  3VH6 W;  3VH5 A;  4QLC D;  4G91 C;  4X23 B;  3WTP B;  3AZF A;  5DNN C;  1P34 C;  3AZL D;  1F66 D;  5E5A C;  5JA4 A;  2BYK B;  5AVB C;  1KX4 C;  1P3P C;  3X1S A;  4J8V A;  4H9Q A;  3UT9 C;  1P3B A;  3AZM A;  3REI A;  1ZLA B;  4Z66 B;  2CV5 A;  3W97 C;  3AN2 A;  4WZS B;  3B6G C;  1TZY A;  1P3K C;  4LD9 D;  1BFM A;  4NE3 A;  2ARO D;  3WKJ D;  1BH8 A;  3MNN D;  3VH5 W;  1KX3 C;  3MVD B;  3UTB A;  3KUY A;  2IO5 C;  5B1L C;  5B1M B;  4CAY A;  4XUJ C;  4J8U C;  3AZE B;  3AZL B;  1KU5 A;  3R45 B;  3REJ D;  3REL D;  2FJ7 A;  5AV8 D;  3AFA A;  5CPI B;  3C1C B;  1S32 C;  3KXB A;  5GSU D;  3LJA C;  3A6N C;  3AZI B;  4R8P A;  3X1V C;  2ARO B;  3VH6 T;  5KDM B;  3B0C W;  3MGS D;  4WU8 D;  2RVQ C;  3MNN B;  1EQZ A;  1H3O A;  2F8N A;  5B2J B;  3WA9 C;  3AV1 D;  5B0Y A;  4H9O B;  3W98 B;  3REK C;  3X1U A;  3REJ B;  3REL B;  1JFI B;  2NQB B;  3NQJ A;  5AV8 B;  3AV2 D;  5B40 D;  3TU4 B;  4JJN A;  4YM6 A;  1ZLA C;  3VH5 T;  5GSU B;  3REH B;  4J8X A;  4WU8 B;  3AZK C;  4H9R A;  3LEL D;  1KX5 C;  4YS3 D;  5DNM A;  5B2I A;  5G49 B;  3MGQ D;  1P3M C;  3MVD C;  3LZ1 B;  4QLC C;  3UT9 A;  5E5A D;  1BH9 A;  1F66 C;  3W97 A;  5GXQ C;  3AV2 B;  5F99 A;  5CPJ C;  5B40 B;  5BO0 A;  4CSR B;  3B0C T;  4H9S A;  1TAF B;  4DRB A;  3AYW C;  1P3I D;  3B6G D;  3WAA A;  1AOI A;  1P3A C;  2YFW A;  2PYO A;  4LD9 C;  1M19 C;  4ZUX C;  4J8W B;  4YS3 B;  3WKJ C;  4XUJ A;  4Z2M G;  3MNN C;  3LZ0 A;  5CP6 C;  5B1L D;  1M1A A;  5DNN B;  1P34 B;  4J8U D;  5BNX A;  5E5A B;  5AVB B;  5AV9 D;  1P3P B;  1KX4 B;  4H9N A;  3REL C;  3MGP D;  1S32 D;  3B6G B;  1P3K B;  3LJA D;  3MGR D;  3B0D C;  2CWE A;  5GSU C;  3X1V D;  3W99 A;  5BNV A;  1KX3 B;  5AVC D;  3MGS C;  4X23 A;  3WTP A;  3AZJ C;  5B1L B;  4J8U B;  3UTA D;  3AV1 C;  5GT3 C;  1U35 C;  2BYK A;  5FUG B;  5AV9 B;  1ZLA A;  4Z66 A;  5B40 C;  1S32 B;  1P3G D;  3LJA B;  5AV6 D;  3X1V B;  4NE6 A;  3MVD A;  1KX5 D;  3LEL C;  4YS3 C;  3AZE A;  5B1M A;  3MGQ C;  3AZL A;  2HIO C;  3KWQ A;  4E44 A;  3REK B;  3R45 A;  4H9P B;  5JRG D;  3W96 C;  2F8N K;  5B32 D;  5GXQ D;  5CPI A;  5CPJ D;  3C1C A;  3O62 D;  1P3G