3W97A

Crystal structure of human nucleosome core particle lacking h2b n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w97A00
4Z5TB 4E45A 5AV9D 4J8XC 3X1TB 5CPKD 5AVCB 5F99B 3X1UA 1S32C 5GSUA 3O62A 5B40D 1HTAA 3C1CC 3AYWA 1P34B 3AN2D 3C1CB 3LZ1A 3REKC 2NQBD 3UTAA 3C1BD 5B24A 5BNXA 1A7WA 3REKB 3AZLC 5CPIA 4H9PA 3AZFA 4J8UB 3W97B 1HQ3B 5AV9C 2AROD 1KX4A 3MGSB 4QLCA 3AV1A 5B0YD 3LELD 1KX3A 5DNMA 3REIA 1BH9A 5AV9B 3X1VD 5AV6D 4X23C 5B40C 4XZQC 3AZND 5B31G 5KDMB 5CPKB 4KUDD 4LD9A 5CPJB 5B32A 1H3OA 1BFMA 5E5AA 3AN2C 4J8VD 3AZKD 5B0ZC 5B33D 3WKJA 5JA4A 3C1BC 2NZDA 3VH6T 3KXBB 3LZ1D 4WNNA 1P3AD 2NQBB 4KGCD 1P3PA 5B31C 3C1BB 1P3FA 1P3OA 4Z2MH 1EQZA 2AROC 5AY8B 1JFIB 3B6FA 5B0YC 3W96A 5B2IA 2HIOB 3LJAD 3X1VC 5AV6C 2AROB 3AZNC 1AOIA 3LELB 2YFWA 3X1VB 3AZNB 4KUDB 5BT1D 3AYWC 4J8VC 1P3LD 1M1AD 5B33C 4KHAA 3MVDA 4CSRA 3WTPE 3LZ1C 3AZKB 1P3AC 4WU9D 5AV5D 3WKJD 5B24C 2CV5A 1P3AB 4KGCB 4J8WD 5AV8A 5B32G 1P3MA 4XUJB 4YS3D 4YM6A 1TZYB 1P3KA 3AZJA 3AFAA 3LJAC 4DRAA 4QLCC 5BO0B 3AZGA 3LJAB 5B2JA 4LD9C 5B32C 1M1AC 5C3IB 1P3LB 1P3GD 3A6ND 3AZIA 2PYOA 3WKJC 3W99D 3MGRA 5GT0B 4G92B 3AZHD 4WU9B 5AV5B 2YFVA 4HGAC 4YS3C 4Z5TA 4WU8A 1P3FC 1BH8A 5GXQA 4J8WB 1EQZC 5CHLB 3X1TA 4YS3B 3R45A 2BYMA 3B6FC 3WTPB 3WAAD 3VH5A 3VH6W 3X1SA 1AOIC 3KWQA 2FJ7B 1U35D 3W99C 1S32D 4ZUXB 3REHA 3A6NB 1P3GB 3W99B 3AZHB 2F8ND 2CV5C 1N1JA 1P3MC 4NE3A 4YM6C 3MGQB 3WAAC 1P3KC 4H9OB 3AZJC 1R4VA 5KDMA 1P3IA 5BS7A 3WAAB 4G91C 1ULYA 2F8NH 3NQJB 1U35C 1KX5A 1Q9CA 3UTBA 3KXBA 5FUGA 4X23D 4J8XB 4XZQD 1U35B 5AVBA 4R8PA 1M18D 2PYOC 1S32B 3W98A 3REHD 4H9QB 5B0ZD 4DRBA 5DNNA 2F8NB 3UT9D 5GT3A 4WU8C 2HIOA 5GXQC 4H9RB 5B31D 3AZLB 5CP6D 1M19A 3X1SC 1TAFB 5B1MA 4AWLC 3KWQC 3B0CW 5JRGA 2LY8A 3B0DC 1M18C 5B1LA 3X1UD 4X23B 5B40B 4XZQB 5GSUD 3O62D 3AZMA 3REHC 3AYWD 1M18B 4XUJA 3RELA 3AN2B 1P3BA 1TZYA 3UT9C 1WWSA 5B0ZB 3KUYA 3MGPA 3UTAD 3UT9B 5B24D 5CP6C 5CPID 5B31B 5BS7C 4Z66A 3AZFD 4CAYA 5CP6B 1KX4D 2BYKA 5B0YB 4QLCD 3MNNA 3AV1D 1KX3D 5DNMD 5GT0A 3REID 5AV6B 3X1UC 5GSUC 3O62C 4LD9D 3AZEA 5B32D 4R8PC 1F66A 3O62B 5E5AD 3AYWB 3W98C 4J8VB 4ZBJC 2HUEC 5B33B 1ID3A 3UTAC 2NZDD 3WTPA 4UUZA 2JSSA 4EO5C 5GT3C 3LZ1B 4H9NA 3TU4A 5CPIC 1P3PD 5B24B 5G49A 4EO5B 5BNXB 3WA9A 3AZFC 1P3FD 1P3OD 2FJ7A 1M19C 1EQZD 3NQUB 1KX4C 3REJA 3B6FD 3AV1C 1KX3C 3W96D 5B2ID 5JRGC 5DNMC 3LZ0A 3REIC 3AV2A 3B6GA 1AOID 4QLCB 3AV1B 1KX3B 5DNMB 3REIB 5B1LC 5E5AC 1ZLAA 4JJNA 4LD9B 5B32B 1M1AB 5E5AB 3MVDD 2NZDC 1P3BC 3WKJB 3KUYC 1P3PC 1ID3D 3B0CT 2CV5D 1P3OC 4HGAB 5AV8D 1P3MD 4NFTA 1P3FB 1P3OB 4Z66C 4YM6D 5F99A 5AVCA 3W96C 5B2IC 1P3KD 1EQZB 3AZJD 3AFAD 3B6FB 3W96B 5B2IB 3MNNC 1P34A 3AZGD 5B2JD 3C1CA 4H9QA 1AOIB 3AZEC 2YFWB 1F66C 4NE5A 3VH5T 3MVDC 3REKA 3AZID 4M6BA 2PYOD 4KHAB 1ID3C 4CSRB 3MGRD 4J8UA 3W97A 3TU4C 1HQ3A 2CWEA 5AV8C 3MGSA 2CV5B 3WA9C 4Z5TD 4WU8D 5GXQD 5AV9A 5AV8B 3B0BA 3AFAC 1P3MB 3X1TD 5CPKA 5CPJA 4YM6B 2L5AA 1P3KB 3AZGC 3AZJB 5B40A 3AFAB 3X1SD 5B2JC 4G91B 3AZGB 3KWQD 5B2JB 1ZLAC 2NQBA 3AZIC 3C1BA 3MGRC 2PYOB 5AY8A 1JFIA 4Z5TC 2AROA 3X1TC 5B0YA 3LELA 4WU8B 1BH8B 5AVCC 5F99C 5GXQB 3X1VA 5AV6A 3AZNA 4KUDA 3R45B 2BYMB 1P3ID 5CPJD 1P34C 5BNVB 3X1SB 4J8VA 3AZKA 5B33A 1KX5D 4AWLB 3KWQB 2F8NK 3UTBD 3KXBD 1P3AA 4KGCA 5AVBD 3B0DB 3V9RB 4R8PD 4J8UC 3REHB 3W97C 3W98D 1HQ3C 5DNND 3NQUA 5AY8D 3MGSC 5GT3D 5BO0A 2HIOD 3LJAA 3VH5W 1N1JB 1B6WA 5CPKC 1P3IC 5CPJC 1KU5A 3VH6A 1M19D 1P3IB 1P3LA 1M1AA 1KX5C 5B1MD 5JRGD 3UTBC 3KXBC 4WU9A 5AV5A 1KX5B 2NQBC 5AVBC 4H9SA 3UTBB 3X1UB 5FUGB 5B1LD 5GSUB 3AZMD 5AVBB 4J8WA 4E44A 4R8PB 4YS3A 4XUJD 4Z2MG 5DNNC 3RELD 5AY8C 1B67A 1P3BD 1TZYD 3W98B 2HIOC 2RVQD 2HUEB 4ZBJB 5DNNB 3KUYD 3UTAB 3MGPD 5GT3B 3LELC 2IO5C 5CPIB 4KUDC 4H9PB 3AZFB 5B1MC 4Z66D 2IO5B 1M19B 4ZUXA 1P3GA 3A6NA 1KX4B 3AZKC 5B1MB 3W99A 3MNND 5JRGB 3AZHA 1BH9B 5GT0D 3AZMC 4KGCC 3AZED 1H3OB 4XUJC 5B1LB 3RELC 1F66D 3AZMB 3MGQA 1TZYC 1F1EA 4H9OA 2RVQC 3RELB 3MGPC 5JA4B 2NZDB 1P3BB 3WTPD 3WAAA 4WNNB 3TU4D 3KUYB 3NQJA 1P3PB 3MGPB 3WA9D 2FJ7D 4NE6A 5C3IC 4J8XA 5BT1C 1U35A 1P3LC 4Z66B 3REJD 4CAYB 1S32A 4G92C 5GT0C 4ZUXD 3LZ0D 3KSYA 3AV2D 3B6GD 2BYKB 4WU9C 5AV5C 3MNNB 4H9SC 2F8NA 1ZLAD 4JJND 4J8WC 3AZEB 4H9RA 1F66B 3MVDB 3AZLA 3WTPC 3MGQD 1ID3B 4UUZB 1TAFA 4H9NB 3TU4B 5BNVA 2FJ7C 3WA9B 5G49B 3REJC 5F99D 5AVCD 4X23A 4ZUXC 4XZQA 3LZ0C 4WZSB 4J8XD 3AV2C 1P3GC 3A6NC 3B6GC 3REJB 3V9RA 1M18A 1P34D 3LZ0B 3AZHC 3AN2A 3AV2B 3C1CD 3B6GB 4JJNC 5B0ZA 1WWIA 3UT9A 3REKD 3MGQC 4JJNB 1ZLAB 3AZIB 5B31A 3MGRB 3AZLD 5CP6A 4J8UD 3W97D 2YFVB 1HQ3D 2F8NG 4WV4B 3MGSD
