3MGQC

Binding of nickel ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqC00
5B40C 3REKB 5AV8A 3AFAC 3AZFA 1M19B 3C1BC 5E5AC 5AV6B 5GSUA 1EQZB 2PYOD 3WTPD 3B0CW 3AZIB 3AZGB 3MGQA 1F66B 3TU4C 3LZ1A 5F99B 1F1EA 5B33A 4J8UB 3AN2A 3REIA 3UTAC 5AV9B 4X23B 4G91C 1WWIA 3X1VC 4KGCD 1P3LB 3W98D 3UT9A 4XZQD 3LJAD 3KXBD 1F66A 3AZEA 3X1TC 5JRGD 4ZUXB 4G92B 3O62A 1AOIA 5B40B 3AFAB 4YM6B 3C1BB 4WU8D 1M18D 1P3LA 1KX4A 5CPID 4WNNA 3TU4B 3X1UA 3WAAB 2CV5C 3KWQB 4ZUXA 5B0YA 3NQJB 3C1CD 5B2JC 5B0ZC 1TAFB 3AFAA 2F8NH 3W98C 4G91B 5E5AA 3C1BA 2FJ7B 3AYWD 5CHLB 1P3FB 5AV5C 4J8XB 4ZBJB 5DNNA 3MGPD 4JJND 3MNNA 2PYOB 3WTPB 4E45A 3UTAA 1TAFA 2HIOD 3X1VA 1P3OC 3B6GD 4H9OB 2HUEC 3LZ0D 5B1LD 2F8NK 3AZHC 1N1JB 3C1CC 3UTBC 3X1TA 4KGCB 4NE3A 3VH5W 1ULYA 5AVCD 3AYWC 5CPKD 3W98B 4XZQB 4LD9D 3LJAB 4Z5TC 3KXBB 3W99D 5JRGB 3AV1D 5BT1C 5GT3C 2AROD 2CV5A 3B6FC 4WU8B 4EO5C 1M18B 3B6GC 5B2JA 2F8NA 5B0ZA 3W98A 3VH6T 5CPIB 4KUDD 5FUGA 1Q9CA 3B0DC 3V9RB 1P3BC 2IO5C 5GT0C 4KHAB 4CSRB 5AV5A 3C1CB 2NQBD 3W96D 1H3OA 3R45A 1R4VA 4AWLC 2F8NG 4NE5A 1M1AC 1P3OA 4J8UD 5B31D 5B32C 3MGPB 3REHD 4JJNB 3AZHA 4YS3C 3C1CA 3UTBA 1P3ID 2HIOB 5B24D 4Z2MH 3B6GB 4XUJD 3AYWA 3REKC 1M19C 3LZ0B 5B1LB 5AV6C 1EQZC 1BH9B 4Z5TA 3B0DB 3W96C 3AZIC 3AZJD 5AVCB 5GT3A 5CPKB 3B6FA 5G49B 5F99C 4LD9B 3W99B 3B6GA 4J8UC 1S32D 5AV9C 4X23C 3AV1B 3A6ND 2NZDD 2AROB 1P3IC 4QLCD 1P3BA 5GT0A 3AV2D 1KU5A 4UUZA 4H9NB 4G92C 4KUDB 3LELD 4H9PB 3NQUA 4YM6C 1A7WA 1M1AA 1JFIB 2L5AA 3AZLD 1WWSA 3W96B 2NQBB 3REJD 5CPJD 5BNXA 5B32A 2BYKB 3WAAC 3AZND 4YS3A 1S32C 3KWQC 1ZLAA 3B0BA 4H9NA 4R8PA 1ID3A 3A6NC 5B31B 5KDMB 4H9PA 3REKA 1M19A 3REHB 2FJ7C 1B67A 5AV6A 3AV2C 3MVDD 1EQZA 3MGRD 3W96A 1P3IB 3AZIA 3X1SD 1P3FC 1HQ3D 5B32G 5B24B 3AZGA 4J8XC 4XUJB 4ZBJC 5F99A 2RVQD 2PYOC 1HTAA 4Z2MG 3VH5A 3VH5T 4J8UA 3WTPC 3REJC 5CPJC 1KX5D 5AV9A 4X23A 3AZJB 5GXQD 1P3IA 1S32B 4KGCC 4WU9D 3A6NB 2NZDB 5B40A 4NE6A 4XZQC 4YM6A 4QLCB 1P3PD 3LJAC 3KXBC 3AV2B 1BFMA 5JRGC 4J8VD 1TZYD 4M6BA 3TU4A 3LELB 3WAAA 3WA9B 1S32A 3KWQA 4WU8C 1U35D 5B1MD 1M18C 1P3AD 3AZLB 3NQJA 3A6NA 4J8WD 3REJB 5CPJB 5CPIC 2FJ7A 4WV4B 1KX3D 3AV2A 3AZNB 1P34D 1P3FA 5JA4B 4J8XA 3W97D 1P3PC 3MGSD 3MVDB 1P3GD 3MGRB 2PYOA 3WTPA 3REJA 5CPJA 3X1SB 4J8VC 1HQ3B 4Z66D 4H9OA 3MGPC 4J8XD 4JJNC 1N1JA 5JA4A 4WZSB 4J8WC 1KX5B 2HIOC 5GXQB 3AZMD 4KGCA 5DNMD 3LZ0C 5B1LC 3VH6A 4XZQA 3LJAA 3KXBA 5BS7C 3W97C 5JRGA 1P3GC 4WU9B 5AVCC 5CPKC 1P3PB 4WU8A 4LD9C 1M18A 3AZFD 3W99C 5AV8D 1BH8B 5GSUD 4J8VB 1TZYB 5CPIA 3AV1C 3V9RA 2AROC 3B0CT 2YFVB 4KHAA 5B1MB 1U35B 1P3AB 4CSRA 4J8WB 5DNMC 5B33D 3WTPE 4KUDC 1KX3B 3AN2D 3REID 5B2IB 1P34B 4J8VA 3UT9D 2NQBC 3W97B 3MGPA 4JJNA 3AZED 3MGSB 1P3GB 4J8WA 2BYMB 3O62D 2HIOA 4CAYB 4Z66B 5B31C 3LZ0A 3REHC 5B1LA 5BO0B 1BH9A 5BS7A 3W97A 5B24C 3X1UD 3AZMB 4H9RB 4XUJC 1P3GA 5AVCA 5DNMB 5B0YD 5CPKA 5G49A 4LD9A 4NFTA 2YFWB 3KUYD 3W99A 3WA9D 5E5AD 3AZJC 1B6WA 5BO0A 1P3MD 3AV1A 5AY8B 2AROA 5BNVB 3AZKD 5DNND 3AZFB 5AV8B 5DNMA 3MNND 5GSUB 4KUDA 3UTAD 3WKJD 2NZDC 4QLCC 5C3IB 3X1VD 1JFIA 5CP6D 2NQBA 2BYKA 5B33B 3AN2B 3REIB 3X1TD 3LELC 3KUYC 3WA9C 3AZLC 1P3MC 3UT9B 5B31A 5KDMA 3REHA 3AZEB 4HGAB 3AZKC 5DNNC 3AZNC 3O62B 3MNNC 5B24A 1AOIB 2CV5D 4XUJA 3WKJC 3MVDC 5B2JD 3MGRC 2F8ND 5B0ZD 5CP6C 3RELD 1KX4B 5B31G 3X1SC 4WNNB 1HQ3C 3AZJA 3X1UB 4E44A 5B0YB 5AV5D 2RVQC 3KUYB 1KX5C 5E5AB 5GXQC 1P3MB 4H9SC 2NZDA 4QLCA 4H9QB 1P3OD 3AZKB 5DNNB 5B2ID 3MNNB 3AZHD 4WU9C 3UTBD 3UTAB 3LELA 3KUYA 3WKJB 3RELC 3WA9A 3X1VB 3AZLA 3KSYA 1P3MA 5CP6B 4H9QA 1TZYC 4Z5TD 3AZKA 3X1TB 3AZNA 1P3KD 1U35C 5B1MC 5BT1D 1P3AC 5GT3D 3B6FD 3WKJA 4DRAA 1KX3C 3MVDA 3MGRA 5B2IC 5CP6A 1P34C 3X1SA 1HQ3A 2CV5B 1P3BD 5GT0D 3MGSC 5AY8D 5B2JB 2F8NB 4DRBA 5B0ZB 3RELB 1KX5A 5AVBD 5FUGB 4Z66C 5GXQA 4H9SA 1M1AD 1P3KC 5AV5B 1H3OB 3R45B 5B32D 3MGQD 3AZMC 4YS3D 3LZ1D 4WU9A 1ZLAD 3RELA 4R8PD 1P3PA 1P3OB 1ID3D 3REKD 2HUEB 1M19D 1BH8A 5AV6D 1EQZD 3AZHB 1TZYA 5AY8C 2JSSA 3UTBB 3AZID 5AVBC 2YFVA 3AZGD 1F66D 1U35A 5B1MA 3AYWB 3AZFC 5AV8C 1P3AA 5F99D 5GSUC 1AOID 4Z5TB 1KX3A 5B2IA 5AV9D 4X23D 1P34A 5C3IC 3MGQC 1P3KB 1P3LD 3LZ1C 5GT3B 1ZLAC 3B6FB 1KX4D 4R8PC 4EO5B 5B33C 1ID3C 3AN2C 3MGSA 3REIC 4ZUXD 2BYMA 4Z66A 5B40D 4CAYA 3AFAD 3UT9C 4YM6D 1P3BB 3C1BD 2IO5B 5GT0B 3AZGC 1F66C 1P3KA 3AZEC 4HGAC 4UUZB 2LY8A 4AWLB 5AVBB 3O62C 3TU4D 1AOIC 3WAAD 3AZMA 2CWEA 3NQUB 4H9RA 3KWQD 3VH6W 1M1AB 1P3LC 2YFWA 5BNXB 5B32B 1KX4C 2FJ7D 3MGQB 3X1UC 3LZ1B 4YS3B 5AY8A 1ZLAB 4ZUXC 1P3FD 5B0YC 4R8PB 5AVBA 1ID3B 5BNVA