B;  3AZI A;  5AV5 D;  2ARO A;  5KDM A;  3AYW D;  5B0Z D;  3MNN A;  3AZK B;  1P3I C;  1P3A D;  1KX5 B;  3AZN D;  1Q9C A;  1M19 D;  4ZUX D;  5B24 D;  1M18 C;  1P3M B;  5B2J A;  4H9O A;  3WTP E;  3W98 A;  5CP6 D;  3AZH D;  4QLC B;  1B67 A;  3REJ A;  3REL A;  1JFI A;  2NQB A;  1F66 B;  5AV8 A;  5GXQ B;  5CPJ B;  3O62 B;  5AV9 C;  3TU4 A;  3AZF D;  5GSU A;  4Z5T D;  3REH A;  3MGP C;  5AV5 B;  5CHL B;  4WU8 A;  3AYW B;  1P3F C;  4WNN B;  1P3A B;  4LD9 B;  3MGR C;  1M19 B;  3AZM D;  4ZUX B;  5B24 B;  5G49 A;  3WKJ B;  5AVC C;  4XZQ C;  3LZ1 A;  3AZJ D;  5CP6 B;  3AZH B;  4KGC D;  1U35 D;  5GT3 D;  3UTA C; 
#chains in the Genus database with same CATH topology
 4HGA C;  3AV2 A;  5B40 A;  4CSR A;  1Z2C B;  4Z5T B;  5B33 C;  3B0D B;  1P3G C;  1P3L C;  5AV6 C;  4J8W A;  3AFA D;  3MGS B;  3AZG D;  3KXB D;  3AZJ B;  5DNN A;  1P34 A;  4AWL C;  4KGC B;  2HIO D;  1P3O C;  3AV1 B;  5GT3 B;  2VQR A;  5AY8 C;  5E5A A;  5BS7 C;  3IP4 C;  1U35 B;  1ULY A;  5AVB A;  1P3P A;  1KX4 A;  3W96 D;  4KHA B;  5JRG C;  3V9R B;  2F8N D;  3X1T C;  5B0Y D;  2NZD C;  5B32 C;  1N1J B;  2LY8 A;  3O62 C;  3B6G A;  1P3K A;  3B6F C;  5AV5 C;  1KX3 A;  1ID3 D;  2RIQ A;  5B0Z C;  2Y2O A;  3LEL B;  3AZG B;  3AZN C;  1M18 D;  5B31 D;  4YM6 D;  5BT1 D;  5B1L A;  5B24 C;  4J8X D;  3MGQ B;  4J8U A;  2HIO B;  5FUG A;  3P5J B;  5AV9 A;  4DRA A;  3AZH C;  2F8N H;  3W96 B;  5DNM D;  5B2I D;  2Y2H A;  1F1E A;  1WWS A;  1S32 A;  3LJA A;  3A6N A;  3AZF C;  4Z5T C;  3X1V A;  1P3F D;  2HUE C;  1ID3 B;  1P3I B;  2ZM5 A;  1P3B C;  1M18 B;  3AZM C;  5B31 B;  3REI C;  3WA9 A;  2CV5 C;  4XZQ D;  3REK A;  3WAA D;  4H9P A;  4KGC C;  5GT0 D;  3LZ0 D;  4G92 B;  2YFV B;  1P3G A;  1M1A D;  3H0M C;  3MGP B;  2JSS A;  5B33 D;  1P3F B;  3AZK A;  1P3L D;  1KX5 A;  3MGR B;  2FJ7 C;  1P3M A;  3AFA C;  5AVC B;  4XZQ B;  3AZG C;  5CPK D;  4QLC A;  3C1B D;  4UUZ B;  3KXB C;  1P3O D;  5AY8 D;  1F66 A;  3UTA B;  5GXQ A;  4HGA B;  4NFT A;  5GT0 B;  4E45 A;  3O62 A;  5CPJ A;  4X23 D;  3WTP D;  3VH6 A;  4KUD D;  3X1T D;  2NZD D;  1HTA A;  5AV5 A;  5B0Y C;  2ZY2 A;  5B33 B;  3AYW