chains in the Genus database with same CATH superfamily
4Z5TB 4E45A 5AV9D 4J8XC 3X1TB 5CPKD 5AVCB 5F99B 3X1UA 1S32C 5GSUA 3O62A 5B40D 1HTAA 3C1CC 3AYWA 2DQNC 3EPJA 1P34B 3AN2D 2ZY5A 3C1CB 3LZ1A 3REKC 2NQBD 2BG1A 3UTAA 3C1BD 5B24A 5BNXA 1A7WA 2W8SA 3REKB 3AZLC 5CPIA 4H9PA 3P5JB 3AZFA 4J8UB 3W97B 1HQ3B 5AV9C 2AROD 2Y2MA 3MGSB 1KX4A 4QLCA 3AV1A 5B0YD 3LELD 1KX3A 5DNMA 3REIA 1BH9A 5AV9B 3X1VD 5AV6D 4X23C 5B40C 4XZQC 3AZND 5B31G 5KDMB 5CPKB 4KUDD 4LD9A 5CPJB 5B32A 1H3OA 1BFMA 5E5AA 3AN2C 2Y2KA 4J8VD 3AZKD 5B0ZC 5B33D 3WKJA 5JA4A 3C1BC 2NZDA 3VH6T 3KXBB 3LZ1D 4WNNA 1P3AD 2NQBB 4KGCD 1P3PA 5B31C 3C1BB 1P3FA 1P3OA 4Z2MH 1EQZA 2AROC 5AY8B 1JFIB 3B6FA 5B0YC 3W96A 5B2IA 2HIOB 3LJAD 3X1VC 5AV6C 2AROB 3AZNC 1AOIA 3LELB 3H0RC 2YFWA 3X1VB 3AZNB 4KUDB 5BT1D 3AYWC 4J8VC 1P3LD 1M1AD 5B33C 4KHAA 3MVDA 4CSRA 3WTPE 3LZ1C 2Y2LA 3AZKB 1P3AC 4WU9D 5AV5D 3WKJD 5B24C 2CV5A 1P3AB 4KGCB 4J8WD 5AV8A 5B32G 1P3MA 4XUJB 4YS3D 4YM6A 1TZYB 1P3KA 3AZJA 3AFAA 3LJAC 2Y2NA 4DRAA 4QLCC 5BO0B 3AZGA 3LJAB 5B2JA 4LD9C 5B32C 1M1AC 5C3IB 3H0LC 1P3LB 1P3GD 3A6ND 3AZIA 2PYOA 3WKJC 3W99D 2JCHA 5GT0B 3MGRA 4G92B 3AZHD 4WU9B 5AV5B 2ZM5A 2YFVA 3H0MC 3KFUG 4HGAC 4YS3C 4Z5TA 1T3UA 4WU8A 1P3FC 1BH8A 5GXQA 4J8WB 1EQZC 5CHLB 3X1TA 4YS3B 3R45A 2BYMA 3B6FC 3WTPB 3WAAD 3VH5A 3VH6W 3X1SA 1AOIC 3KWQA 2FJ7B 1U35D 3W99C 1S32D 4ZUXB 3REHA 3A6NB 1P3GB 3W99B 3AZHB 2F8ND 2CV5C 1N1JA 1P3MC 4NE3A 4YM6C 3MGQB 3WAAC 1P3KC 4H9OB 3AZJC 1R4VA 4DQYB 5KDMA 1P3IA 5BS7A 3WAAB 4G91C 1ULYA 2F8NH 3NQJB 1U35C 1KX5A 1Q9CA 3UTBA 3KXBA 5FUGA 4X23D 4J8XB 4XZQD 1U35B 5AVBA 4R8PA 4UPKA 2Y2OA 1S32B 1M18D 2PYOC 3W98A 3REHD 4H9QB 5B0ZD 4DRBA 5DNNA 2F8NB 3UT9D 5GT3A 4WU8C 2HIOA 5GXQC 4H9RB 5B31D 3AZLB 5CP6D 1M19A 3X1SC 2XD1A 1TAFB 5B1MA 2UWXA 4AWLC 3KWQC 3B0CW 5JRGA 3EPLA 2LY8A 2F2AC 3B0DC 1M18C 5B1LA 3X1UD 4X23B 5B40B 4XZQB 5GSUD 3O62D 3AZMA 3REHC 3AYWD 1M18B 4XUJA 3RELA 3AN2B 1P3BA 1TZYA 3UT9C 1WWSA 5B0ZB 3KUYA 3MGPA 3UTAD 3UT9B 5B24D 5CP6C 5CPID 5B31B 5BS7C 4Z66A 3AZFD 4CAYA 5CP6B 1KX4D 2BYKA 5B0YB 4QLCD 3MNNA 3AV1D 1KX3D 5DNMD 5GT0A 3REID 5AV6B 3X1UC 5GSUC 3O62C 4LD9D 3AZEA 5B32D 4R8PC 1F66A 3O62B 5E5AD 3AYWB 3W98C 4J8VB 4ZBJC 2HUEC 5B33B 1ID3A 3UTAC 2NZDD 3WTPA 4UUZA 2JSSA 4EO5C 5GT3C 3LZ1B 4H9NA 3TU4A 5CPIC 1P3PD 5B24B 5G49A 4EO5B 5BNXB 3WA9A 3AZFC 1P3FD 1P3OD 2FJ7A 1M19C 1EQZD 3NQUB 1KX4C 3REJA 3B6FD 3AV1C 1KX3C 3W96D 5B2ID 5JRGC 5DNMC 3LZ0A 3REIC 3AV2A 3B6GA 1AOID 4QLCB 3AV1B 1KX3B 5DNMB 3REIB 5B1LC 5E5AC 1ZLAA 4JJNA 4LD9B 5B32B 1M1AB 5E5AB 3MVDD 2NZDC 1P3BC 3WKJB 3KUYC 1P3PC 1ID3D 3B0CT 2CV5D 1P3OC 4HGAB 5AV8D 1P3MD 4NFTA 1P3FB 1P3OB 4Z66C 5F99A 5AVCA 4YM6D 3W96C 5B2IC 1P3KD 1EQZB 3AZJD 3AFAD 3B6FB 3FDDA 3W96B 5B2IB 3MNNC 1P34A 3AZGD 5B2JD 3C1CA 4H9QA 1AOIB 3AZEC 2YFWB 1F66C 4NE5A 3VH5T 3MVDC 3IP4C 3REKA 3AZID 4M6BA 2PYOD 4KHAB 1ID3C 4CSRB 3MGRD 4J8UA 3W97A 3EPKA 3TU4C 1HQ3A 2CWEA 5AV8C 3MGSA 2CV5B 3WA9C 4Z5TD 4WU8D 5GXQD 5AV9A 5AV8B 3B0BA 3AFAC 1P3MB 3X1TD 5CPKA 5CPJA 4YM6B 2L5AA 1P3KB 3AZGC 3AZJB 5B40A 1W2EA 3AFAB 3X1SD 5B2JC 2Y2GA 4G91B 3AZGB 3KWQD 3A1IA 5B2JB 2FFFB 1ZLAC 2NQBA 3AZIC 2G5HC 3C1BA 3MGRC 2PYOB 5AY8A 1JFIA 4Z5TC 3A1KA 2AROA 3X1TC 5B0YA 3LELA 4WU8B 1BH8B 5AVCC 5F99C 5GXQB 3X1VA 5AV6A 3AZNA 4KUDA 3R45B 3F6TA 2BYMB 1P3ID 5CPJD 1P34C 5BNVB 3X1SB 4J8VA 3AZKA 2XD5A 5B33A 1KX5D 4AWLB 3KWQB 2F8NK 3UTBD 3KXBD 1Z2CB 1P3AA 4KGCA 5AVBD 3B0DB 3V9RB 4R8PD 4J8UC 3REHB 3W97C 3W98D 1HQ3C 5DNND 3NQUA 5AY8D 3MGSC 5GT3D 5BO0A 2HIOD 3LJAA 3VH5W 1N1JB 1B6WA 5CPKC 1P3IC 2ZY4A 5CPJC 1KU5A 3VH6A 1M19D 2G5IC 1P3IB 1P3LA 1M1AA 1KX5C 5B1MD 5JRGD 3UTBC 3KXBC 4WU9A 2Y2HA 5AV5A 1KX5B 2ZY3A 5AVBC 2NQBC 4H9SA 3UTBB 3X1UB 5FUGB 5B1LD 5GSUB 3AZMD 5AVBB 4J8WA 4E44A 4R8PB 4YS3A 4XUJD 4Z2MG 5DNNC 3RELD 5AY8C 1B67A 1P3BD 1TZYD 3W98B 2HIOC 2RVQD 2HUEB 4ZBJB 5DNNB 3KUYD 3UTAB 3MGPD 5GT3B 3LELC 2IO5C 5CPIB 4KUDC 2Y2JA 4H9PB 3AZFB 5B1MC 4Z66D 2IO5B 1M19B 4ZUXA 1P3GA 3A6NA 1KX4B 3AZKC 5B1MB 3W99A 3MNND 5JRGB 3AZHA 1BH9B 5GT0D 3AZMC 4KGCC 3AZED 1H3OB 4XUJC 5B1LB 3RELC 1F66D 3AZMB 3MGQA 1TZYC 1F1EA 4H9OA 2RVQC 3EG5B 3RELB 3MGPC 5JA4B 2NZDB 1P3BB 3WTPD 3WAAA 4WNNB 3TU4D 3KUYB 3NQJA 1P3PB 3MGPB 2Y2IA 3EPHA 2JE5A 3WA9D 2J8PA 4WJ3C 2FJ7D 4NE6A 5C3IC 4J8XA 5BT1C 1U35A 1P3LC 4Z66B 3REJD 4CAYB 1S32A 1PZRA 4G92C 5GT0C 4ZUXD 3LZ0D 3KSYA 3AV2D 3B6GD 2BYKB 4WU9C 5AV5C 3MNNB 4H9SC 2F8NA 1ZLAD 4JJND 4J8WC 3AZEB 4H9RA 2VQRA 1F66B 3MVDB 3AZLA 3WTPC 3MGQD 2Y2QA 1ID3B 4UUZB 1TAFA 4H9NB 3TU4B 5BNVA 2FJ7C 3WA9B 5G49B 3REJC 5F99D 5AVCD 4X23A 4ZUXC 4XZQA 3LZ0C 4WZSB 4J8XD 3AL0C 3AV2C 1P3GC 3A6NC 3B6GC 3REJB 3V9RA 1M18A 1P34D 2DF4C 3LZ0B 3AZHC 3AN2A 3AV2B 3C1CD 3B6GB 4JJNC 5B0ZA 1WWIA 3UT9A 2Y2PA 3REKD 3MGQC 4JJNB 1ZLAB 3AZIB 5B31A 3MGRB 3AZLD 5CP6A 4J8UD 3W97D 2RIQA 2YFVB 1HQ3D 2ZY2A 2F8NG 4WV4B 3MGSD