chains in the Genus database with same CATH superfamily
5B40C 3REKB 5AV8A 3AFAC 3AZFA 1M19B 3C1BC 5E5AC 5AV6B 5GSUA 1EQZB 2PYOD 3WTPD 3B0CW 3AZIB 2ZY5A 3AZGB 3MGQA 1F66B 3TU4C 3LZ1A 5F99B 1F1EA 5B33A 4J8UB 3AN2A 3REIA 4DQYB 3UTAC 5AV9B 4X23B 4G91C 1WWIA 3X1VC 4KGCD 1P3LB 3W98D 3UT9A 4XZQD 3LJAD 3KXBD 1F66A 3AZEA 3X1TC 5JRGD 4ZUXB 4G92B 3O62A 1AOIA 5B40B 3AFAB 4YM6B 3C1BB 4WU8D 1M18D 1P3LA 2DQNC 5CPID 1KX4A 4WNNA 3TU4B 3X1UA 3WAAB 2CV5C 3KWQB 4ZUXA 5B0YA 3NQJB 3C1CD 5B2JC 5B0ZC 1TAFB 3AFAA 2F8NH 3W98C 4G91B 5E5AA 3C1BA 2FJ7B 3AYWD 5CHLB 1P3FB 5AV5C 4J8XB 4ZBJB 5DNNA 3MGPD 4JJND 3MNNA 2PYOB 3WTPB 4E45A 3UTAA 2ZY2A 1TAFA 2HIOD 3X1VA 1P3OC 3B6GD 4H9OB 2HUEC 3LZ0D 5B1LD 2F8NK 3AZHC 1N1JB 3C1CC 3UTBC 3X1TA 4KGCB 4NE3A 3VH5W 1ULYA 5AVCD 3AYWC 5CPKD 3W98B 4XZQB 4LD9D 3LJAB 2G5IC 4Z5TC 3KXBB 3W99D 5JRGB 2JCHA 3AV1D 5BT1C 5GT3C 2AROD 2CV5A 3B6FC 4WU8B 4EO5C 1M18B 3B6GC 5B2JA 2F8NA 5B0ZA 3W98A 3VH6T 5CPIB 4KUDD 5FUGA 1Q9CA 3FDDA 3B0DC 3V9RB 1P3BC 2BG1A 2IO5C 5GT0C 4KHAB 4CSRB 5AV5A 4UPKA 3C1CB 2NQBD 3W96D 1H3OA 3R45A 1R4VA 4AWLC 2F8NG 4NE5A 2Y2GA 1M1AC 1P3OA 4J8UD 5B31D 5B32C 3MGPB 3REHD 4JJNB 2Y2JA 3AZHA 4YS3C 3H0RC 3C1CA 3UTBA 1P3ID 2HIOB 5B24D 2ZM5A 4Z2MH 3B6GB 4XUJD 3AYWA 3REKC 1M19C 3LZ0B 5B1LB 5AV6C 1EQZC 1BH9B 4Z5TA 3B0DB 3W96C 3AZIC 3AZJD 5AVCB 5GT3A 5CPKB 3B6FA 3EG5B 5G49B 5F99C 4LD9B 3W99B 3B6GA 4J8UC 1S32D 5AV9C 4X23C 3AV1B 3A6ND 2NZDD 2AROB 1P3IC 4QLCD 1P3BA 5GT0A 3AV2D 1KU5A 4UUZA 2J8PA 4H9NB 2XD5A 4G92C 4KUDB 3LELD 4H9PB 3NQUA 4YM6C 1A7WA 1M1AA 1JFIB 2L5AA 3AZLD 1WWSA 3W96B 2NQBB 3REJD 5CPJD 5BNXA 5B32A 2BYKB 3AL0C 3WAAC 3AZND 4YS3A 1S32C 3KWQC 1ZLAA 3B0BA 4H9NA 4R8PA 1ID3A 3A6NC 5B31B 5KDMB 4H9PA 3REKA 2RIQA 3REHB 1M19A 2FJ7C 1B67A 5AV6A 3AV2C 3MVDD 1EQZA 3MGRD 3W96A 1P3IB 3AZIA 3X1SD 1P3FC 1HQ3D 5B32G 5B24B 3AZGA 4J8XC 4XUJB 4ZBJC 2Y2PA 2UWXA 5F99A 2RVQD 2PYOC 1HTAA 4Z2MG 3VH5A 3VH5T 4J8UA 3WTPC 3REJC 5CPJC 1KX5D 5AV9A 4X23A 3AZJB 5GXQD 2JE5A 1P3IA 2Y2IA 1S32B 4KGCC 4WU9D 3A6NB 2NZDB 5B40A 4NE6A 4XZQC 4YM6A 4QLCB 1P3PD 3LJAC 3KXBC 3AV2B 1BFMA 5JRGC 4J8VD 1TZYD 4M6BA 3TU4A 3LELB 3WAAA 3WA9B 1S32A 3KWQA 4WU8C 1U35D 5B1MD 1M18C 1P3AD 3AZLB 3NQJA 3A6NA 4J8WD 3REJB 5CPJB 5CPIC 2FJ7A 4WV4B 1KX3D 3AV2A 3H0LC 3AZNB 1P34D 1P3FA 5JA4B 4J8XA 3W97D 1P3PC 3MGSD 3MVDB 1P3GD 3MGRB 2PYOA 2VQRA 3WTPA 3REJA 5CPJA 3X1SB 4J8VC 1HQ3B 4Z66D 2Y2NA 4H9OA 3MGPC 4J8XD 4JJNC 1N1JA 5JA4A 4WZSB 4J8WC 1KX5B 2HIOC 5GXQB 3AZMD 4KGCA 5DNMD 2Y2HA 3LZ0C 5B1LC 3VH6A 4XZQA 3LJAA 3KXBA 5BS7C 3W97C 3A1KA 5JRGA 1T3UA 1P3GC 4WU9B 5AVCC 5CPKC 1P3PB 4WU8A 4LD9C 1M18A 2Y2MA 3W99C 5AV8D 3AZFD 1BH8B 5GSUD 4J8VB 1TZYB 1Z2CB 5CPIA 3AV1C 3V9RA 2AROC 3B0CT 2YFVB 4KHAA 5B1MB 1U35B 1P3AB 4CSRA 4J8WB 5DNMC 5B33D 3WTPE 4KUDC 1KX3B 3AN2D 3REID 3A1IA 5B2IB 1P34B 4J8VA 3UT9D 2NQBC 3W97B 3MGPA 4JJNA 3AZED 2ZY4A 3MGSB 1P3GB 4J8WA 2BYMB 3O62D 2HIOA 4CAYB 4Z66B 5B31C 3LZ0A 3REHC 5B1LA 5BO0B 1BH9A 5BS7A 2Y2OA 3W97A 5B24C 3X1UD 3AZMB 4H9RB 4XUJC 1P3GA 5AVCA 5DNMB 5B0YD 5CPKA 5G49A 4LD9A 4NFTA 2YFWB 3KUYD 3W99A 3WA9D 5E5AD 3AZJC 1B6WA 5BO0A 1P3MD 3AV1A 5AY8B 2AROA 2Y2KA 5BNVB 3AZKD 5DNND 3AZFB 5AV8B 2Y2LA 5DNMA 3MNND 5GSUB 4KUDA 3UTAD 3WKJD 2NZDC 3EPJA 4QLCC 5C3IB 3EPKA 3X1VD 1JFIA 5CP6D 2NQBA 2BYKA 5B33B 3AN2B 3REIB 3X1TD 3LELC 3KUYC 3WA9C 2W8SA 3EPLA 3AZLC 1P3MC 3UT9B 5B31A 5KDMA 3REHA 3AZEB 4HGAB 3AZKC 5DNNC 3F6TA 3AZNC 3O62B 3MNNC 3EPHA 5B24A 2F2AC 1AOIB 2CV5D 4XUJA 3WKJC 3MVDC 5B2JD 3MGRC 2F8ND 5B0ZD 5CP6C 3RELD 1KX4B 5B31G 3X1SC 4WNNB 1HQ3C 3AZJA 3X1UB 4E44A 5B0YB 5AV5D 2RVQC 3KUYB 1KX5C 5E5AB 5GXQC 1P3MB 4H9SC 2NZDA 4QLCA 4H9QB 1P3OD 3AZKB 5DNNB 5B2ID 2ZY3A 3MNNB 3AZHD 4WU9C 3UTBD 3UTAB 3LELA 3KUYA 3WKJB 3RELC 3WA9A 2DF4C 3X1VB 2G5HC 3AZLA 3KSYA 1P3MA 5CP6B 4H9QA 1TZYC 4Z5TD 3AZKA 3X1TB 3AZNA 1P3KD 1U35C 5B1MC 4WJ3C 5BT1D 1P3AC 5GT3D 3B6FD 3WKJA 4DRAA 1KX3C 3MVDA 3MGRA 5B2IC 5CP6A 1P34C 3X1SA 1HQ3A 2CV5B 1P3BD 5GT0D 3MGSC 5AY8D 5B2JB 2F8NB 4DRBA 5B0ZB 3RELB 1KX5A 2FFFB 5AVBD 5FUGB 1PZRA 4Z66C 5GXQA 4H9SA 1M1AD 1P3KC 5AV5B 1H3OB 3R45B 5B32D 3MGQD 3AZMC 4YS3D 3LZ1D 4WU9A 1ZLAD 3RELA 4R8PD 3P5JB 1P3PA 2Y2QA 1P3OB 1ID3D 3REKD 2HUEB 1M19D 1BH8A 5AV6D 1W2EA 1EQZD 3AZHB 1TZYA 5AY8C 2JSSA 3UTBB 3AZID 3KFUG 5AVBC 2YFVA 3AZGD 1F66D 1U35A 5B1MA 3AYWB 3AZFC 5AV8C 1P3AA 5F99D 5GSUC 2XD1A 1AOID 4Z5TB 1KX3A 5B2IA 5AV9D 4X23D 1P34A 5C3IC 3MGQC 1P3KB 1P3LD 3LZ1C 5GT3B 1ZLAC 3B6FB 1KX4D 4R8PC 4EO5B 5B33C 1ID3C 3AN2C 3MGSA 3REIC 4ZUXD 3IP4C 2BYMA 4CAYA 5B40D 4Z66A 3AFAD 3UT9C 4YM6D 1P3BB 3C1BD 2IO5B 5GT0B 3AZGC 1F66C 1P3KA 3AZEC 4HGAC 4UUZB 2LY8A 4AWLB 5AVBB 3O62C 3TU4D 1AOIC 3WAAD 3AZMA 2CWEA 3NQUB 4H9RA 3KWQD 3VH6W 1M1AB 1P3LC 2YFWA 5BNXB 5B32B 1KX4C 2FJ7D 3MGQB 3X1UC 3H0MC 3LZ1B 4YS3B 5AY8A 1ZLAB 4ZUXC 1P3FD 5B0YC 4R8PB 5AVBA 1ID3B 5BNVA