A;  1HQ3 D;  4WNN A;  1P3A A;  1P3L B;  4LD9 A;  1M19 A;  4ZUX A;  3B6F D;  5AV6 B;  5B24 A;  3WKJ A;  5B32 G;  1ID3 C;  5CP6 A;  4JJN C;  3AZH A;  5CPK B;  3C1B B;  5B31 C;  4YM6 C;  5BT1 C;  4AWL B;  1P3O B;  4J8X C;  5AY8 B;  3EPH A;  4WU9 D;  3B0B A;  5JRG B;  3AZE D;  5B1M D;  5DNM C;  5B2I C;  4Z5T A;  5B32 B;  3X1T B;  4KUD B;  2BYM B;  3KWQ D;  3KFU G;  2NZD B;  4G92 C;  5C3I C;  1HQ3 B;  3FDD A;  3NQU B;  3B6F B;  5CPI D;  3C1C D;  1R4V A;  3MGS A;  5B0Z B;  5F99 C;  3X1S D;  4J8V D;  3AZN B;  1P3B D;  3REI D;  3AZI D;  3AZJ A;  4KGC A;  4H9S C;  2CV5 D;  3AN2 D;  5GT3 A;  1B6W A;  3AV1 A;  1U35 A;  4WJ3 C;  1TZY D;  3WAA C;  1AOI C;  4WU9 B;  2PYO C;  4KHA A;  3V9R A;  5B2J D;  1N1J A;  3UTB D;  5GT0 C;  3LZ0 C;  3KWQ B;  3W98 D;  3AZF B;  3KUY D;  1M1A C;  1TAF A;  2NQB D;  2HUE B;  5JA4 B;  3LEL A;  3TU4 D;  3AZG A;  3X1S B;  4J8V B;  4H9Q B;  1P3B B;  2FJ7 D;  3AZM B;  3REH D;  3REI B;  4YS3 A;  3MGQ A;  2HIO A;  2CV5 B;  3AN2 B;  1TZY B;  5CPK C;  3C1B C;  4R8P D;  3W96 A;  1EQZ D;  3W99 C;  1BH8 B;  4EO5 C;  3UTB B;  3LZ1 D;  4X23 C;  3WTP C;  1WWI A;  3KUY B;  4KUD C;  4CAY B;  1ID3 A;  1P3I A;  1HQ3 C;  3X1U D;  2JCH A;  1M18 A;  2FJ7 B;  5B31 A;  3A1K A;  2F8N G;  4Z66 C;  3AFA B;  2G5H C;  1EQZ A;  4JJN D;  2XD5 A;  3KXB B;  2J8P A;  4R8P B;  4J8W D;  1EQZ B;  2YFV A;  4WU9 C;  1H3O B;  5DNN D;  4M6B A;  1P34 D;  2F8N B;  5B31 G;  3MGP A;  1A7W A;  5B1M C;  3AZE C;  4NE5 A;  5B0Y B;  3AZL C;  1P3F A;  3KWQ C;  5AVB D;  1KX4 D;  1P3P D;  3F6T A;  3MGR A;  3UT9 D;  3X1U B;  4ZBJ B;  3NQJ B;  3W97 D;  5CPI C;  4WV4 B;  5F99 D;  3KSY A;  5AVC A;  4XZQ A;  3C1C C;  2G5I C;  1P3K D;  3X1S C;  4J8V C;  4UUZ A;  4JJN B;  4YM6 B;  3AZI C;  4J8X B;  1KX3 D;  2ARO C;  3UTA A;  3AN2 C;  5GT0 A;  1AOI D;  4H9R B;  1TZY C;  2PYO D;  4G91 B;  5DNM B;  4XUJ D;  5B2I B;  5B2J C;  5B33 A;  3UTB C;  3W98 C;  5C3I B;  1P3L A;  4Z2M H;  3UT9 B;  3KUY C;  5AV6 A;  3REJ C;  3EPL A;  2NQB C;  1BH9 B;  5AV8 C;  3W97 B;  3AL0 C;  5F99 B;  5BO0 B;  3TU4 C;  4UPK A;  3A6N D;  5CPK A;  3C1B A;  3EPK A;  3REH C;  1P3O A;  5AY8 A;  2RVQ D;  5BS7 A;  4WU8 C;  3WAA B;  1AOI B;  2YFW B;  2PYO B;  3W99 D;  4R8P C;  5JRG A;  3WA9 D;  4KUD A;  2IO5 B;  3X1T A;  1EQZ C;  2L5A A;  5B32 A;  4XUJ B;  2BYM A;  2NZD A;  3LZ0 B;  3REK D;  3LZ1 C;  1HQ3 A;  1M1A B;  3NQU A;  3B6F A;  5BNX B;  2DF4 C;  5B0Z A;  3AV2 C;  4H9N B;  3AZN A;  3X1U C;  1ZLA D;  4ZBJ C;  3A6N B;  4Z66 D;  2Y2L A;  3AZK D;  4WU9 A;  1P3M D;  3W99 B;  4J8W C;  5BNV B;  3WA9 B;  3MVD D;  4EO5 B;  1T3U A;  3VH6 W;  2DQN C;  3VH5 A;  4QLC D;  4G91 C;  4X23 B;  3WTP B;  3AZF A;  5DNN C;  1P34 C;  3AZL D;  1F66 D;  5E5A C;  5JA4 A;  2BYK B;  5AVB C;  1KX4 C;  1P3P C;  3X1S A;  4J8V A;  4H9Q A;  3UT9 C;  1P3B A;  3AZM A;  3REI A;  1ZLA B;  4Z66 B;  2CV5 A;  3W97 C;  3AN2 A;  4WZS B;  3B6G C;  1TZY A;  1P3K C;  4LD9 D;  1BFM A;  4NE3 A;  2ARO D;  3WKJ D;  1BH8 A;  3MNN D;  3VH5 W;  1KX3 C;  3MVD B;  3UTB A;  3KUY A;  2IO5 C;  5B1L C;  5B1M B;  4CAY A;  4XUJ C;  4J8U C;  3AZE B;  3AZL B;  2Y2I A;  3A1I A;  1KU5 A;  3R45 B;  3REJ D;  3REL D;  2FJ7 A;  2Y2M A;  5AV8 D;  3AFA A;  5CPI B;  3C1C B;  1S32 C;  3KXB A;  5GSU D;  3LJA C;  3A6N C;  3AZI B;  4R8P A;  3X1V C;  2ARO B;  5KDM B;  3VH6 T;  3B0C W;  3MGS D;  2Y2Q A;  2RVQ C;  3MNN B;  4WU8 D;  2Y2G A;  1H3O A;  2F8N A;  5B2J B;  3WA9 C;  3AV1 D;  5B0Y A;  4H9O B;  3W98 B;  3REK C;  2JE5 A;  2FFF B;  3X1U A;  2XD1 A;  3REJ B;  3REL B;  2Y2K A;  4DQY B;  3NQJ A;  1JFI B;  5AV8 B;  2NQB B;  3AV2 D;  5B40 D;  3TU4 B;  4JJN A;  4YM6 A;  1ZLA C;  3VH5 T;  5GSU B;  3REH B;  4J8X A;  4WU8 B;  2ZY5 A;  3AZK C;  4H9R A;  3LEL D;  1KX5 C;  4YS3 D;  5DNM A;  5B2I A;  5G49 B;  3MGQ D;  1P3M C;  3MVD C;  3LZ1 B;  4QLC C;  3UT9 A;  5E5A D;  1BH9 A;  1F66 C;  3W97 A;  5GXQ C;  3AV2 B;  5F99 A;  5CPJ C;  5B40 B;  5BO0 A;  2ZY4 A;  4CSR B;  3B0C T;  4H9S A;  1TAF B;  4DRB A;  3AYW C;  1P3I D;  3B6G D;  3WAA A;  1AOI A;  1P3A C;  2YFW A;  2PYO A;  4LD9 C;  1M19 C;  4ZUX C;  4J8W B;  4YS3 B;  3WKJ C;  4XUJ A;  4Z2M G;  3MNN C;  3LZ0 A;  2BG1 A;  2ZY3 A;  5CP6 C;  5B1L D;  1M1A A;  5DNN B;  1P34 B;  4J8U D;  5BNX A;  5E5A B;  2UWX