chains in the Genus database with same CATH topology
4Z5TB 4E45A 5AV9D 4J8XC 3X1TB 5CPKD 5AVCB 5F99B 3X1UA 1S32C 5GSUA 3O62A 5B40D 1HTAA 3C1CC 3AYWA 2DQNC 3EPJA 1P34B 3AN2D 2ZY5A 3C1CB 3LZ1A 3REKC 2NQBD 2BG1A 3UTAA 3C1BD 5B24A 5BNXA 1A7WA 2W8SA 3REKB 3AZLC 5CPIA 4H9PA 3P5JB 3AZFA 4J8UB 3W97B 1HQ3B 5AV9C 2AROD 2Y2MA 3MGSB 1KX4A 4QLCA 3AV1A 5B0YD 3LELD 1KX3A 5DNMA 3REIA 1BH9A 5AV9B 3X1VD 5AV6D 4X23C 5B40C 4XZQC 3AZND 5B31G 5KDMB 5CPKB 4KUDD 4LD9A 5CPJB 5B32A 1H3OA 1BFMA 5E5AA 3AN2C 2Y2KA 4J8VD 3AZKD 5B0ZC 5B33D 3WKJA 5JA4A 3C1BC 2NZDA 3VH6T 3KXBB 3LZ1D 4WNNA 1P3AD 2NQBB 4KGCD 1P3PA 5B31C 3C1BB 1P3FA 1P3OA 4Z2MH 1EQZA 2AROC 5AY8B 1JFIB 3B6FA 5B0YC 3W96A 5B2IA 2HIOB 3LJAD 3X1VC 5AV6C 2AROB 3AZNC 1AOIA 3LELB 3H0RC 2YFWA 3X1VB 3AZNB 4KUDB 5BT1D 3AYWC 4J8VC 1P3LD 1M1AD 5B33C 4KHAA 3MVDA 4CSRA 3WTPE 3LZ1C 2Y2LA 3AZKB 1P3AC 4WU9D 5AV5D 3WKJD 5B24C 2CV5A 1P3AB 4KGCB 4J8WD 5AV8A 5B32G 1P3MA 4XUJB 4YS3D 4YM6A 1TZYB 1P3KA 3AZJA 3AFAA 3LJAC 2Y2NA 4DRAA 4QLCC 5BO0B 3AZGA 3LJAB 5B2JA 4LD9C 5B32C 1M1AC 5C3IB 3H0LC 1P3LB 1P3GD 3A6ND 3AZIA 2PYOA 3WKJC 3W99D 2JCHA 5GT0B 3MGRA 4G92B 3AZHD 4WU9B 5AV5B 2ZM5A 2YFVA 3H0MC 3KFUG 4HGAC 4YS3C 4Z5TA 1T3UA 4WU8A 1P3FC 1BH8A 5GXQA 4J8WB 1EQZC 5CHLB 3X1TA 4YS3B 3R45A 2BYMA 3B6FC 3WTPB 3WAAD 3VH5A 3VH6W 3X1SA 1AOIC 3KWQA 2FJ7B 1U35D 3W99C 1S32D 4ZUXB 3REHA 3A6NB 1P3GB 3W99B 3AZHB 2F8ND 2CV5C 1N1JA 1P3MC 4NE3A 4YM6C 3MGQB 3WAAC 1P3KC 4H9OB 3AZJC 1R4VA 4DQYB 5KDMA 1P3IA 5BS7A 3WAAB 4G91C 1ULYA 2F8NH 3NQJB 1U35C 1KX5A 1Q9CA 3UTBA 3KXBA 5FUGA 4X23D 4J8XB 4XZQD 1U35B 5AVBA 4R8PA 4UPKA 2Y2OA 1S32B 1M18D 2PYOC 3W98A 3REHD 4H9QB 5B0ZD 4DRBA 5DNNA 2F8NB 3UT9D 5GT3A 4WU8C 2HIOA 5GXQC 4H9RB 5B31D 3AZLB 5CP6D 1M19A 3X1SC 2XD1A 1TAFB 5B1MA 2UWXA 4AWLC 3KWQC 3B0CW 5JRGA 3EPLA 2LY8A 2F2AC 3B0DC 1M18C 5B1LA 3X1UD 4X23B 5B40B 4XZQB 5GSUD 3O62D 3AZMA 3REHC 3AYWD 1M18B 4XUJA 3RELA 3AN2B 1P3BA 1TZYA 3UT9C 1WWSA 5B0ZB 3KUYA 3MGPA 3UTAD 3UT9B 5B24D 5CP6C 5CPID 5B31B 5BS7C 4Z66A 3AZFD 4CAYA 5CP6B 1KX4D 2BYKA 5B0YB 4QLCD 3MNNA 3AV1D 1KX3D 5DNMD 5GT0A 3REID 5AV6B 3X1UC 5GSUC 3O62C 4LD9D 3AZEA 5B32D 4R8PC 1F66A 3O62B 5E5AD 3AYWB 3W98C 4J8VB 4ZBJC 2HUEC 5B33B 1ID3A 3UTAC 2NZDD 3WTPA 4UUZA 2JSSA 4EO5C 5GT3C 3LZ1B 4H9NA 3TU4A 5CPIC 1P3PD 5B24B 5G49A 4EO5B 5BNXB 3WA9A 3AZFC 1P3FD 1P3OD 2FJ7A 1M19C 1EQZD 3NQUB 1KX4C 3REJA 3B6FD 3AV1C 1KX3C 3W96D 5B2ID 5JRGC 5DNMC 3LZ0A 3REIC 3AV2A 3B6GA 1AOID 4QLCB 3AV1B 1KX3B 5DNMB 3REIB 5B1LC 5E5AC 1ZLAA 4JJNA 4LD9B 5B32B 1M1AB 5E5AB 3MVDD 2NZDC 1P3BC 3WKJB 3KUYC 1P3PC 1ID3D 3B0CT 2CV5D 1P3OC 4HGAB 5AV8D 1P3MD 4NFTA 1P3FB 1P3OB 4Z66C 5F99A 5AVCA 4YM6D 3W96C 5B2IC 1P3KD 1EQZB 3AZJD 3AFAD 3B6FB 3FDDA 3W96B 5B2IB 3MNNC 1P34A 3AZGD 5B2JD 3C1CA 4H9QA 1AOIB 3AZEC 2YFWB 1F66C 4NE5A 3VH5T 3MVDC 3IP4C 3REKA 3AZID 4M6BA 2PYOD 4KHAB 1ID3C 4CSRB 3MGRD 4J8UA 3W97A 3EPKA 3TU4C 1HQ3A 2CWEA 5AV8C 3MGSA 2CV5B 3WA9C 4Z5TD 4WU8D 5GXQD 5AV9A 5AV8B 3B0BA 3AFAC 1P3MB 3X1TD 5CPKA 5CPJA 4YM6B 2L5AA 1P3KB 3AZGC 3AZJB 5B40A 1W2EA 3AFAB 3X1SD 5B2JC 2Y2GA 4G91B 3AZGB 3KWQD 3A1IA 5B2JB 2FFFB 1ZLAC 2NQBA 3AZIC 2G5HC 3C1BA 3MGRC 2PYOB 5AY8A 1JFIA 4Z5TC 3A1KA 2AROA 3X1TC 5B0YA 3LELA 4WU8B 1BH8B 5AVCC 5F99C 5GXQB 3X1VA 5AV6A 3AZNA 4KUDA 3R45B 3F6TA 2BYMB 1P3ID 5CPJD 1P34C 5BNVB 3X1SB 4J8VA 3AZKA 2XD5A 5B33A 1KX5D 4AWLB 3KWQB 2F8NK 3UTBD 3KXBD 1Z2CB 1P3AA 4KGCA 5AVBD 3B0DB 3V9RB 4R8PD 4J8UC 3REHB 3W97C 3W98D 1HQ3C 5DNND 3NQUA 5AY8D 3MGSC 5GT3D 5BO0A 2HIOD 3LJAA 3VH5W 1N1JB 1B6WA 5CPKC 1P3IC 2ZY4A 5CPJC 1KU5A 3VH6A 1M19D 2G5IC 1P3IB 1P3LA 1M1AA 1KX5C 5B1MD 5JRGD 3UTBC 3KXBC 4WU9A 2Y2HA 5AV5A 1KX5B 2ZY3A 5AVBC 2NQBC 4H9SA 3UTBB 3X1UB 5FUGB 5B1LD 5GSUB 3AZMD 5AVBB 4J8WA 4E44A 4R8PB 4YS3A 4XUJD 4Z2MG 5DNNC 3RELD 5AY8C 1B67A 1P3BD 1TZYD 3W98B 2HIOC 2RVQD 2HUEB 4ZBJB 5DNNB 3KUYD 3UTAB 3MGPD 5GT3B 3LELC 2IO5C 