chains in the Genus database with same CATH topology
5B40C 3REKB 5AV8A 3AFAC 3AZFA 1M19B 3C1BC 5E5AC 5AV6B 5GSUA 1EQZB 2PYOD 3WTPD 3B0CW 3AZIB 2ZY5A 3AZGB 3MGQA 1F66B 3TU4C 3LZ1A 5F99B 1F1EA 5B33A 4J8UB 3AN2A 3REIA 4DQYB 3UTAC 5AV9B 4X23B 4G91C 1WWIA 3X1VC 4KGCD 1P3LB 3W98D 3UT9A 4XZQD 3LJAD 3KXBD 1F66A 3AZEA 3X1TC 5JRGD 4ZUXB 4G92B 3O62A 1AOIA 5B40B 3AFAB 4YM6B 3C1BB 4WU8D 1M18D 1P3LA 2DQNC 5CPID 1KX4A 4WNNA 3TU4B 3X1UA 3WAAB 2CV5C 3KWQB 4ZUXA 5B0YA 3NQJB 3C1CD 5B2JC 5B0ZC 1TAFB 3AFAA 2F8NH 3W98C 4G91B 5E5AA 3C1BA 2FJ7B 3AYWD 5CHLB 1P3FB 5AV5C 4J8XB 4ZBJB 5DNNA 3MGPD 4JJND 3MNNA 2PYOB 3WTPB 4E45A 3UTAA 2ZY2A 1TAFA 2HIOD 3X1VA 1P3OC 3B6GD 4H9OB 2HUEC 3LZ0D 5B1LD 2F8NK 3AZHC 1N1JB 3C1CC 3UTBC 3X1TA 4KGCB 4NE3A 3VH5W 1ULYA 5AVCD 3AYWC 5CPKD 3W98B 4XZQB 4LD9D 3LJAB 2G5IC 4Z5TC 3KXBB 3W99D 5JRGB 2JCHA 3AV1D 5BT1C 5GT3C 2AROD 2CV5A 3B6FC 4WU8B 4EO5C 1M18B 3B6GC 5B2JA 2F8NA 5B0ZA 3W98A 3VH6T 5CPIB 4KUDD 5FUGA 1Q9CA 3FDDA 3B0DC 3V9RB 1P3BC 2BG1A 2IO5C 5GT0C 4KHAB 4CSRB 5AV5A 4UPKA 3C1CB 2NQBD 3W96D 1H3OA 3R45A 1R4VA 4AWLC 2F8NG 4NE5A 2Y2GA 1M1AC 1P3OA 4J8UD 5B31D 5B32C 3MGPB 3REHD 4JJNB 2Y2JA 3AZHA 4YS3C 3H0RC 3C1CA 3UTBA 1P3ID 2HIOB 5B24D 2ZM5A 4Z2MH 3B6GB 4XUJD 3AYWA 3REKC 1M19C 3LZ0B 5B1LB 5AV6C 1EQZC 1BH9B 4Z5TA 3B0DB 3W96C 3AZIC 3AZJD 5AVCB 5GT3A 5CPKB 3B6FA 3EG5B 5G49B 5F99C 4LD9B 3W99B 3B6GA 4J8UC 1S32D 5AV9C 4X23C 3AV1B 3A6ND 2NZDD 2AROB 1P3IC 4QLCD 1P3BA 5GT0A 3AV2D 1KU5A 4UUZA 2J8PA 4H9NB 2XD5A 4G92C 4KUDB 3LELD 4H9PB 3NQUA 4YM6C 1A7WA 1M1AA 1JFIB 2L5AA 3AZLD 1WWSA 3W96B 2NQBB 3REJD 5CPJD 5BNXA 5B32A 2BYKB 3AL0C 3WAAC 3AZND 4YS3A 1S32C 3KWQC 1ZLAA 3B0BA 4H9NA 4R8PA 1ID3A 3A6NC 5B31B 5KDMB 4H9PA 3REKA 2RIQA 3REHB 1M19A 2FJ7C 1B67A 5AV6A 3AV2C 3MVDD 1EQZA 3MGRD 3W96A 1P3IB 3AZIA 3X1SD 1P3FC 1HQ3D 5B32G 5B24B 3AZGA 4J8XC 4XUJB 4ZBJC 2Y2PA 2UWXA 5F99A 2RVQD 2PYOC 1HTAA 4Z2MG 3VH5A 3VH5T 4J8UA 3WTPC 3REJC 5CPJC 1KX5D 5AV9A 4X23A 3AZJB 5GXQD 2JE5A 1P3IA 2Y2IA 1S32B 4KGCC 4WU9D 3A6NB 2NZDB 5B40A 4NE6A 4XZQC 4YM6A 4QLCB 1P3PD 3LJAC 3KXBC 3AV2B 1BFMA 5JRGC 4J8VD 1TZYD 4M6BA 3TU4A 3LELB 3WAAA 3WA9B 1S32A 3KWQA 4WU8C 1U35D 5B1MD 1M18C 1P3AD 3AZLB 3NQJA 3A6NA 4J8WD 3REJB 5CPJB 5CPIC 2FJ7A 4WV4B 1KX3D 3AV2A 3H0LC 3AZNB 1P34D 1P3FA 5JA4B 4J8XA 3W97D 1P3PC 3MGSD 3MVDB 1P3GD 3MGRB 2PYOA 2VQRA 3WTPA 3REJA 5CPJA 3X1SB 4J8VC 1HQ3B 4Z66D 2Y2NA 4H9OA 3MGPC 4J8XD 4JJNC 1N1JA 5JA4A 4WZSB 4J8WC 1KX5B 2HIOC 5GXQB 3AZMD 4KGCA 5DNMD 2Y2HA 3LZ0C 5B1LC 3VH6A 4XZQA 3LJAA 3KXBA 5BS7C 3W97C 3A1KA 5JRGA 1T3UA 1P3GC 4WU9B 5AVCC 5CPKC 1P3PB 4WU8A 4LD9C 1M18A 2Y2MA 3W99C 5AV8D 3AZFD 1BH8B 5GSUD 4J8VB 1TZYB 1Z2CB 5CPIA 3AV1C 3V9RA 2AROC 3B0CT 2YFVB 4KHAA 5B1MB 1U35B 1P3AB 4CSRA 4J8WB 5DNMC 5B33D 3WTPE 4KUDC 1KX3B 3AN2D 3REID 3A1IA 5B2IB 1P34B 4J8VA 3UT9D 2NQBC 3W97B 3MGPA 4JJNA 3AZED 2ZY4A 3MGSB 1P3GB 4J8WA 2BYMB 3O62D 2HIOA 4CAYB 4Z66B 5B31C 3LZ0A 3REHC 5B1LA 5BO0B 1BH9A 5BS7A 2Y2OA 3W97A 5B24C 3X1UD 3AZMB 4H9RB 4XUJC 1P3GA 5AVCA 5DNMB 5B0YD 5CPKA 5G49A 4LD9A 4NFTA 2YFWB 3KUYD 3W99A 3WA9D 5E5AD 3AZJC 1B6WA 5BO0A 1P3MD 3AV1A 5AY8B 2AROA 2Y2KA 5BNVB 3AZKD 5DNND 3AZFB 5AV8B 2Y2LA 5DNMA 3MNND 5GSUB 4KUDA 3UTAD 3WKJD 2NZDC 3EPJA 4QLCC 5C3IB 3EPKA 3X1VD 1JFIA 5CP6D 2NQBA 2BYKA 5B33B 3AN2B 3REIB 3X1TD 3LELC 3KUYC 3WA9C 2W8SA 3EPLA 3AZLC 1P3MC 3UT9B 5B31A 5KDMA 3REHA 3AZEB 4HGAB 3AZKC 5DNNC 3F6TA 3AZNC 3O62B 3MNNC 3EPHA 5B24A 2F2AC 1AOIB 2CV5D 4XUJA 3WKJC 3MVDC 5B2JD 3MGRC 2F8ND 5B0ZD 5CP6C 3RELD 1KX4B 5B31G 3X1SC 4WNNB 1HQ3C 3AZJA 3X1UB 4E44A 5B0YB 5AV5D 2RVQC 3KUYB 1KX5C 5E5AB 5GXQC 1P3MB 4H9SC 2NZDA 4QLCA 4H9QB 1P3OD 3AZKB 5DNNB 5B2ID 2ZY3A 3MNNB 3AZHD 4WU9C 3UTBD 3UTAB 3LELA 3KUYA 3WKJB 3RELC 3WA9A 2DF4C 3X1VB 2G5HC 3AZLA 3KSYA 1P3MA 5CP6B 4H9QA 1TZYC 4Z5TD 3AZKA 3X1TB 3AZNA 1P3KD 1U35C 5B1MC 4WJ3C 5BT1D 1P3AC 5GT3D 3B6FD 3WKJA 4DRAA 1KX3C 3MVDA 3MGRA 5B2IC 