A;  5AVB B;  5AV9 D;  1P3P B;  1KX4 B;  4H9N A;  3REL C;  3MGP D;  3EPJ A;  1S32 D;  3B6G B;  1P3K B;  3LJA D;  3MGR D;  3B0D C;  2CWE A;  5GSU C;  3X1V D;  3W99 A;  5BNV A;  1KX3 B;  5AVC D;  3MGS C;  4X23 A;  3WTP A;  3AZJ C;  5B1L B;  4J8U B;  3UTA D;  1W2E A;  5GT3 C;  3AV1 C;  1U35 C;  2BYK A;  5FUG B;  5AV9 B;  3H0L C;  2W8S A;  1ZLA A;  4Z66 A;  3H0R C;  5B40 C;  1S32 B;  1P3G D;  3LJA B;  2Y2J A;  5AV6 D;  3X1V B;  4NE6 A;  3MVD A;  1KX5 D;  3LEL C;  4YS3 C;  3AZE A;  5B1M A;  3MGQ C;  3AZL A;  2HIO C;  2F2A C;  3KWQ A;  4E44 A;  3REK B;  3R45 A;  4H9P B;  5JRG D;  3W96 C;  2F8N K;  5B32 D;  5GXQ D;  5CPI A;  5CPJ D;  3C1C A;  3O62 D;  1P3G B;  3AZI A;  2Y2P A;  3EG5 B;  5AV5 D;  2ARO A;  5KDM A;  3AYW D;  5B0Z D;  3MNN A;  3AZK B;  1P3I C;  1P3A D;  1KX5 B;  3AZN D;  1Q9C A;  1M19 D;  4ZUX D;  5B24 D;  1M18 C;  1P3M B;  5B2J A;  4H9O A;  3WTP E;  3W98 A;  5CP6 D;  3AZH D;  4QLC B;  1B67 A;  3REJ A;  3REL A;  1JFI A;  2NQB A;  1F66 B;  5AV8 A;  5GXQ B;  5CPJ B;  3O62 B;  5AV9 C;  3TU4 A;  3AZF D;  5GSU A;  4Z5T D;  3REH A;  3MGP C;  5AV5 B;  5CHL B;  4WU8 A;  3AYW B;  1P3F C;  4WNN B;  1P3A B;  4LD9 B;  3MGR C;  1M19 B;  3AZM D;  2Y2N A;  4ZUX B;  5B24 B;  5G49 A;  3WKJ B;  1PZR A;  5AVC C;  4XZQ C;  3LZ1 A;  3AZJ D;  5CP6 B;  3AZH B;  4KGC D;  1U35 D;  5GT3 D;  3UTA C; 
#chains in the Genus database with same CATH homology
 4HGA C;  3AV2 A;  5B40 A;  4CSR A;  1Z2C B;  4Z5T B;  5B33 C;  3B0D B;  1P3G C;  1P3L C;  5AV6 C;  4J8W A;  3AFA D;  3MGS B;  3AZG D;  3KXB D;  3AZJ B;  5DNN A;  1P34 A;  4AWL C;  4KGC B;  2HIO D;  1P3O C;  3AV1 B;  5GT3 B;  2VQR A;  5AY8 C;  5E5A A;  5BS7 C;  3IP4 C;  1U35 B;  1ULY A;  5AVB A;  1P3P A;  1KX4 A;  3W96 D;  4KHA B;  5JRG C;  3V9R B;  2F8N D;  3X1T C;  5B0Y D;  2NZD C;  5B32 C;  1N1J B;  2LY8 A;  3O62 C;  3B6G A;  1P3K A;  3B6F C;  5AV5 C;  1KX3 A;  1ID3 D;  2RIQ A;  5B0Z C;  2Y2O A;  3LEL B;  3AZG B;  3AZN C;  1M18 D;  5B31 D;  4YM6 D;  5BT1 D;  5B1L A;  5B24 C;  4J8X D;  3MGQ B;  4J8U A;  2HIO B;  5FUG A;  3P5J B;  5AV9 A;  4DRA A;  3AZH C;  2F8N H;  3W96 B;  