5CPIB 4KUDC 2Y2JA 4H9PB 3AZFB 5B1MC 4Z66D 2IO5B 1M19B 4ZUXA 1P3GA 3A6NA 1KX4B 3AZKC 5B1MB 3W99A 3MNND 5JRGB 3AZHA 1BH9B 5GT0D 3AZMC 4KGCC 3AZED 1H3OB 4XUJC 5B1LB 3RELC 1F66D 3AZMB 3MGQA 1TZYC 1F1EA 4H9OA 2RVQC 3EG5B 3RELB 3MGPC 5JA4B 2NZDB 1P3BB 3WTPD 3WAAA 4WNNB 3TU4D 3KUYB 3NQJA 1P3PB 3MGPB 2Y2IA 3EPHA 2JE5A 3WA9D 2J8PA 4WJ3C 2FJ7D 4NE6A 5C3IC 4J8XA 5BT1C 1U35A 1P3LC 4Z66B 3REJD 4CAYB 1S32A 1PZRA 4G92C 5GT0C 4ZUXD 3LZ0D 3KSYA 3AV2D 3B6GD 2BYKB 4WU9C 5AV5C 3MNNB 4H9SC 2F8NA 1ZLAD 4JJND 4J8WC 3AZEB 4H9RA 2VQRA 1F66B 3MVDB 3AZLA 3WTPC 3MGQD 2Y2QA 1ID3B 4UUZB 1TAFA 4H9NB 3TU4B 5BNVA 2FJ7C 3WA9B 5G49B 3REJC 5F99D 5AVCD 4X23A 4ZUXC 4XZQA 3LZ0C 4WZSB 4J8XD 3AL0C 3AV2C 1P3GC 3A6NC 3B6GC 3REJB 3V9RA 1M18A 1P34D 2DF4C 3LZ0B 3AZHC 3AN2A 3AV2B 3C1CD 3B6GB 4JJNC 5B0ZA 1WWIA 3UT9A 2Y2PA 3REKD 3MGQC 4JJNB 1ZLAB 3AZIB 5B31A 3MGRB 3AZLD 5CP6A 4J8UD 3W97D 2RIQA 2YFVB 1HQ3D 2ZY2A 2F8NG 4WV4B 3MGSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T B;  4E45 A;  5AV9 D;  4J8X C;  3X1T B;  5CPK D;  5AVC B;  5F99 B;  3X1U A;  1S32 C;  5GSU A;  3O62 A;  5B40 D;  1HTA A;  3C1C C;  3AYW A;  1P34 B;  3AN2 D;  3C1C B;  3LZ1 A;  3REK C;  2NQB D;  3UTA A;  3C1B D;  5B24 A;  5BNX A;  1A7W A;  3REK B;  3AZL C;  5CPI A;  4H9P A;  3AZF A;  4J8U B;  3W97 B;  1HQ3 B;  5AV9 C;  2ARO D;  1KX4 A;  3MGS B;  4QLC A;  3AV1 A;  5B0Y D;  3LEL D;  1KX3 A;  5DNM A;  3REI A;  1BH9 A;  5AV9 B;  3X1V D;  5AV6 D;  4X23 C;  5B40 C;  4XZQ C;  3AZN D;  5B31 G;  5KDM B;  5CPK B;  4KUD D;  4LD9 A;  5CPJ B;  5B32 A;  1H3O A;  1BFM A;  5E5A A;  3AN2 C;  4J8V D;  3AZK D;  5B0Z C;  5B33 D;  3WKJ A;  5JA4 A;  3C1B C;  2NZD A;  3VH6 T;  3KXB B;  3LZ1 D;  4WNN A;  1P3A D;  2NQB B;  4KGC D;  1P3P A;  5B31 C;  3C1B B;  1P3F A;  1P3O A;  4Z2M H;  1EQZ A;  2ARO C;  5AY8 B;  1JFI B;  3B6F A;  5B0Y C;  3W96 A;  5B2I A;  2HIO B;  3LJA D;  3X1V C;  5AV6 C;  2ARO B;  3AZN C;  1AOI A;  3LEL B;  2YFW A;  3X1V B;  3AZN B;  4KUD B;  5BT1 D;  3AYW C;  4J8V C;  1P3L D;  1M1A D;  5B33 C;  4KHA A;  3MVD A;  4CSR A;  3WTP E;  3LZ1 C;  3AZK B;  1P3A C;  4WU9 D;  5AV5 D;  3WKJ D;  5B24 C;  2CV5 A;  1P3A B;  4KGC B;  4J8W D;  5AV8 A;  5B32 G;  1P3M A;  4XUJ B;  4YS3 D;  4YM6 A;  1TZY B;  1P3K A;  3AZJ A;  3AFA A;  3LJA C;  4DRA A;  4QLC C;  5BO0 B;  3AZG A;  3LJA B;  5B2J A;  4LD9 C;  5B32 C;  1M1A C;  5C3I B;  1P3L B;  1P3G D;  3A6N D;  3AZI A;  2PYO A;  3WKJ C;  3W99 D;  3MGR A;  5GT0 B;  4G92 B;  3AZH D;  4WU9 B;  5AV5 B;  2YFV A;  4HGA C;  4YS3 C;  4Z5T A;  4WU8 A;  1P3F C;  1BH8 A;  5GXQ A;  4J8W B;  1EQZ C;  5CHL B;  3X1T A;  4YS3 B;  3R45 A;  2BYM A;  3B6F C;  3WTP B;  3WAA D;  3VH5 A;  3VH6 W;  3X1S A;  1AOI C;  3KWQ A;  2FJ7 B;  1U35 D;  3W99 C;  1S32 D;  4ZUX B;  3REH A;  3A6N B;  1P3G B;  3W99 B;  3AZH B;  2F8N D;  2CV5 C;  1N1J A;  1P3M C;  4NE3 A;  4YM6 C;  3MGQ B;  3WAA C;  1P3K C;  4H9O B;  3AZJ C;  1R4V A;  5KDM A;  1P3I A;  5BS7 A;  3WAA B;  4G91 C;  1ULY A;  2F8N H;  3NQJ B;  1U35 C;  1KX5 A;  1Q9C A;  3UTB A;  3KXB A;  5FUG A;  4X23 D;  4J8X B;  4XZQ D;  1U35 B;  5AVB A;  4R8P A;  1M18 D;  2PYO C;  1S32 B;  3W98 A;  3REH D;  4H9Q B;  5B0Z D;  4DRB A;  5DNN A;  2F8N B;  3UT9 D;  5GT3 A;  4WU8 C;  2HIO A;  5GXQ C;  4H9R B;  5B31 D;  3AZL B;  5CP6 D;  1M19 A;  3X1S C;  1TAF B;  5B1M A;  4AWL C;  3KWQ C;  3B0C W;  5JRG A;  2LY8 A;  3B0D C;  1M18 C;  5B1L A;  3X1U D;  4X23 B;  5B40 B;  4XZQ B;  5GSU D;  3O62 D;  3AZM A;  3REH C;  3AYW D;  1M18 B;  4XUJ A;  3REL A;  3AN2 B;  1P3B A;  1TZY A;  3UT9 C;  1WWS A;  5B0Z B;  3KUY A;  3MGP A;  3UTA D;  3UT9 B;  5B24 D;  5CP6 C;  5CPI D;  5B31 B;  5BS7 C;  4Z66 A;  3AZF D;  4CAY A;  5CP6 B;  1KX4 D;  2BYK A;  5B0Y B;  4QLC D;  3MNN A;  3AV1 D;  1KX3 D;  5DNM D;  5GT0 A;  3REI D;  5AV6 B;  3X1U C;  5GSU C;  3O62 C;  4LD9 D;  3AZE A;  5B32 D;  4R8P C;  1F66 A;  3O62 B;  5E5A D;  3AYW B;  3W98 C;  4J8V B;  4ZBJ C;  2HUE C;  5B33 B;  1ID3 A;  3UTA C;  2NZD D;  3WTP A;  4UUZ A;  2JSS A;  4EO5 C;  5GT3 C;  3LZ1 B;  4H9N A;  3TU4 A;  5CPI C;  1P3P D;  5B24 B;  5G49 A;  4EO5 B;  5BNX B;  3WA9 A;  3AZF C;  1P3F D;  1P3O D;  2FJ7 A;  1M19 C;  1EQZ D;  3NQU B;  1KX4 C;  3REJ A;  3B6F D;  3AV1 C;  1KX3 C;  3W96 D;  5B2I D;  5JRG C;  5DNM C;  3LZ0 A;  3REI C;  3AV2 A;  3B6G A;  1AOI D;  4QLC B;  3AV1 B;  1KX3 B;  5DNM B;  3REI