5CP6A 1P34C 3X1SA 1HQ3A 2CV5B 1P3BD 5GT0D 3MGSC 5AY8D 5B2JB 2F8NB 4DRBA 5B0ZB 3RELB 1KX5A 2FFFB 5AVBD 5FUGB 1PZRA 4Z66C 5GXQA 4H9SA 1M1AD 1P3KC 5AV5B 1H3OB 3R45B 5B32D 3MGQD 3AZMC 4YS3D 3LZ1D 4WU9A 1ZLAD 3RELA 4R8PD 3P5JB 1P3PA 2Y2QA 1P3OB 1ID3D 3REKD 2HUEB 1M19D 1BH8A 5AV6D 1W2EA 1EQZD 3AZHB 1TZYA 5AY8C 2JSSA 3UTBB 3AZID 3KFUG 5AVBC 2YFVA 3AZGD 1F66D 1U35A 5B1MA 3AYWB 3AZFC 5AV8C 1P3AA 5F99D 5GSUC 2XD1A 1AOID 4Z5TB 1KX3A 5B2IA 5AV9D 4X23D 1P34A 5C3IC 3MGQC 1P3KB 1P3LD 3LZ1C 5GT3B 1ZLAC 3B6FB 1KX4D 4R8PC 4EO5B 5B33C 1ID3C 3AN2C 3MGSA 3REIC 4ZUXD 3IP4C 2BYMA 4CAYA 5B40D 4Z66A 3AFAD 3UT9C 4YM6D 1P3BB 3C1BD 2IO5B 5GT0B 3AZGC 1F66C 1P3KA 3AZEC 4HGAC 4UUZB 2LY8A 4AWLB 5AVBB 3O62C 3TU4D 1AOIC 3WAAD 3AZMA 2CWEA 3NQUB 4H9RA 3KWQD 3VH6W 1M1AB 1P3LC 2YFWA 5BNXB 5B32B 1KX4C 2FJ7D 3MGQB 3X1UC 3H0MC 3LZ1B 4YS3B 5AY8A 1ZLAB 4ZUXC 1P3FD 5B0YC 4R8PB 5AVBA 1ID3B 5BNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 C;  3REK B;  5AV8 A;  3AFA C;  3AZF A;  1M19 B;  3C1B C;  5E5A C;  5AV6 B;  5GSU A;  1EQZ B;  2PYO D;  3WTP D;  3B0C W;  3AZI B;  3AZG B;  3MGQ A;  1F66 B;  3TU4 C;  3LZ1 A;  5F99 B;  1F1E A;  5B33 A;  4J8U B;  3AN2 A;  3REI A;  3UTA C;  5AV9 B;  4X23 B;  4G91 C;  1WWI A;  3X1V C;  4KGC D;  1P3L B;  3W98 D;  3UT9 A;  4XZQ D;  3LJA D;  3KXB D;  1F66 A;  3AZE A;  3X1T C;  5JRG D;  4ZUX B;  4G92 B;  3O62 A;  1AOI A;  5B40 B;  3AFA B;  4YM6 B;  3C1B B;  4WU8 D;  1M18 D;  1P3L A;  1KX4 A;  5CPI D;  4WNN A;  3TU4 B;  3X1U A;  3WAA B;  2CV5 C;  3KWQ B;  4ZUX A;  5B0Y A;  3NQJ B;  3C1C D;  5B2J C;  5B0Z C;  1TAF B;  3AFA A;  2F8N H;  3W98 C;  4G91 B;  5E5A A;  3C1B A;  2FJ7 B;  3AYW D;  5CHL B;  1P3F B;  5AV5 C;  4J8X B;  4ZBJ B;  5DNN A;  3MGP D;  4JJN D;  3MNN A;  2PYO B;  3WTP B;  4E45 A;  3UTA A;  1TAF A;  2HIO D;  3X1V A;  1P3O C;  3B6G D;  4H9O B;  2HUE C;  3LZ0 D;  5B1L D;  2F8N K;  3AZH C;  1N1J B;  3C1C C;  3UTB C;  3X1T A;  4KGC B;  4NE3 A;  3VH5 W;  1ULY A;  5AVC D;  3AYW C;  5CPK D;  3W98 B;  4XZQ B;  4LD9 D;  3LJA B;  4Z5T C;  3KXB B;  3W99 D;  5JRG B;  3AV1 D;  5BT1 C;  5GT3 C;  2ARO D;  2CV5 A;  3B6F C;  4WU8 B;  4EO5 C;  1M18 B;  3B6G C;  5B2J A;  2F8N A;  5B0Z A;  3W98 A;  3VH6 T;  5CPI B;  4KUD D;  5FUG A;  1Q9C A;  3B0D C;  3V9R B;  1P3B C;  2IO5 C;  5GT0 C;  4KHA B;  4CSR B;  5AV5 A;  3C1C B;  2NQB D;  3W96 D;  1H3O A;  3R45 A;  1R4V A;  4AWL C;  2F8N G;  4NE5 A;  1M1A C;  1P3O A;  4J8U D;  5B31 D;  5B32 C;  3MGP B;  3REH D;  4JJN B;  3AZH A;  4YS3 C;  3C1C A;  3UTB A;  1P3I D;  2HIO B;  5B24 D;  4Z2M H;  3B6G B;  4XUJ D;  3AYW A;  3REK C;  1M19 C;  3LZ0 B;  5B1L B;  5AV6 C;  1EQZ C;  1BH9 B;  4Z5T A;  3B0D B;  3W96 C;  3AZI C;  3AZJ D;  5AVC B;  5GT3 A;  5CPK B;  3B6F A;  5G49 B;  5F99 C;  4LD9 B;  3W99 B;  3B6G A;  4J8U C;  1S32 D;  5AV9 C;  4X23 C;  3AV1 B;  3A6N D;  2NZD D;  2ARO B;  1P3I C;  4QLC D;  1P3B A;  5GT0 A;  3AV2 D;  1KU5 A;  4UUZ A;  4H9N B;  4G92 C;  4KUD B;  3LEL D;  4H9P B;  3NQU A;  4YM6 C;  1A7W A;  1M1A A;  1JFI B;  2L5A A;  3AZL D;  1WWS A;  3W96 B;  2NQB B;  3REJ D;  5CPJ D;  5BNX A;  5B32 A;  2BYK B;  3WAA C;  3AZN D;  4YS3 A;  1S32 C;  3KWQ C;  1ZLA A;  3B0B A;  4H9N A;  4R8P A;  1ID3 A;  3A6N C;  5B31 B;  5KDM B;  4H9P A;  3REK A;  1M19 A;  3REH B;  2FJ7 C;  1B67 A;  5AV6 A;  3AV2 C;  3MVD D;  1EQZ A;  3MGR D;  3W96 A;  1P3I B;  3AZI A;  3X1S D;  1P3F C;  1HQ3 D;  5B32 G;  5B24 B;  3AZG A;  4J8X C;  4XUJ B;  4ZBJ C;  5F99 A;  2RVQ D;  2PYO C;  1HTA A;  4Z2M G;  3VH5 A;  3VH5 T;  4J8U A;  3WTP C;  3REJ C;  5CPJ C;  1KX5 D;  5AV9 A;  4X23 A;  3AZJ B;  5GXQ D;  1P3I A;  1S32 B;  4KGC C;  4WU9 D;  3A6N B;  2NZD B;  5B40 A;  4NE6 A;  4XZQ C;  4YM6 A;  4QLC B;  1P3P D;  3LJA C;  3KXB C;  3AV2 B;  1BFM A;  5JRG C;  4J8V D;  1TZY D;  4M6B A;  3TU4 A;  3LEL B;  3WAA A;  3WA9 B;  1S32 A;  3KWQ A;  4WU8 C;  1U35 D;  5B1M D;  1M18 C;  1P3A D;  3AZL B;  3NQJ A;  3A6N A;  4J8W D;  3REJ B;  5CPJ B;  5CPI C;  2FJ7 A;  4WV4 B;  1KX3 D;  3AV2 A;  3AZN B;  1P34 D;  1P3F A;  5JA4 B;  4J8X A;  3W97 D;  1P3P C;  3MGS D;  3MVD B;  1P3G D;  3MGR B;  2PYO A;  3WTP A;  3REJ A;  5CPJ A;  3X1S B;  4J8V C;  1HQ3 B;  4Z66 D;  4H9O A;  3MGP C;  4J8X D;  4JJN C;  1N1J A;  5JA4 A;  4WZS B;  4J8W C;  1KX5 B;  2HIO C;  5GXQ B;  3AZM D;  4KGC A;  5DNM D;  3LZ0 C;  5B1L C;  3VH6 A;  4XZQ A;  3LJA A;  3KXB A;  5BS7 C;  3W97 C;  5JRG A;  1P3G C;  4WU9 B;  5AVC C;  5CPK C;  1P3P B;  4WU8 A;  4LD9 C;  1M18 A;  3AZF D;  3W99 C;  5AV8 D;  1BH8 B;  5GSU D;  4J8V B;  1TZY B;  5CPI A;  3AV1 C;  3V9R A;  2ARO C;  3B0C T;  2YFV B;  4KHA A;  5B1M B;  1U35 B;  1P3A B;  4CSR A;  4J8W B;  5DNM C;  5B33 D;  3WTP E;  4KUD C;  1KX3 B;  3AN2 D;  3REI D;  5B2I B;  1P34 B;  4J8V A;  3UT9 D;  2NQB C;  3W97 B;  3MGP A;  4JJN A;  3AZE D;  3MGS B;  1P3G B;  4J8W A;  2BYM B;  3O62 D;  2HIO A;  4CAY B;  4Z66 B;  5B31 C;  3LZ0 A;  3REH C;  5B1L A;  5BO0 B;  1BH9 A;  5BS7 A;  3W97 A;  5B24 C;  3X1U D;  3AZM B;  4H9R B;  4XUJ C;  1P3G A;  5AVC A;  5DNM B;  5B0Y D;  5CPK A;  5G49 A;  4LD9 A;  4NFT A;  2YFW B;  3KUY D;  3W99 A;  3WA9 D;  5E5A D;  3AZJ C;  1B6W A;  5BO0 A;  1P3M D;  3AV1 A;  5AY8 B;  2ARO A;  5BNV B;  3AZK D;  5DNN D;  3AZF B;  5AV8 B;  5DNM A;  3MNN D;  5GSU B;  4KUD A;  3UTA D;  3WKJ D;  2NZD C;  4QLC C;  5C3I B;  3X1V D;  1JFI A;  5CP6 D;  2NQB A;  2BYK A;  5B33 B;  3AN2 B;  3REI B;  3X1T D;  3LEL C;  3KUY C;  3WA9 C;  3AZL C;  1P3M C;  3UT9 B;  5B31 A;  5KDM A;  3REH A;  3AZE B;  4HGA B;  3AZK C;  5DNN C;  3AZN C;  3O62 B;  3MNN C;  5B24 A;  1AOI B;  2CV5 D;  4XUJ A;  3WKJ C;  3MVD C;  5B2J D;  3MGR C;  2F8N D;  5B0Z D;  5CP6 C;  3REL D;  1KX4 B;  5B31 G;  3X1S C;  4WNN B;  1HQ3 C;  3AZJ A;  3X1U B;  4E44 A;  5B0Y B;  5AV5 D;  2RVQ C;  3KUY B;  1KX5 C;  5E5A B;  5GXQ C;  1P3M B;  4H9S C;  2NZD A;  4QLC A;  4H9Q B;  1P3O D;  3AZK B;  5DNN B;  5B2I D;  3MNN B;  3AZH D;  4WU9 C;  3UTB D;  3UTA B;  3LEL A;  3KUY A;  3WKJ B;  3REL C;  3WA9 A;  3X1V B;  3AZL A;  3KSY A;  1P3M A;  5CP6 B;  4H9Q A;  1TZY C;  4Z5T D;  3AZK A;  3X1T B;  3AZN A;  1P3K D;  1U35 C;  5B1M C;  5BT1 D;  1P3A C;  5GT3 D;  3B6F D;  3WKJ A;  4DRA A;  1KX3 C;  3MVD A;  3MGR A;  5B2I C;  5CP6 A;  1P34 C;  3X1S A;  1HQ3 A;  2CV5 B;  1P3B D;  5GT0 D;  3MGS C;  5AY8 D;  5B2J B;  2F8N B;  4DRB A;  5B0Z B;  3REL B;  1KX5 A;  5AVB D;  5FUG B;  4Z66 C;  5GXQ A;  4H9S A;  1M1A D;  1P3K C;  5AV5 B;  1H3O B;  3R45 B;  5B32 D;  3MGQ D;  3AZM C;  4YS3 D;  3LZ1 D;  4WU9 A;  1ZLA D;  3REL A;  4R8P D;  1P3P A;  1P3O B;  1ID3 D;  3REK D;  2HUE B;  1M19 D;  1BH8 A;  5AV6 D;  1EQZ D;  3AZH B;  1TZY A;  5AY8 C;  2JSS A;  3UTB B;  3AZI D;  5AVB C;  2YFV A;  3AZG D;  1F66 D;  1U35 A;  5B1M A;  3AYW B;  3AZF C;  5AV8 C;  1P3A A;  5F99 D;  5GSU C;  1AOI D;  4Z5T B;  1KX3 A;  5B2I A;  5AV9 D;  4X23 D;  1P34 A;  5C3I C;  3MGQ C;  1P3K B;  1P3L D;  3LZ1 C;  5GT3 B;  1ZLA C;  3B6F B;  1KX4 D;  4R8P C;  4EO5 B;  5B33 C;  1ID3 C;  3AN2 C;  3MGS A;  3REI C;  4ZUX D;  2BYM A;  4Z66 A;  5B40 D;  4CAY A;  3AFA D;  3UT9 C;  4YM6 D;  1P3B B;  3C1B D;  2IO5 B;  5GT0 B;  3AZG C;  1F66 C;  1P3K A;  3AZE C;  4HGA C;  4UUZ B;  2LY8 A;  4AWL B;  5AVB B;  3O62 C;  3TU4 D;  1AOI C;  3WAA D;  3AZM A;  2CWE A;  3NQU B;  4H9R A;  3KWQ D;  3VH6 W;  1M1A B;  1P3L C;  2YFW A;  5BNX B;  5B32 B;  1KX4 C;  2FJ7 D;  3MGQ B;  3X1U C;  3LZ1 B;  4YS3 B;  5AY8 A;  1ZLA B;  4ZUX C;  1P3F D;  5B0Y C;  4R8P B;  5AVB A;  1ID3 B;  5BNV A; 
#chains in the Genus database with same CATH topology
 5B40 C;  3REK B;  5AV8 A;  3AFA C;  3AZF A;  1M19 B;  3C1B C;  5E5A C;  5AV6 B;  5GSU A;  1EQZ B;  2PYO D;  3WTP D;  3B0C W;  3AZI B;  2ZY5 A;  3AZG B;  3MGQ A;  1F66 B;  3TU4 C;  3LZ1 A;  5F99 B;  1F1E A;  5B33 A;  4J8U B;  3AN2 A;  3REI A;  4DQY B;  3UTA C;  5AV9 B;  4X23 B;  4G91 C;  1WWI A;  3X1V C;  4KGC D;  1P3L B;  3W98 D;  3UT9 A;  4XZQ D;  3LJA D;  3KXB D;  1F66 A;  3AZE A;  3X1T C;  5JRG D;  4ZUX B;  4G92 B;  3O62 A;  1AOI A;  5B40 B;  3AFA B;  4YM6 B;  3C1B B;  4WU8 D;  1M18 D;  1P3L A;  2DQN C;  5CPI D;  1KX4 A;  4WNN A;  3TU4 B;  3X1U A;  3WAA B;  2CV5 C;  3KWQ B;  4ZUX A;  5B0Y A;  3NQJ B;  3C1C D;  5B2J C;  5B0Z C;  1TAF B;  3AFA A;  2F8N H;  3W98 C;  4G91 B;  5E5A A;  3C1B A;  2FJ7 B;  3AYW D;  5CHL B;  1P3F B;  5AV5 C;  4J8X B;  4ZBJ B;  5DNN A;  3MGP D;  4JJN D;  3MNN A;  2PYO B;  3WTP B;  4E45 A;  3UTA A;  2ZY2 A;  1TAF A;  2HIO D;  3X1V A;  1P3O C;  3B6G D;  4H9O B;  2HUE C;  3LZ0 D;  5B1L D;  2F8N K;  3AZH C;  1N1J B;  3C1C C;  3UTB C;  3X1T A;  4KGC B;  4NE3 A;  3VH5 W;  1ULY A;  5AVC D;  3AYW C;  5CPK D;  3W98 B;  4XZQ B;  4LD9 D;  3LJA B;  2G5I C;  4Z5T C;  3KXB B;  