5DNM D;  5B2I D;  2Y2H A;  1F1E A;  1WWS A;  1S32 A;  3LJA A;  3A6N A;  3AZF C;  4Z5T C;  3X1V A;  1P3F D;  2HUE C;  1ID3 B;  1P3I B;  2ZM5 A;  1P3B C;  1M18 B;  3AZM C;  5B31 B;  3REI C;  3WA9 A;  2CV5 C;  4XZQ D;  3REK A;  3WAA D;  4H9P A;  4KGC C;  5GT0 D;  3LZ0 D;  4G92 B;  2YFV B;  1P3G A;  1M1A D;  3H0M C;  3MGP B;  2JSS A;  5B33 D;  1P3F B;  3AZK A;  1P3L D;  1KX5 A;  3MGR B;  2FJ7 C;  1P3M A;  3AFA C;  5AVC B;  4XZQ B;  3AZG C;  5CPK D;  4QLC A;  3C1B D;  4UUZ B;  3KXB C;  1P3O D;  5AY8 D;  1F66 A;  3UTA B;  5GXQ A;  4HGA B;  4NFT A;  5GT0 B;  4E45 A;  3O62 A;  5CPJ A;  4X23 D;  3WTP D;  3VH6 A;  4KUD D;  3X1T D;  2NZD D;  1HTA A;  5AV5 A;  5B0Y C;  2ZY2 A;  5B33 B;  3AYW A;  1HQ3 D;  4WNN A;  1P3A A;  1P3L B;  4LD9 A;  1M19 A;  4ZUX A;  3B6F D;  5AV6 B;  5B24 A;  3WKJ A;  5B32 G;  1ID3 C;  5CP6 A;  4JJN C;  3AZH A;  5CPK B;  3C1B B;  5B31 C;  4YM6 C;  5BT1 C;  4AWL B;  1P3O B;  4J8X C;  5AY8 B;  3EPH A;  4WU9 D;  3B0B A;  5JRG B;  3AZE D;  5B1M D;  5DNM C;  5B2I C;  4Z5T A;  5B32 B;  3X1T B;  4KUD B;  2BYM B;  3KWQ D;  3KFU G;  2NZD B;  4G92 C;  5C3I C;  1HQ3 B;  3FDD A;  3NQU B;  3B6F B;  5CPI D;  3C1C D;  1R4V A;  3MGS A;  5B0Z B;  5F99 C;  3X1S D;  4J8V D;  3AZN B;  1P3B D;  3REI D;  3AZI D;  3AZJ A;  4KGC A;  4H9S C;  2CV5 D;  3AN2 D;  5GT3 A;  1B6W A;  3AV1 A;  1U35 A;  4WJ3 C;  1TZY D;  3WAA C;  1AOI C;  4WU9 B;  2PYO C;  4KHA A;  3V9R A;  5B2J D;  1N1J A;  3UTB D;  5GT0 C;  3LZ0 C;  3KWQ B;  3W98 D;  3AZF B;  3KUY D;  1M1A C;  1TAF A;  2NQB D;  2HUE B;  5JA4 B;  3LEL A;  3TU4 D;  3AZG A;  3X1S B;  4J8V B;  4H9Q B;  1P3B B;  2FJ7 D;  3AZM B;  3REH D;  3REI B;  4YS3 A;  3MGQ A;  2HIO A;  2CV5 B;  3AN2 B;  1TZY B;  5CPK C;  3C1B C;  4R8P D;  3W96 A;  1EQZ D;  3W99 C;  1BH8 B;  4EO5 C;  3UTB B;  3LZ1 D;  4X23 C;  3WTP C;  1WWI A;  3KUY B;  4KUD C;  4CAY B;  1ID3 A;  1P3I A;  1HQ3 C;  3X1U D;  2JCH A;  1M18 A;  2FJ7 B;  5B31 A;  3A1K A;  2F8N G;  4Z66 C;  3AFA B;  2G5H C;  1EQZ A;  4JJN D;  2XD5 A;  3KXB B;  2J8P A;  4R8P B;  4J8W D;  1EQZ B;  2YFV A;  4WU9 C;  1H3O B;  5DNN D;  4M6B A;  1P34 