B;  5B1L C;  5E5A C;  1ZLA A;  4JJN A;  4LD9 B;  5B32 B;  1M1A B;  5E5A B;  3MVD D;  2NZD C;  1P3B C;  3WKJ B;  3KUY C;  1P3P C;  1ID3 D;  3B0C T;  2CV5 D;  1P3O C;  4HGA B;  5AV8 D;  1P3M D;  4NFT A;  1P3F B;  1P3O B;  4Z66 C;  4YM6 D;  5F99 A;  5AVC A;  3W96 C;  5B2I C;  1P3K D;  1EQZ B;  3AZJ D;  3AFA D;  3B6F B;  3W96 B;  5B2I B;  3MNN C;  1P34 A;  3AZG D;  5B2J D;  3C1C A;  4H9Q A;  1AOI B;  3AZE C;  2YFW B;  1F66 C;  4NE5 A;  3VH5 T;  3MVD C;  3REK A;  3AZI D;  4M6B A;  2PYO D;  4KHA B;  1ID3 C;  4CSR B;  3MGR D;  4J8U A;  3W97 A;  3TU4 C;  1HQ3 A;  2CWE A;  5AV8 C;  3MGS A;  2CV5 B;  3WA9 C;  4Z5T D;  4WU8 D;  5GXQ D;  5AV9 A;  5AV8 B;  3B0B A;  3AFA C;  1P3M B;  3X1T D;  5CPK A;  5CPJ A;  4YM6 B;  2L5A A;  1P3K B;  3AZG C;  3AZJ B;  5B40 A;  3AFA B;  3X1S D;  5B2J C;  4G91 B;  3AZG B;  3KWQ D;  5B2J B;  1ZLA C;  2NQB A;  3AZI C;  3C1B A;  3MGR C;  2PYO B;  5AY8 A;  1JFI A;  4Z5T C;  2ARO A;  3X1T C;  5B0Y A;  3LEL A;  4WU8 B;  1BH8 B;  5AVC C;  5F99 C;  5GXQ B;  3X1V A;  5AV6 A;  3AZN A;  4KUD A;  3R45 B;  2BYM B;  1P3I D;  5CPJ D;  1P34 C;  5BNV B;  3X1S B;  4J8V A;  3AZK A;  5B33 A;  1KX5 D;  4AWL B;  3KWQ B;  2F8N K;  3UTB D;  3KXB D;  1P3A A;  4KGC A;  5AVB D;  3B0D B;  3V9R B;  4R8P D;  4J8U C;  3REH B;  3W97 C;  3W98 D;  1HQ3 C;  5DNN D;  3NQU A;  5AY8 D;  3MGS C;  5GT3 D;  5BO0 A;  2HIO D;  3LJA A;  3VH5 W;  1N1J B;  1B6W A;  5CPK C;  1P3I C;  5CPJ C;  1KU5 A;  3VH6 A;  1M19 D;  1P3I B;  1P3L A;  1M1A A;  1KX5 C;  5B1M D;  5JRG D;  3UTB C;  3KXB C;  4WU9 A;  5AV5 A;  1KX5 B;  2NQB C;  5AVB C;  4H9S A;  3UTB B;  3X1U B;  5FUG B;  5B1L D;  5GSU B;  3AZM D;  5AVB B;  4J8W A;  4E44 A;  4R8P B;  4YS3 A;  4XUJ D;  4Z2M G;  5DNN C;  3REL D;  5AY8 C;  1B67 A;  1P3B D;  1TZY D;  3W98 B;  2HIO C;  2RVQ D;  2HUE B;  4ZBJ B;  5DNN B;  3KUY D;  3UTA B;  3MGP D;  5GT3 B;  3LEL C;  2IO5 C;  5CPI B;  4KUD C;  4H9P B;  3AZF B;  5B1M C;  4Z66 D;  2IO5 B;  1M19 B;  4ZUX A;  1P3G A;  3A6N A;  1KX4 B;  3AZK C;  5B1M B;  3W99 A;  3MNN D;  5JRG B;  3AZH A;  1BH9 B;  5GT0 D;  3AZM C;  4KGC C;  3AZE D;  1H3O B;  4XUJ C;  5B1L B;  3REL C;  1F66 D;  3AZM B;  3MGQ A;  1TZY C;  1F1E A;  4H9O A;  2RVQ C;  3REL B;  3MGP C;  5JA4 B;  2NZD B;  1P3B B;  3WTP D;  3WAA A;  4WNN B;  3TU4 D;  3KUY B;  3NQJ A;  1P3P B;  3MGP B;  3WA9 D;  2FJ7 D;  4NE6 A;  5C3I C;  4J8X A;  5BT1 C;  1U35 A;  1P3L C;  4Z66 B;  3REJ D;  4CAY B;  1S32 A;  4G92 C;  5GT0 C;  4ZUX D;  3LZ0 D;  3KSY A;  3AV2 D;  3B6G D;  2BYK B;  4WU9 C;  5AV5 C;  3MNN B;  4H9S C;  2F8N A;  1ZLA D;  4JJN D;  4J8W C;  3AZE B;  4H9R A;  1F66 B;  3MVD B;  3AZL A;  3WTP C;  3MGQ D;  1ID3 B;  4UUZ B;  1TAF A;  4H9N B;  3TU4 B;  5BNV A;  2FJ7 C;  3WA9 B;  5G49 B;  3REJ C;  5F99 D;  5AVC D;  4X23 A;  4ZUX C;  4XZQ A;  3LZ0 C;  4WZS B;  4J8X D;  3AV2 C;  1P3G C;  3A6N C;  3B6G C;  3REJ B;  3V9R A;  1M18 A;  1P34 D;  3LZ0 B;  3AZH C;  3AN2 A;  3AV2 B;  3C1C D;  3B6G B;  4JJN C;  5B0Z A;  1WWI A;  3UT9 A;  3REK D;  3MGQ C;  4JJN B;  1ZLA B;  3AZI B;  5B31 A;  3MGR B;  3AZL D;  5CP6 A;  4J8U D;  3W97 D;  2YFV B;  1HQ3 D;  2F8N G;  4WV4 B;  3MGS D; 
#chains in the Genus database with same CATH topology
 4Z5T B;  4E45 A;  5AV9 D;  4J8X C;  3X1T B;  5CPK D;  5AVC B;  5F99 B;  3X1U A;  1S32 C;  5GSU A;  3O62 A;  5B40 D;  1HTA A;  3C1C C;  3AYW A;  2DQN C;  3EPJ A;  1P34 B;  3AN2 D;  2ZY5 A;  3C1C B;  3LZ1 A;  3REK C;  2NQB D;  2BG1 A;  3UTA A;  3C1B D;  5B24 A;  5BNX A;  1A7W A;  2W8S A;  3REK B;  3AZL C;  5CPI A;  4H9P A;  3P5J B;  3AZF A;  4J8U B;  3W97 B;  1HQ3 B;  5AV9 C;  2ARO D;  2Y2M A;  3MGS B;  1KX4 A;  4QLC A;  3AV1 A;  5B0Y D;  3LEL D;  1KX3 A;  5DNM A;  3REI A;  1BH9 A;  5AV9 B;  3X1V D;  5AV6 D;  4X23 C;  5B40 C;  4XZQ C;  3AZN D;  5B31 G;  5KDM B;  5CPK B;  4KUD D;  4LD9 A;  5CPJ B;  5B32 A;  1H3O A;  1BFM A;  5E5A A;  3AN2 C;  2Y2K A;  4J8V D;  3AZK D;  5B0Z C;  5B33 D;  3WKJ A;  5JA4 A;  3C1B C;  2NZD A;  3VH6 T;  3KXB B;  3LZ1 D;  4WNN A;  1P3A D;  2NQB B;  4KGC D;  1P3P A;  5B31 C;  3C1B B;  1P3F A;  1P3O A;  4Z2M H;  1EQZ A;  2ARO C;  5AY8 B;  1JFI B;  3B6F A;  5B0Y C;  3W96 A;  5B2I A;  2HIO B;  3LJA D;  3X1V C;  5AV6 C;  2ARO B;  3AZN C;  1AOI A;  3LEL B;  3H0R C;  2YFW A;  3X1V B;  3AZN B;  4KUD B;  5BT1 D;  3AYW C;  4J8V C;  1P3L D;  1M1A D;  5B33 C;  