3W99 D;  5JRG B;  2JCH A;  3AV1 D;  5BT1 C;  5GT3 C;  2ARO D;  2CV5 A;  3B6F C;  4WU8 B;  4EO5 C;  1M18 B;  3B6G C;  5B2J A;  2F8N A;  5B0Z A;  3W98 A;  3VH6 T;  5CPI B;  4KUD D;  5FUG A;  1Q9C A;  3FDD A;  3B0D C;  3V9R B;  1P3B C;  2BG1 A;  2IO5 C;  5GT0 C;  4KHA B;  4CSR B;  5AV5 A;  4UPK A;  3C1C B;  2NQB D;  3W96 D;  1H3O A;  3R45 A;  1R4V A;  4AWL C;  2F8N G;  4NE5 A;  2Y2G A;  1M1A C;  1P3O A;  4J8U D;  5B31 D;  5B32 C;  3MGP B;  3REH D;  4JJN B;  2Y2J A;  3AZH A;  4YS3 C;  3H0R C;  3C1C A;  3UTB A;  1P3I D;  2HIO B;  5B24 D;  2ZM5 A;  4Z2M H;  3B6G B;  4XUJ D;  3AYW A;  3REK C;  1M19 C;  3LZ0 B;  5B1L B;  5AV6 C;  1EQZ C;  1BH9 B;  4Z5T A;  3B0D B;  3W96 C;  3AZI C;  3AZJ D;  5AVC B;  5GT3 A;  5CPK B;  3B6F A;  3EG5 B;  5G49 B;  5F99 C;  4LD9 B;  3W99 B;  3B6G A;  4J8U C;  1S32 D;  5AV9 C;  4X23 C;  3AV1 B;  3A6N D;  2NZD D;  2ARO B;  1P3I C;  4QLC D;  1P3B A;  5GT0 A;  3AV2 D;  1KU5 A;  4UUZ A;  2J8P A;  4H9N B;  2XD5 A;  4G92 C;  4KUD B;  3LEL D;  4H9P B;  3NQU A;  4YM6 C;  1A7W A;  1M1A A;  1JFI B;  2L5A A;  3AZL D;  1WWS A;  3W96 B;  2NQB B;  3REJ D;  5CPJ D;  5BNX A;  5B32 A;  2BYK B;  3AL0 C;  3WAA C;  3AZN D;  4YS3 A;  1S32 C;  3KWQ C;  1ZLA A;  3B0B A;  4H9N A;  4R8P A;  1ID3 A;  3A6N C;  5B31 B;  5KDM B;  4H9P A;  3REK A;  2RIQ A;  3REH B;  1M19 A;  2FJ7 C;  1B67 A;  5AV6 A;  3AV2 C;  3MVD D;  1EQZ A;  3MGR D;  3W96 A;  1P3I B;  3AZI A;  3X1S D;  1P3F C;  1HQ3 D;  5B32 G;  5B24 B;  3AZG A;  4J8X C;  4XUJ B;  4ZBJ C;  2Y2P A;  2UWX A;  5F99 A;  2RVQ D;  2PYO C;  1HTA A;  4Z2M G;  3VH5 A;  3VH5 T;  4J8U A;  3WTP C;  3REJ C;  5CPJ C;  1KX5 D;  5AV9 A;  4X23 A;  3AZJ B;  5GXQ D;  2JE5 A;  1P3I A;  2Y2I A;  1S32 B;  4KGC C;  4WU9 D;  3A6N B;  2NZD B;  5B40 A;  4NE6 A;  4XZQ C;  4YM6 A;  4QLC B;  1P3P D;  3LJA C;  3KXB C;  3AV2 B;  1BFM A;  5JRG C;  4J8V D;  1TZY D;  4M6B A;  3TU4 A;  3LEL B;  3WAA A;  3WA9 B;  1S32 A;  3KWQ A;  4WU8 C;  1U35 D;  5B1M D;  1M18 C;  1P3A D;  3AZL B;  3NQJ A;  3A6N A;  4J8W D;  3REJ B;  5CPJ B;  5CPI C;  2FJ7 A;  4WV4 B;  1KX3 D;  3AV2 A;  3H0L C;  3AZN B;  1P34 D;  1P3F A;  5JA4 B;  4J8X A;  3W97 D;  1P3P C;  3MGS D;  3MVD B;  1P3G D;  3MGR B;  2PYO A;  2VQR A;  3WTP A;  3REJ A;  5CPJ A;  3X1S B;  4J8V C;  1HQ3 B;  4Z66 D;  2Y2N A;  4H9O A;  3MGP C;  4J8X D;  4JJN C;  1N1J A;  5JA4 A;  4WZS B;  4J8W C;  1KX5 B;  2HIO C;  5GXQ B;  3AZM D;  4KGC A;  5DNM D;  2Y2H A;  3LZ0 C;  5B1L C;  3VH6 A;  4XZQ A;  3LJA A;  3KXB A;  5BS7 C;  3W97 C;  3A1K A;  5JRG A;  1T3U A;  1P3G C;  4WU9 B;  5AVC C;  5CPK C;  1P3P B;  4WU8 A;  4LD9 C;  1M18 A;  2Y2M A;  3W99 C;  5AV8 D;  3AZF D;  1BH8 B;  5GSU D;  4J8V B;  1TZY B;  1Z2C B;  5CPI A;  3AV1 C;  3V9R A;  2ARO C;  3B0C T;  2YFV B;  4KHA A;  5B1M B;  1U35 B;  1P3A B;  4CSR A;  4J8W B;  5DNM C;  5B33 D;  3WTP E;  4KUD C;  1KX3 B;  3AN2 D;  3REI D;  3A1I A;  5B2I B;  1P34 B;  4J8V A;  3UT9 D;  2NQB C;  3W97 B;  3MGP A;  4JJN A;  3AZE D;  2ZY4 A;  3MGS B;  1P3G B;  4J8W A;  2BYM B;  3O62 D;  2HIO A;  4CAY B;  4Z66 B;  5B31 C;  3LZ0 A;  3REH C;  5B1L A;  5BO0 B;  1BH9 A;  5BS7 A;  2Y2O A;  3W97 A;  5B24 C;  3X1U D;  3AZM B;  4H9R B;  4XUJ C;  1P3G A;  5AVC A;  5DNM B;  5B0Y D;  5CPK A;  5G49 A;  4LD9 A;  4NFT A;  2YFW B;  3KUY D;  3W99 A;  3WA9 D;  5E5A D;  3AZJ C;  1B6W A;  5BO0 A;  1P3M D;  3AV1 A;  5AY8 B;  2ARO A;  2Y2K A;  5BNV B;  3AZK D;  5DNN D;  3AZF B;  5AV8 B;  2Y2L A;  5DNM A;  3MNN D;  5GSU B;  4KUD A;  3UTA D;  3WKJ D;  2NZD C;  3EPJ A;  4QLC C;  5C3I B;  3EPK A;  3X1V D;  1JFI A;  5CP6 D;  2NQB A;  2BYK A;  5B33 B;  3AN2 B;  3REI B;  3X1T D;  3LEL C;  3KUY C;  3WA9 C;  2W8S A;  3EPL A;  3AZL C;  1P3M C;  3UT9 B;  5B31 A;  5KDM A;  3REH A;  3AZE B;  4HGA B;  3AZK C;  5DNN C;  3F6T A;  3AZN C;  3O62 B;  3MNN C;  3EPH A;  5B24 A;  2F2A C;  1AOI B;  2CV5 D;  4XUJ A;  3WKJ C;  3MVD C;  5B2J D;  3MGR C;  2F8N D;  5B0Z D;  5CP6 C;  3REL D;  1KX4 B;  5B31 G;  3X1S C;  4WNN B;  1HQ3 C;  3AZJ A;  3X1U B;  4E44 A;  5B0Y B;  5AV5 D;  2RVQ C;  3KUY B;  1KX5 C;  5E5A B;  5GXQ C;  1P3M B;  4H9S C;  2NZD A;  4QLC A;  4H9Q B;  1P3O D;  3AZK B;  5DNN B;  5B2I D;  2ZY3 A;  3MNN B;  3AZH D;  4WU9 C;  3UTB D;  3UTA B;  3LEL A;  3KUY A;  3WKJ B;  3REL C;  3WA9 A;  2DF4 C;  3X1V B;  2G5H C;  3AZL A;  3KSY A;  1P3M A;  5CP6 B;  