D;  2F8N B;  5B31 G;  3MGP A;  1A7W A;  5B1M C;  3AZE C;  4NE5 A;  5B0Y B;  3AZL C;  1P3F A;  3KWQ C;  5AVB D;  1KX4 D;  1P3P D;  3F6T A;  3MGR A;  3UT9 D;  3X1U B;  4ZBJ B;  3NQJ B;  3W97 D;  5CPI C;  4WV4 B;  5F99 D;  3KSY A;  5AVC A;  4XZQ A;  3C1C C;  2G5I C;  1P3K D;  3X1S C;  4J8V C;  4UUZ A;  4JJN B;  4YM6 B;  3AZI C;  4J8X B;  1KX3 D;  2ARO C;  3UTA A;  3AN2 C;  5GT0 A;  1AOI D;  4H9R B;  1TZY C;  2PYO D;  4G91 B;  5DNM B;  4XUJ D;  5B2I B;  5B2J C;  5B33 A;  3UTB C;  3W98 C;  5C3I B;  1P3L A;  4Z2M H;  3UT9 B;  3KUY C;  5AV6 A;  3REJ C;  3EPL A;  2NQB C;  1BH9 B;  5AV8 C;  3W97 B;  3AL0 C;  5F99 B;  5BO0 B;  3TU4 C;  4UPK A;  3A6N D;  5CPK A;  3C1B A;  3EPK A;  3REH C;  1P3O A;  5AY8 A;  2RVQ D;  5BS7 A;  4WU8 C;  3WAA B;  1AOI B;  2YFW B;  2PYO B;  3W99 D;  4R8P C;  5JRG A;  3WA9 D;  4KUD A;  2IO5 B;  3X1T A;  1EQZ C;  2L5A A;  5B32 A;  4XUJ B;  2BYM A;  2NZD A;  3LZ0 B;  3REK D;  3LZ1 C;  1HQ3 A;  1M1A B;  3NQU A;  3B6F A;  5BNX B;  2DF4 C;  5B0Z A;  3AV2 C;  4H9N B;  3AZN A;  3X1U C;  1ZLA D;  4ZBJ C;  3A6N B;  4Z66 D;  2Y2L A;  3AZK D;  4WU9 A;  1P3M D;  3W99 B;  4J8W C;  5BNV B;  3WA9 B;  3MVD D;  4EO5 B;  1T3U A;  3VH6 W;  2DQN C;  3VH5 A;  4QLC D;  4G91 C;  4X23 B;  3WTP B;  3AZF A;  5DNN C;  1P34 C;  3AZL D;  1F66 D;  5E5A C;  5JA4 A;  2BYK B;  5AVB C;  1KX4 C;  1P3P C;  3X1S A;  4J8V A;  4H9Q A;  3UT9 C;  1P3B A;  3AZM A;  3REI A;  1ZLA B;  4Z66 B;  2CV5 A;  3W97 C;  3AN2 A;  4WZS B;  3B6G C;  1TZY A;  1P3K C;  4LD9 D;  1BFM A;  4NE3 A;  2ARO D;  3WKJ D;  1BH8 A;  3MNN D;  3VH5 W;  1KX3 C;  3MVD B;  3UTB A;  3KUY A;  2IO5 C;  5B1L C;  5B1M B;  4CAY A;  4XUJ C;  4J8U C;  3AZE B;  3AZL B;  2Y2I A;  3A1I A;  1KU5 A;  3R45 B;  3REJ D;  3REL D;  2FJ7 A;  2Y2M A;  5AV8 D;  3AFA A;  5CPI B;  3C1C B;  1S32 C;  3KXB A;  5GSU D;  3LJA C;  3A6N C;  3AZI B;  4R8P A;  3X1V C;  2ARO B;  5KDM B;  3VH6 T;  3B0C W;  3MGS D;  2Y2Q A;  2RVQ C;  3MNN B;  4WU8 D;  2Y2G A;  1H3O A;  2F8N A;  5B2J B;  3WA9 C;  3AV1 D;  5B0Y A;  4H9O B;  3W98 B;  3REK C;  2JE5 A;  2FFF B;  3X1U A;  2XD1 A;  3REJ B;  3REL B;  