4KHA A;  3MVD A;  4CSR A;  3WTP E;  3LZ1 C;  2Y2L A;  3AZK B;  1P3A C;  4WU9 D;  5AV5 D;  3WKJ D;  5B24 C;  2CV5 A;  1P3A B;  4KGC B;  4J8W D;  5AV8 A;  5B32 G;  1P3M A;  4XUJ B;  4YS3 D;  4YM6 A;  1TZY B;  1P3K A;  3AZJ A;  3AFA A;  3LJA C;  2Y2N A;  4DRA A;  4QLC C;  5BO0 B;  3AZG A;  3LJA B;  5B2J A;  4LD9 C;  5B32 C;  1M1A C;  5C3I B;  3H0L C;  1P3L B;  1P3G D;  3A6N D;  3AZI A;  2PYO A;  3WKJ C;  3W99 D;  2JCH A;  5GT0 B;  3MGR A;  4G92 B;  3AZH D;  4WU9 B;  5AV5 B;  2ZM5 A;  2YFV A;  3H0M C;  3KFU G;  4HGA C;  4YS3 C;  4Z5T A;  1T3U A;  4WU8 A;  1P3F C;  1BH8 A;  5GXQ A;  4J8W B;  1EQZ C;  5CHL B;  3X1T A;  4YS3 B;  3R45 A;  2BYM A;  3B6F C;  3WTP B;  3WAA D;  3VH5 A;  3VH6 W;  3X1S A;  1AOI C;  3KWQ A;  2FJ7 B;  1U35 D;  3W99 C;  1S32 D;  4ZUX B;  3REH A;  3A6N B;  1P3G B;  3W99 B;  3AZH B;  2F8N D;  2CV5 C;  1N1J A;  1P3M C;  4NE3 A;  4YM6 C;  3MGQ B;  3WAA C;  1P3K C;  4H9O B;  3AZJ C;  1R4V A;  4DQY B;  5KDM A;  1P3I A;  5BS7 A;  3WAA B;  4G91 C;  1ULY A;  2F8N H;  3NQJ B;  1U35 C;  1KX5 A;  1Q9C A;  3UTB A;  3KXB A;  5FUG A;  4X23 D;  4J8X B;  4XZQ D;  1U35 B;  5AVB A;  4R8P A;  4UPK A;  2Y2O A;  1S32 B;  1M18 D;  2PYO C;  3W98 A;  3REH D;  4H9Q B;  5B0Z D;  4DRB A;  5DNN A;  2F8N B;  3UT9 D;  5GT3 A;  4WU8 C;  2HIO A;  5GXQ C;  4H9R B;  5B31 D;  3AZL B;  5CP6 D;  1M19 A;  3X1S C;  2XD1 A;  1TAF B;  5B1M A;  2UWX A;  4AWL C;  3KWQ C;  3B0C W;  5JRG A;  3EPL A;  2LY8 A;  2F2A C;  3B0D C;  1M18 C;  5B1L A;  3X1U D;  4X23 B;  5B40 B;  4XZQ B;  5GSU D;  3O62 D;  3AZM A;  3REH C;  3AYW D;  1M18 B;  4XUJ A;  3REL A;  3AN2 B;  1P3B A;  1TZY A;  3UT9 C;  1WWS A;  5B0Z B;  3KUY A;  3MGP A;  3UTA D;  3UT9 B;  5B24 D;  5CP6 C;  5CPI D;  5B31 B;  5BS7 C;  4Z66 A;  3AZF D;  4CAY A;  5CP6 B;  1KX4 D;  2BYK A;  5B0Y B;  4QLC D;  3MNN A;  3AV1 D;  1KX3 D;  5DNM D;  5GT0 A;  3REI D;  5AV6 B;  3X1U C;  5GSU C;  3O62 C;  4LD9 D;  3AZE A;  5B32 D;  4R8P C;  1F66 A;  3O62 B;  5E5A D;  3AYW B;  3W98 C;  4J8V B;  4ZBJ C;  2HUE C;  5B33 B;  1ID3 A;  3UTA C;  2NZD D;  3WTP A;  4UUZ A;  2JSS A;  4EO5 C;  5GT3 C;  3LZ1 B;  4H9N A;  3TU4 A;  5CPI C;  1P3P D;  5B24 B;  5G49 A;  4EO5 B;  5BNX B;  3WA9 A;  3AZF C;  1P3F D;  1P3O D;  2FJ7 A;  1M19 C;  1EQZ D;  3NQU B;  1KX4 C;  3REJ A;  3B6F D;  3AV1 C;  1KX3 C;  3W96 D;  5B2I D;  5JRG C;  5DNM C;  3LZ0 A;  3REI C;  3AV2 A;  3B6G A;  1AOI D;  4QLC B;  3AV1 B;  1KX3 B;  5DNM B;  3REI B;  5B1L C;  5E5A C;  1ZLA A;  4JJN A;  4LD9 B;  5B32 B;  1M1A B;  5E5A B;  3MVD D;  2NZD C;  1P3B C;  3WKJ B;  3KUY C;  1P3P C;  1ID3 D;  3B0C T;  2CV5 D;  1P3O C;  4HGA B;  5AV8 D;  1P3M D;  4NFT A;  1P3F B;  1P3O B;  4Z66 C;  5F99 A;  5AVC A;  4YM6 D;  3W96 C;  5B2I C;  1P3K D;  1EQZ B;  3AZJ D;  3AFA D;  3B6F B;  3FDD A;  3W96 B;  5B2I B;  3MNN C;  1P34 A;  3AZG D;  5B2J D;  3C1C A;  4H9Q A;  1AOI B;  3AZE C;  2YFW B;  1F66 C;  4NE5 A;  3VH5 T;  3MVD C;  3IP4 C;  3REK A;  3AZI D;  4M6B A;  2PYO D;  4KHA B;  1ID3 C;  4CSR B;  3MGR D;  4J8U A;  3W97 A;  3EPK A;  3TU4 C;  1HQ3 A;  2CWE A;  5AV8 C;  3MGS A;  2CV5 B;  3WA9 C;  4Z5T D;  4WU8 D;  5GXQ D;  5AV9 A;  5AV8 B;  3B0B A;  3AFA C;  1P3M B;  3X1T D;  5CPK A;  5CPJ A;  4YM6 B;  2L5A A;  1P3K B;  3AZG C;  3AZJ B;  5B40 A;  1W2E A;  3AFA B;  3X1S D;  5B2J C;  2Y2G A;  4G91 B;  3AZG B;  3KWQ D;  3A1I A;  5B2J B;  2FFF B;  1ZLA C;  2NQB A;  3AZI C;  2G5H C;  3C1B A;  3MGR C;  2PYO B;  5AY8 A;  1JFI A;  4Z5T C;  3A1K A;  2ARO A;  3X1T C;  5B0Y A;  3LEL A;  4WU8 B;  1BH8 B;  5AVC C;  5F99 C;  5GXQ B;  3X1V A;  5AV6 A;  3AZN A;  4KUD A;  3R45 B;  3F6T A;  2BYM B;  1P3I D;  5CPJ D;  1P34 C;  5BNV B;  3X1S B;  4J8V A;  3AZK A;  2XD5 A;  5B33 A;  1KX5 D;  4AWL B;  3KWQ B;  2F8N K;  3UTB D;  3KXB D;  1Z2C B;  1P3A A;  4KGC A;  5AVB D;  3B0D B;  3V9R B;  4R8P D;  4J8U C;  3REH B;  3W97 C;  3W98 D;  1HQ3 C;  5DNN D;  3NQU A;  5AY8 D;  3MGS C;  5GT3 D;  5BO0 A;  2HIO D;  3LJA A;  3VH5 W;  1N1J B;  1B6W A;  5CPK C;  1P3I C;  2ZY4 A;  5CPJ C;  1KU5 A;  3VH6 A;  1M19 D;  2G5I C;  1P3I B;  1P3L A;  1M1A A;  1KX5 C;  5B1M D;  5JRG D;  3UTB C;  3KXB C;  4WU9 A;  2Y2H A;  5AV5 A;  1KX5 B;  2ZY3 A;  5AVB C;  2NQB C;  4H9S A;  3UTB B;  3X1U B;  5FUG B;  5B1L D;  5GSU B;  3AZM D;  5AVB B;  4J8W A;  4E44 A;  4R8P B;  4YS3 A;  4XUJ D;  4Z2M G;  5DNN C;  3REL