4H9Q A;  1TZY C;  4Z5T D;  3AZK A;  3X1T B;  3AZN A;  1P3K D;  1U35 C;  5B1M C;  4WJ3 C;  5BT1 D;  1P3A C;  5GT3 D;  3B6F D;  3WKJ A;  4DRA A;  1KX3 C;  3MVD A;  3MGR A;  5B2I C;  5CP6 A;  1P34 C;  3X1S A;  1HQ3 A;  2CV5 B;  1P3B D;  5GT0 D;  3MGS C;  5AY8 D;  5B2J B;  2F8N B;  4DRB A;  5B0Z B;  3REL B;  1KX5 A;  2FFF B;  5AVB D;  5FUG B;  1PZR A;  4Z66 C;  5GXQ A;  4H9S A;  1M1A D;  1P3K C;  5AV5 B;  1H3O B;  3R45 B;  5B32 D;  3MGQ D;  3AZM C;  4YS3 D;  3LZ1 D;  4WU9 A;  1ZLA D;  3REL A;  4R8P D;  3P5J B;  1P3P A;  2Y2Q A;  1P3O B;  1ID3 D;  3REK D;  2HUE B;  1M19 D;  1BH8 A;  5AV6 D;  1W2E A;  1EQZ D;  3AZH B;  1TZY A;  5AY8 C;  2JSS A;  3UTB B;  3AZI D;  3KFU G;  5AVB C;  2YFV A;  3AZG D;  1F66 D;  1U35 A;  5B1M A;  3AYW B;  3AZF C;  5AV8 C;  1P3A A;  5F99 D;  5GSU C;  2XD1 A;  1AOI D;  4Z5T B;  1KX3 A;  5B2I A;  5AV9 D;  4X23 D;  1P34 A;  5C3I C;  3MGQ C;  1P3K B;  1P3L D;  3LZ1 C;  5GT3 B;  1ZLA C;  3B6F B;  1KX4 D;  4R8P C;  4EO5 B;  5B33 C;  1ID3 C;  3AN2 C;  3MGS A;  3REI C;  4ZUX D;  3IP4 C;  2BYM A;  4CAY A;  5B40 D;  4Z66 A;  3AFA D;  3UT9 C;  4YM6 D;  1P3B B;  3C1B D;  2IO5 B;  5GT0 B;  3AZG C;  1F66 C;  1P3K A;  3AZE C;  4HGA C;  4UUZ B;  2LY8 A;  4AWL B;  5AVB B;  3O62 C;  3TU4 D;  1AOI C;  3WAA D;  3AZM A;  2CWE A;  3NQU B;  4H9R A;  3KWQ D;  3VH6 W;  1M1A B;  1P3L C;  2YFW A;  5BNX B;  5B32 B;  1KX4 C;  2FJ7 D;  3MGQ B;  3X1U C;  3H0M C;  3LZ1 B;  4YS3 B;  5AY8 A;  1ZLA B;  4ZUX C;  1P3F D;  5B0Y C;  4R8P B;  5AVB A;  1ID3 B;  5BNV A; 
#chains in the Genus database with same CATH homology
 5B40 C;  3REK B;  5AV8 A;  3AFA C;  3AZF A;  1M19 B;  3C1B C;  5E5A C;  5AV6 B;  5GSU A;  1EQZ B;  2PYO D;  3WTP D;  3B0C W;  3AZI B;  2ZY5 A;  3AZG B;  3MGQ A;  1F66 B;  3TU4 C;  3LZ1 A;  5F99 B;  1F1E A;  5B33 A;  4J8U B;  3AN2 A;  3REI A;  4DQY B;  3UTA C;  5AV9 B;  4X23 B;  4G91 C;  1WWI A;  3X1V C;  4KGC D;  1P3L B;  3W98 D;  3UT9 A;  4XZQ D;  3LJA D;  3KXB D;  1F66 A;  3AZE A;  3X1T C;  5JRG D;  4ZUX B;  4G92 B;  3O62 A;  1AOI A;  5B40 B;  3AFA B;  4YM6 B;  3C1B B;  4WU8 D;  1M18 D;  1P3L A;  2DQN C;  5CPI D;  1KX4 A;  4WNN A;  3TU4 B;  3X1U A;  3WAA B;  2CV5 C;  3KWQ B;  4ZUX A;  5B0Y A;  3NQJ B;  3C1C D;  5B2J C;  5B0Z C;  1TAF B;  3AFA A;  2F8N H;  3W98 C;  4G91 B;  5E5A A;  3C1B A;  2FJ7 B;  3AYW D;  5CHL B;  1P3F B;  5AV5 C;  4J8X B;  4ZBJ B;  5DNN A;  3MGP D;  4JJN D;  3MNN A;  2PYO B;  3WTP B;  4E45 A;  3UTA A;  2ZY2 A;  1TAF A;  2HIO D;  3X1V A;  1P3O C;  3B6G D;  4H9O B;  2HUE C;  3LZ0 D;  5B1L D;  2F8N K;  3AZH C;  1N1J B;  3C1C C;  3UTB C;  3X1T A;  4KGC B;  4NE3 A;  3VH5 W;  1ULY A;  5AVC D;  3AYW C;  5CPK D;  3W98 B;  4XZQ B;  4LD9 D;  3LJA B;  2G5I C;  4Z5T C;  3KXB B;  3W99 D;  5JRG B;  2JCH A;  3AV1 D;  5BT1 C;  5GT3 C;  2ARO D;  2CV5 A;  3B6F C;  4WU8 B;  4EO5 C;  1M18 B;  3B6G C;  5B2J A;  2F8N A;  5B0Z A;  3W98 A;  3VH6 T;  5CPI B;  4KUD D;  5FUG A;  1Q9C A;  3FDD A;  3B0D C;  3V9R B;  1P3B C;  2BG1 A;  2IO5 C;  5GT0 C;  4KHA B;  4CSR B;  5AV5 A;  4UPK A;  3C1C B;  2NQB D;  3W96 D;  1H3O A;  3R45 A;  1R4V A;  4AWL C;  2F8N G;  4NE5 A;  2Y2G A;  1M1A C;  1P3O A;  4J8U D;  5B31 D;  5B32 C;  3MGP B;  3REH D;  4JJN B;  2Y2J A;  3AZH A;  4YS3 C;  3H0R C;  3C1C A;  3UTB A;  1P3I D;  2HIO B;  5B24 D;  2ZM5 A;  4Z2M H;  3B6G B;  4XUJ D;  3AYW A;  3REK C;  1M19 C;  3LZ0 B;  5B1L B;  5AV6 C;  1EQZ C;  1BH9 B;  4Z5T A;  3B0D B;  3W96 C;  3AZI C;  3AZJ D;  5AVC B;  5GT3 A;  5CPK B;  3B6F A;  3EG5 B;  5G49 B;  5F99 C;  4LD9 B;  3W99 B;  3B6G A;  4J8U C;  1S32 D;  5AV9 C;  4X23 C;  3AV1 B;  3A6N D;  2NZD D;  2ARO B;  1P3I C;  4QLC D;  1P3B A;  5GT0 A;  3AV2 D;  1KU5 A;  4UUZ A;  2J8P A;  4H9N B;  2XD5 A;  4G92 C;  4KUD B;  3LEL D;  4H9P B;  3NQU A;  4YM6 C;  1A7W A;  1M1A A;  1JFI B;  2L5A A;  3AZL D;  1WWS A;  3W96 B;  2NQB B;  3REJ D;  5CPJ D;  5BNX A;  5B32 A;  2BYK B;  3AL0 C;  3WAA C;  3AZN D;  4YS3 A;  1S32 C;  3KWQ C;  1ZLA A;  3B0B A;  4H9N A;  4R8P A;  1ID3 A;  3A6N C;  5B31 B;  5KDM B;  4H9P A;  3REK A;  2RIQ A;  3REH B;  1M19 A;  2FJ7 C;  1B67 A;  5AV6 A;  3AV2 C;  3MVD D;  1EQZ A;  3MGR D;  3W96 A;  1P3I B;  3AZI A;  3X1S D;  1P3F C;  1HQ3 D;  5B32 G;  5B24 B;  3AZG A;  4J8X C;  4XUJ B;  4ZBJ C;  2Y2P A;  2UWX A;  5F99 A;  2RVQ D;  2PYO C;  1HTA A;  4Z2M G;  3VH5 