2Y2K A;  4DQY B;  3NQJ A;  1JFI B;  5AV8 B;  2NQB B;  3AV2 D;  5B40 D;  3TU4 B;  4JJN A;  4YM6 A;  1ZLA C;  3VH5 T;  5GSU B;  3REH B;  4J8X A;  4WU8 B;  2ZY5 A;  3AZK C;  4H9R A;  3LEL D;  1KX5 C;  4YS3 D;  5DNM A;  5B2I A;  5G49 B;  3MGQ D;  1P3M C;  3MVD C;  3LZ1 B;  4QLC C;  3UT9 A;  5E5A D;  1BH9 A;  1F66 C;  3W97 A;  5GXQ C;  3AV2 B;  5F99 A;  5CPJ C;  5B40 B;  5BO0 A;  2ZY4 A;  4CSR B;  3B0C T;  4H9S A;  1TAF B;  4DRB A;  3AYW C;  1P3I D;  3B6G D;  3WAA A;  1AOI A;  1P3A C;  2YFW A;  2PYO A;  4LD9 C;  1M19 C;  4ZUX C;  4J8W B;  4YS3 B;  3WKJ C;  4XUJ A;  4Z2M G;  3MNN C;  3LZ0 A;  2BG1 A;  2ZY3 A;  5CP6 C;  5B1L D;  1M1A A;  5DNN B;  1P34 B;  4J8U D;  5BNX A;  5E5A B;  2UWX A;  5AVB B;  5AV9 D;  1P3P B;  1KX4 B;  4H9N A;  3REL C;  3MGP D;  3EPJ A;  1S32 D;  3B6G B;  1P3K B;  3LJA D;  3MGR D;  3B0D C;  2CWE A;  5GSU C;  3X1V D;  3W99 A;  5BNV A;  1KX3 B;  5AVC D;  3MGS C;  4X23 A;  3WTP A;  3AZJ C;  5B1L B;  4J8U B;  3UTA D;  1W2E A;  5GT3 C;  3AV1 C;  1U35 C;  2BYK A;  5FUG B;  5AV9 B;  3H0L C;  2W8S A;  1ZLA A;  4Z66 A;  3H0R C;  5B40 C;  1S32 B;  1P3G D;  3LJA B;  2Y2J A;  5AV6 D;  3X1V B;  4NE6 A;  3MVD A;  1KX5 D;  3LEL C;  4YS3 C;  3AZE A;  5B1M A;  3MGQ C;  3AZL A;  2HIO C;  2F2A C;  3KWQ A;  4E44 A;  3REK B;  3R45 A;  4H9P B;  5JRG D;  3W96 C;  2F8N K;  5B32 D;  5GXQ D;  5CPI A;  5CPJ D;  3C1C A;  3O62 D;  1P3G B;  3AZI A;  2Y2P A;  3EG5 B;  5AV5 D;  2ARO A;  5KDM A;  3AYW D;  5B0Z D;  3MNN A;  3AZK B;  1P3I C;  1P3A D;  1KX5 B;  3AZN D;  1Q9C A;  1M19 D;  4ZUX D;  5B24 D;  1M18 C;  1P3M B;  5B2J A;  4H9O A;  3WTP E;  3W98 A;  5CP6 D;  3AZH D;  4QLC B;  1B67 A;  3REJ A;  3REL A;  1JFI A;  2NQB A;  1F66 B;  5AV8 A;  5GXQ B;  5CPJ B;  3O62 B;  5AV9 C;  3TU4 A;  3AZF D;  5GSU A;  4Z5T D;  3REH A;  3MGP C;  5AV5 B;  5CHL B;  4WU8 A;  3AYW B;  1P3F C;  4WNN B;  1P3A B;  4LD9 B;  3MGR C;  1M19 B;  3AZM D;  2Y2N A;  4ZUX B;  5B24 B;  5G49 A;  3WKJ B;  1PZR A;  5AVC C;  4XZQ C;  3LZ1 A;  3AZJ D;  5CP6 B;  3AZH B;  4KGC D;  1U35 D;  5GT3 D;  3UTA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...