D;  5AY8 C;  1B67 A;  1P3B D;  1TZY D;  3W98 B;  2HIO C;  2RVQ D;  2HUE B;  4ZBJ B;  5DNN B;  3KUY D;  3UTA B;  3MGP D;  5GT3 B;  3LEL C;  2IO5 C;  5CPI B;  4KUD C;  2Y2J A;  4H9P B;  3AZF B;  5B1M C;  4Z66 D;  2IO5 B;  1M19 B;  4ZUX A;  1P3G A;  3A6N A;  1KX4 B;  3AZK C;  5B1M B;  3W99 A;  3MNN D;  5JRG B;  3AZH A;  1BH9 B;  5GT0 D;  3AZM C;  4KGC C;  3AZE D;  1H3O B;  4XUJ C;  5B1L B;  3REL C;  1F66 D;  3AZM B;  3MGQ A;  1TZY C;  1F1E A;  4H9O A;  2RVQ C;  3EG5 B;  3REL B;  3MGP C;  5JA4 B;  2NZD B;  1P3B B;  3WTP D;  3WAA A;  4WNN B;  3TU4 D;  3KUY B;  3NQJ A;  1P3P B;  3MGP B;  2Y2I A;  3EPH A;  2JE5 A;  3WA9 D;  2J8P A;  4WJ3 C;  2FJ7 D;  4NE6 A;  5C3I C;  4J8X A;  5BT1 C;  1U35 A;  1P3L C;  4Z66 B;  3REJ D;  4CAY B;  1S32 A;  1PZR A;  4G92 C;  5GT0 C;  4ZUX D;  3LZ0 D;  3KSY A;  3AV2 D;  3B6G D;  2BYK B;  4WU9 C;  5AV5 C;  3MNN B;  4H9S C;  2F8N A;  1ZLA D;  4JJN D;  4J8W C;  3AZE B;  4H9R A;  2VQR A;  1F66 B;  3MVD B;  3AZL A;  3WTP C;  3MGQ D;  2Y2Q A;  1ID3 B;  4UUZ B;  1TAF A;  4H9N B;  3TU4 B;  5BNV A;  2FJ7 C;  3WA9 B;  5G49 B;  3REJ C;  5F99 D;  5AVC D;  4X23 A;  4ZUX C;  4XZQ A;  3LZ0 C;  4WZS B;  4J8X D;  3AL0 C;  3AV2 C;  1P3G C;  3A6N C;  3B6G C;  3REJ B;  3V9R A;  1M18 A;  1P34 D;  2DF4 C;  3LZ0 B;  3AZH C;  3AN2 A;  3AV2 B;  3C1C D;  3B6G B;  4JJN C;  5B0Z A;  1WWI A;  3UT9 A;  2Y2P A;  3REK D;  3MGQ C;  4JJN B;  1ZLA B;  3AZI B;  5B31 A;  3MGR B;  3AZL D;  5CP6 A;  4J8U D;  3W97 D;  2RIQ A;  2YFV B;  1HQ3 D;  2ZY2 A;  2F8N G;  4WV4 B;  3MGS D; 
#chains in the Genus database with same CATH homology
 4Z5T B;  4E45 A;  5AV9 D;  4J8X C;  3X1T B;  5CPK D;  5AVC B;  5F99 B;  3X1U A;  1S32 C;  5GSU A;  3O62 A;  5B40 D;  1HTA A;  3C1C C;  3AYW A;  2DQN C;  3EPJ A;  1P34 B;  3AN2 D;  2ZY5 A;  3C1C B;  3LZ1 A;  3REK C;  2NQB D;  2BG1 A;  3UTA A;  3C1B D;  5B24 A;  5BNX A;  1A7W A;  2W8S A;  3REK B;  3AZL C;  5CPI A;  4H9P A;  3P5J B;  3AZF A;  4J8U B;  3W97 B;  1HQ3 B;  5AV9 C;  2ARO D;  2Y2M A;  3MGS B;  1KX4 A;  4QLC A;  3AV1 A;  5B0Y D;  3LEL D;  1KX3 A;  5DNM A;  3REI A;  1BH9 A;  5AV9 B;  3X1V D;  5AV6 D;  4X23 C;  5B40 C;  4XZQ C;  3AZN D;  5B31 G;  5KDM B;  5CPK B;  4KUD D;  4LD9 A;  5CPJ B;  5B32 A;  1H3O A;  1BFM A;  5E5A A;  3AN2 C;  2Y2K A;  4J8V D;  3AZK D;  5B0Z C;  5B33 D;  3WKJ A;  5JA4 A;  3C1B C;  2NZD A;  3VH6 T;  3KXB B;  3LZ1 D;  4WNN A;  1P3A D;  2NQB B;  4KGC D;  1P3P A;  5B31 C;  3C1B B;  1P3F A;  1P3O A;  4Z2M H;  1EQZ A;  2ARO C;  5AY8 B;  1JFI B;  3B6F A;  5B0Y C;  3W96 A;  5B2I A;  2HIO B;  3LJA D;  3X1V C;  5AV6 C;  2ARO B;  3AZN C;  1AOI A;  3LEL B;  3H0R C;  2YFW A;  3X1V B;  3AZN B;  4KUD B;  5BT1 D;  3AYW C;  4J8V C;  1P3L D;  1M1A D;  5B33 C;  4KHA A;  3MVD A;  4CSR A;  3WTP E;  3LZ1 C;  2Y2L A;  3AZK B;  1P3A C;  4WU9 D;  5AV5 D;  3WKJ D;  5B24 C;  2CV5 A;  1P3A B;  4KGC B;  4J8W D;  5AV8 A;  5B32 G;  1P3M A;  4XUJ B;  4YS3 D;  4YM6 A;  1TZY B;  1P3K A;  3AZJ A;  3AFA A;  3LJA C;  2Y2N A;  4DRA A;  4QLC C;  5BO0 B;  3AZG A;  3LJA B;  5B2J A;  4LD9 C;  5B32 C;  1M1A C;  5C3I B;  3H0L C;  1P3L B;  1P3G D;  3A6N D;  3AZI A;  2PYO A;  3WKJ C;  3W99 D;  2JCH A;  5GT0 B;  3MGR A;  4G92 B;  3AZH D;  4WU9 B;  5AV5 B;  2ZM5 A;  2YFV A;  3H0M C;  3KFU G;  4HGA C;  4YS3 C;  4Z5T A;  1T3U A;  4WU8 A;  1P3F C;  1BH8 A;  5GXQ A;  4J8W B;  1EQZ C;  5CHL B;  3X1T A;  4YS3 B;  3R45 A;  2BYM A;  3B6F C;  3WTP B;  3WAA D;  3VH5 A;  3VH6 W;  3X1S A;  1AOI C;  3KWQ A;  2FJ7 B;  1U35 D;  3W99 C;  1S32 D;  4ZUX B;  3REH A;  3A6N B;  1P3G B;  3W99 B;  3AZH B;  2F8N D;  2CV5 C;  1N1J A;  1P3M C;  4NE3 A;  4YM6 C;  3MGQ B;  3WAA C;  1P3K C;  4H9O B;  3AZJ C;  1R4V A;  4DQY B;  5KDM A;  1P3I A;  5BS7 A;  3WAA B;  4G91 C;  1ULY A;  2F8N H;  3NQJ B;  1U35 C;  1KX5 A;  1Q9C A;  3UTB A;  3KXB A;  5FUG A;  4X23 D;  4J8X B;  4XZQ D;  1U35 B;  5AVB A;  4R8P A;  4UPK A;  2Y2O A;  1S32 B;  1M18 D;  2PYO C;  3W98 A;  3REH D;  4H9Q B;  5B0Z D;  4DRB A;  5DNN A;  2F8N B;  3UT9 D;  5GT3 A;  4WU8 C;  2HIO A;  5GXQ C;  4H9R B;  5B31 D;  3AZL B;  5CP6 D;  1M19 A;  3X1S C;  2XD1 A;  1TAF B;  5B1M A;  2UWX A;  4AWL C;  3KWQ C;  3B0C W;  5JRG A;  3EPL A;  2LY8 A;  2F2A C;  3B0D C;  1M18 C;  5B1L A;  3X1U D;  4X23 B;  5B40 B;  4XZQ B;  5GSU D;  3O62 D;  3AZM A;  3REH C;  3AYW D;  1M18 B;  4XUJ A;  