A;  3VH5 T;  4J8U A;  3WTP C;  3REJ C;  5CPJ C;  1KX5 D;  5AV9 A;  4X23 A;  3AZJ B;  5GXQ D;  2JE5 A;  1P3I A;  2Y2I A;  1S32 B;  4KGC C;  4WU9 D;  3A6N B;  2NZD B;  5B40 A;  4NE6 A;  4XZQ C;  4YM6 A;  4QLC B;  1P3P D;  3LJA C;  3KXB C;  3AV2 B;  1BFM A;  5JRG C;  4J8V D;  1TZY D;  4M6B A;  3TU4 A;  3LEL B;  3WAA A;  3WA9 B;  1S32 A;  3KWQ A;  4WU8 C;  1U35 D;  5B1M D;  1M18 C;  1P3A D;  3AZL B;  3NQJ A;  3A6N A;  4J8W D;  3REJ B;  5CPJ B;  5CPI C;  2FJ7 A;  4WV4 B;  1KX3 D;  3AV2 A;  3H0L C;  3AZN B;  1P34 D;  1P3F A;  5JA4 B;  4J8X A;  3W97 D;  1P3P C;  3MGS D;  3MVD B;  1P3G D;  3MGR B;  2PYO A;  2VQR A;  3WTP A;  3REJ A;  5CPJ A;  3X1S B;  4J8V C;  1HQ3 B;  4Z66 D;  2Y2N A;  4H9O A;  3MGP C;  4J8X D;  4JJN C;  1N1J A;  5JA4 A;  4WZS B;  4J8W C;  1KX5 B;  2HIO C;  5GXQ B;  3AZM D;  4KGC A;  5DNM D;  2Y2H A;  3LZ0 C;  5B1L C;  3VH6 A;  4XZQ A;  3LJA A;  3KXB A;  5BS7 C;  3W97 C;  3A1K A;  5JRG A;  1T3U A;  1P3G C;  4WU9 B;  5AVC C;  5CPK C;  1P3P B;  4WU8 A;  4LD9 C;  1M18 A;  2Y2M A;  3W99 C;  5AV8 D;  3AZF D;  1BH8 B;  5GSU D;  4J8V B;  1TZY B;  1Z2C B;  5CPI A;  3AV1 C;  3V9R A;  2ARO C;  3B0C T;  2YFV B;  4KHA A;  5B1M B;  1U35 B;  1P3A B;  4CSR A;  4J8W B;  5DNM C;  5B33 D;  3WTP E;  4KUD C;  1KX3 B;  3AN2 D;  3REI D;  3A1I A;  5B2I B;  1P34 B;  4J8V A;  3UT9 D;  2NQB C;  3W97 B;  3MGP A;  4JJN A;  3AZE D;  2ZY4 A;  3MGS B;  1P3G B;  4J8W A;  2BYM B;  3O62 D;  2HIO A;  4CAY B;  4Z66 B;  5B31 C;  3LZ0 A;  3REH C;  5B1L A;  5BO0 B;  1BH9 A;  5BS7 A;  2Y2O A;  3W97 A;  5B24 C;  3X1U D;  3AZM B;  4H9R B;  4XUJ C;  1P3G A;  5AVC A;  5DNM B;  5B0Y D;  5CPK A;  5G49 A;  4LD9 A;  4NFT A;  2YFW B;  3KUY D;  3W99 A;  3WA9 D;  5E5A D;  3AZJ C;  1B6W A;  5BO0 A;  1P3M D;  3AV1 A;  5AY8 B;  2ARO A;  2Y2K A;  5BNV B;  3AZK D;  5DNN D;  3AZF B;  5AV8 B;  2Y2L A;  5DNM A;  3MNN D;  5GSU B;  4KUD A;  3UTA D;  3WKJ D;  2NZD C;  3EPJ A;  4QLC C;  5C3I B;  3EPK A;  3X1V D;  1JFI A;  5CP6 D;  2NQB A;  2BYK A;  5B33 B;  3AN2 B;  3REI B;  3X1T D;  3LEL C;  3KUY C;  3WA9 C;  2W8S A;  3EPL A;  3AZL C;  1P3M C;  3UT9 B;  5B31 A;  5KDM A;  3REH A;  3AZE B;  4HGA B;  3AZK C;  5DNN C;  3F6T A;  3AZN C;  3O62 B;  3MNN C;  3EPH A;  5B24 A;  2F2A C;  1AOI B;  2CV5 D;  4XUJ A;  3WKJ C;  3MVD C;  5B2J D;  3MGR C;  2F8N D;  5B0Z D;  5CP6 C;  3REL D;  1KX4 B;  5B31 G;  3X1S C;  4WNN B;  1HQ3 C;  3AZJ A;  3X1U B;  4E44 A;  5B0Y B;  5AV5 D;  2RVQ C;  3KUY B;  1KX5 C;  5E5A B;  5GXQ C;  1P3M B;  4H9S C;  2NZD A;  4QLC A;  4H9Q B;  1P3O D;  3AZK B;  5DNN B;  5B2I D;  2ZY3 A;  3MNN B;  3AZH D;  4WU9 C;  3UTB D;  3UTA B;  3LEL A;  3KUY A;  3WKJ B;  3REL C;  3WA9 A;  2DF4 C;  3X1V B;  2G5H C;  3AZL A;  3KSY A;  1P3M A;  5CP6 B;  4H9Q A;  1TZY C;  4Z5T D;  3AZK A;  3X1T B;  3AZN A;  1P3K D;  1U35 C;  5B1M C;  4WJ3 C;  5BT1 D;  1P3A C;  5GT3 D;  3B6F D;  3WKJ A;  4DRA A;  1KX3 C;  3MVD A;  3MGR A;  5B2I C;  5CP6 A;  1P34 C;  3X1S A;  1HQ3 A;  2CV5 B;  1P3B D;  5GT0 D;  3MGS C;  5AY8 D;  5B2J B;  2F8N B;  4DRB A;  5B0Z B;  3REL B;  1KX5 A;  2FFF B;  5AVB D;  5FUG B;  1PZR A;  4Z66 C;  5GXQ A;  4H9S A;  1M1A D;  1P3K C;  5AV5 B;  1H3O B;  3R45 B;  5B32 D;  3MGQ D;  3AZM C;  4YS3 D;  3LZ1 D;  4WU9 A;  1ZLA D;  3REL A;  4R8P D;  3P5J B;  1P3P A;  2Y2Q A;  1P3O B;  1ID3 D;  3REK D;  2HUE B;  1M19 D;  1BH8 A;  5AV6 D;  1W2E A;  1EQZ D;  3AZH B;  1TZY A;  5AY8 C;  2JSS A;  3UTB B;  3AZI D;  3KFU G;  5AVB C;  2YFV A;  3AZG D;  1F66 D;  1U35 A;  5B1M A;  3AYW B;  3AZF C;  5AV8 C;  1P3A A;  5F99 D;  5GSU C;  2XD1 A;  1AOI D;  4Z5T B;  1KX3 A;  5B2I A;  5AV9 D;  4X23 D;  1P34 A;  5C3I C;  3MGQ C;  1P3K B;  1P3L D;  3LZ1 C;  5GT3 B;  1ZLA C;  3B6F B;  1KX4 D;  4R8P C;  4EO5 B;  5B33 C;  1ID3 C;  3AN2 C;  3MGS A;  3REI C;  4ZUX D;  3IP4 C;  2BYM A;  4CAY A;  5B40 D;  4Z66 A;  3AFA D;  3UT9 C;  4YM6 D;  1P3B B;  3C1B D;  2IO5 B;  5GT0 B;  3AZG C;  1F66 C;  1P3K A;  3AZE C;  4HGA C;  4UUZ B;  2LY8 A;  4AWL B;  5AVB B;  3O62 C;  3TU4 D;  1AOI C;  3WAA D;  3AZM A;  2CWE A;  3NQU B;  4H9R A;  3KWQ D;  3VH6 W;  1M1A B;  1P3L C;  2YFW A;  5BNX B;  5B32 B;  1KX4 C;  2FJ7 D;  3MGQ B;  3X1U C;  3H0M C;  3LZ1 B;  4YS3 B;  5AY8 A;  1ZLA B;  4ZUX C;  1P3F D;  5B0Y C;  4R8P B;  5AVB A;  1ID3 B;  5BNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...