3REL A;  3AN2 B;  1P3B A;  1TZY A;  3UT9 C;  1WWS A;  5B0Z B;  3KUY A;  3MGP A;  3UTA D;  3UT9 B;  5B24 D;  5CP6 C;  5CPI D;  5B31 B;  5BS7 C;  4Z66 A;  3AZF D;  4CAY A;  5CP6 B;  1KX4 D;  2BYK A;  5B0Y B;  4QLC D;  3MNN A;  3AV1 D;  1KX3 D;  5DNM D;  5GT0 A;  3REI D;  5AV6 B;  3X1U C;  5GSU C;  3O62 C;  4LD9 D;  3AZE A;  5B32 D;  4R8P C;  1F66 A;  3O62 B;  5E5A D;  3AYW B;  3W98 C;  4J8V B;  4ZBJ C;  2HUE C;  5B33 B;  1ID3 A;  3UTA C;  2NZD D;  3WTP A;  4UUZ A;  2JSS A;  4EO5 C;  5GT3 C;  3LZ1 B;  4H9N A;  3TU4 A;  5CPI C;  1P3P D;  5B24 B;  5G49 A;  4EO5 B;  5BNX B;  3WA9 A;  3AZF C;  1P3F D;  1P3O D;  2FJ7 A;  1M19 C;  1EQZ D;  3NQU B;  1KX4 C;  3REJ A;  3B6F D;  3AV1 C;  1KX3 C;  3W96 D;  5B2I D;  5JRG C;  5DNM C;  3LZ0 A;  3REI C;  3AV2 A;  3B6G A;  1AOI D;  4QLC B;  3AV1 B;  1KX3 B;  5DNM B;  3REI B;  5B1L C;  5E5A C;  1ZLA A;  4JJN A;  4LD9 B;  5B32 B;  1M1A B;  5E5A B;  3MVD D;  2NZD C;  1P3B C;  3WKJ B;  3KUY C;  1P3P C;  1ID3 D;  3B0C T;  2CV5 D;  1P3O C;  4HGA B;  5AV8 D;  1P3M D;  4NFT A;  1P3F B;  1P3O B;  4Z66 C;  5F99 A;  5AVC A;  4YM6 D;  3W96 C;  5B2I C;  1P3K D;  1EQZ B;  3AZJ D;  3AFA D;  3B6F B;  3FDD A;  3W96 B;  5B2I B;  3MNN C;  1P34 A;  3AZG D;  5B2J D;  3C1C A;  4H9Q A;  1AOI B;  3AZE C;  2YFW B;  1F66 C;  4NE5 A;  3VH5 T;  3MVD C;  3IP4 C;  3REK A;  3AZI D;  4M6B A;  2PYO D;  4KHA B;  1ID3 C;  4CSR B;  3MGR D;  4J8U A;  3W97 A;  3EPK A;  3TU4 C;  1HQ3 A;  2CWE A;  5AV8 C;  3MGS A;  2CV5 B;  3WA9 C;  4Z5T D;  4WU8 D;  5GXQ D;  5AV9 A;  5AV8 B;  3B0B A;  3AFA C;  1P3M B;  3X1T D;  5CPK A;  5CPJ A;  4YM6 B;  2L5A A;  1P3K B;  3AZG C;  3AZJ B;  5B40 A;  1W2E A;  3AFA B;  3X1S D;  5B2J C;  2Y2G A;  4G91 B;  3AZG B;  3KWQ D;  3A1I A;  5B2J B;  2FFF B;  1ZLA C;  2NQB A;  3AZI C;  2G5H C;  3C1B A;  3MGR C;  2PYO B;  5AY8 A;  1JFI A;  4Z5T C;  3A1K A;  2ARO A;  3X1T C;  5B0Y A;  3LEL A;  4WU8 B;  1BH8 B;  5AVC C;  5F99 C;  5GXQ B;  3X1V A;  5AV6 A;  3AZN A;  4KUD A;  3R45 B;  3F6T A;  2BYM B;  1P3I D;  5CPJ D;  1P34 C;  5BNV B;  3X1S B;  4J8V A;  3AZK A;  2XD5 A;  5B33 A;  1KX5 D;  4AWL B;  3KWQ B;  2F8N K;  3UTB D;  3KXB D;  1Z2C B;  1P3A A;  4KGC A;  5AVB D;  3B0D B;  3V9R B;  4R8P D;  4J8U C;  3REH B;  3W97 C;  3W98 D;  1HQ3 C;  5DNN D;  3NQU A;  5AY8 D;  3MGS C;  5GT3 D;  5BO0 A;  2HIO D;  3LJA A;  3VH5 W;  1N1J B;  1B6W A;  5CPK C;  1P3I C;  2ZY4 A;  5CPJ C;  1KU5 A;  3VH6 A;  1M19 D;  2G5I C;  1P3I B;  1P3L A;  1M1A A;  1KX5 C;  5B1M D;  5JRG D;  3UTB C;  3KXB C;  4WU9 A;  2Y2H A;  5AV5 A;  1KX5 B;  2ZY3 A;  5AVB C;  2NQB C;  4H9S A;  3UTB B;  3X1U B;  5FUG B;  5B1L D;  5GSU B;  3AZM D;  5AVB B;  4J8W A;  4E44 A;  4R8P B;  4YS3 A;  4XUJ D;  4Z2M G;  5DNN C;  3REL D;  5AY8 C;  1B67 A;  1P3B D;  1TZY D;  3W98 B;  2HIO C;  2RVQ D;  2HUE B;  4ZBJ B;  5DNN B;  3KUY D;  3UTA B;  3MGP D;  5GT3 B;  3LEL C;  2IO5 C;  5CPI B;  4KUD C;  2Y2J A;  4H9P B;  3AZF B;  5B1M C;  4Z66 D;  2IO5 B;  1M19 B;  4ZUX A;  1P3G A;  3A6N A;  1KX4 B;  3AZK C;  5B1M B;  3W99 A;  3MNN D;  5JRG B;  3AZH A;  1BH9 B;  5GT0 D;  3AZM C;  4KGC C;  3AZE D;  1H3O B;  4XUJ C;  5B1L B;  3REL C;  1F66 D;  3AZM B;  3MGQ A;  1TZY C;  1F1E A;  4H9O A;  2RVQ C;  3EG5 B;  3REL B;  3MGP C;  5JA4 B;  2NZD B;  1P3B B;  3WTP D;  3WAA A;  4WNN B;  3TU4 D;  3KUY B;  3NQJ A;  1P3P B;  3MGP B;  2Y2I A;  3EPH A;  2JE5 A;  3WA9 D;  2J8P A;  4WJ3 C;  2FJ7 D;  4NE6 A;  5C3I C;  4J8X A;  5BT1 C;  1U35 A;  1P3L C;  4Z66 B;  3REJ D;  4CAY B;  1S32 A;  1PZR A;  4G92 C;  5GT0 C;  4ZUX D;  3LZ0 D;  3KSY A;  3AV2 D;  3B6G D;  2BYK B;  4WU9 C;  5AV5 C;  3MNN B;  4H9S C;  2F8N A;  1ZLA D;  4JJN D;  4J8W C;  3AZE B;  4H9R A;  2VQR A;  1F66 B;  3MVD B;  3AZL A;  3WTP C;  3MGQ D;  2Y2Q A;  1ID3 B;  4UUZ B;  1TAF A;  4H9N B;  3TU4 B;  5BNV A;  2FJ7 C;  3WA9 B;  5G49 B;  3REJ C;  5F99 D;  5AVC D;  4X23 A;  4ZUX C;  4XZQ A;  3LZ0 C;  4WZS B;  4J8X D;  3AL0 C;  3AV2 C;  1P3G C;  3A6N C;  3B6G C;  3REJ B;  3V9R A;  1M18 A;  1P34 D;  2DF4 C;  3LZ0 B;  3AZH C;  3AN2 A;  3AV2 B;  3C1C D;  3B6G B;  4JJN C;  5B0Z A;  1WWI A;  3UT9 A;  2Y2P A;  3REK D;  3MGQ C;  4JJN B;  1ZLA B;  3AZI B;  5B31 A;  3MGR B;  3AZL D;  5CP6 A;  4J8U D;  3W97 D;  2RIQ A;  2YFV B;  1HQ3 D;  2ZY2 A;  2F8N G;  4WV4 B;  3MGS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...