4KUDD

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudD00
3AZKC 4KUDA 4LD9D 5B32D 4H9PA 5GXQC 5B0ZD 3LELA 1F1EA 3AV1A 1ZLAD 4DRBA 3AZHA 1KX4B 3MNNB 1M1AB 5CPJA 3W96A 4H9NB 4KUDD 3W99C 4X23C 4KGCC 3AFAB 3X1TA 4J8WB 5AVBB 3TU4A 4H9SA 1S32B 5AVCB 3AV1D 4H9QB 3AZHD 1ID3C 1KX3A 3B0CT 2BYKB 3W96D 5B31G 5CPKA 3X1TD 4WNNA 3TU4D 4XUJA 3AV2B 1KX4A 1M1AA 5B33B 3AZLC 5AY8B 3C1BB 1KX3D 4Z5TC 3AZFB 3UTBA 3AZNC 1S32A 5CPKD 3KUYC 4XUJD 1P3MB 1P3KB 5AV5B 5B1MB 3MGRC 5KDMB 5AV9C 5CP6C 3UTBD 5AY8A 3AZKB 5JRGB 3O62C 1P3GA 4WV4B 3LZ1B 4JJNB 5DNNB 3MGQB 5B2JA 2FJ7C 4WU9C 1F66A 1P3KA 1U35C 5AY8D 1P34A 1WWIA 5B24A 4X23B 3AYWA 3AN2C 3KWQC 1P3GD 3NQJA 3W97C 4YS3C 3AZKA 4EO5B 4XZQB 3X1UB 5B2JD 5GXQA 5JRGA 1F66D 2NZDC 1P34D 5B24D 3AYWD 2JSSA 5DNNA 3B6FC 5B2IB 3AZKD 4X23A 4KGCA 2LY8A 5CPIB 5GXQD 4Z2MH 1N1JA 5FUGA 3NQUA 3WKJB 3W99D 4X23D 4KGCD 1TAFB 3LELC 1AOIB 3AZLA 5B2IA 4WU8C 5CPJC 1ID3D 2F8NA 4Z5TA 3AZNA 4AWLC 1BH9B 3AZLD 5JA4A 4KHAA 3MGRA 2F8ND 5AV9A 4Z5TD 3V9RA 5CP6A 3AZND 1P3IB 1KX4C 3KUYD 3MNNC 4H9OB 1M1AC 4YS3B 3AFAC 4J8WC 3O62A 5AVBC 3MGRD 3UTAC 4CSRB 5AV9D 1S32C 5CP6D 1BH9A 5AVCC 3C1CB 3UT9C 2FJ7A 1U35A 2BYMB 1P3FC 5B32G 3AN2A 3KWQA 3O62D 3AV2C 3W97A 4Z66B 4YS3A 5B33C 2FJ7D 5BO0A 4WU9D 3RELB 3C1BC 1U35D 3LJAB 3AZFC 4CSRA 1BFMA 4R8PB 3B6FA 3AN2D 3KWQD 3W97D 4YS3D 1P3MC 2BYMA 5BNXA 1P3KC 5AV5C 5B1MC 2NZDD 3REIC 4ZBJB 3B6FD 5JRGC 3AZMB 3REJB 3LZ1C 4JJNC 3WTPB 5DNNC 3MGQC 2F8NK 4WU8A 4J8UB 3UTAB 3LELD 3UT9B 3VH6A 4EO5C 4XZQC 3X1UC 1B6WA 4WU8D 5CPJD 1P3FB 3REJA 3WTPA 3MNNA 1M18B 1B67A 4H9NA 5B2IC 1ULYA 3AFAA 5CPIC 4J8WA 5AVBA 3UTAA 4E45A 5C3IB 5B1LB 5AVCA 3UT9A 4H9QA 4WZSB 1KX4D 3MNND 3WKJC 1M1AD 2BYKA 1P3FA 3AFAD 4J8WD 1AOIC 5AVBD 2NQBB 3AV2A 3REIB 3UTAD 1S32D 5B33A 3B6GB 5AVCD 3UT9D 3REHB 2YFWB 2YFVB 3C1BA 2AROB 3AZFA 1P3FD 5DNMB 5B1LA 3AZGB 2L5AA 3X1VB 5CHLB 2CV5B 3AV2D 4UUZB 5B33D 1P3MA 3B0CW 1P3LB 5AV5A 5B1MA 3C1BD 5KDMA 4ZUXB 3REIA 3AZFD 1P3IC 1P3MD 5DNMA 3X1VA 1P3KD 5AV5D 5B1MD 3W98B 3LZ1A 4JJNA 1KX5B 3MGQA 3C1CC 3VH5W 2HIOB 5JRGD 4CAYB 2F8NG 4Z66C 3LZ1D 4JJND 3B0DB 4XZQA 5DNND 3MGQD 3X1UA 5F99B 3RELC 3KXBB 1M19B 3LJAC 3MGSB 4R8PC 4YM6B 5AV8B 5G49B 1JFIB 4XZQD 3X1UD 3MVDB 5CPIA 3X1SB 4QLCC 1HTAA 5BNVB 4ZBJC 3WKJA 4M6BA 5B2ID 1Q9CA 1EQZC 5CPID 1TAFA 1AOIA 3AZMC 4YM6A 3REJC 1P3PB 3WTPC 3VH6T 4J8UC 3WKJD 3MVDA 3WA9C 4NE5A 1WWSA 3A6NB 2HUEB 1AOID 4J8VB 3REKC 1R4VA 1P3IA 4H9OA 1M18C 5AV6B 5GT3B 2PYOB 5C3IC 3AZJB 5B1LC 1TZYB 1KU5A 1HQ3B 3C1CA 1P3ID 4J8VA 5B0YB 1P3BB 3AZEB 2IO5B 4QLCB 3LZ0B 2NQBC 5B31C 4Z66A 5GT0C 3B6GC 5B32B 3C1CD 3MGPC 3REHC 5B0ZB 3RELA 3LJAA 2AROC 1ZLAB 5DNMC 3X1VC 1TZYA 3AZGC 1EQZB 4R8PA 2CV5C 4J8XC 4Z66D 1P3BA 4KUDB 1P3OC 4NE3A 4HGAB 1P3LC 3RELD 4QLCA 3WA9B 3LZ0A 3LJAD 4ZUXC 3AV1B 3AZHB 4R8PD 3W96B 3WTPE 3X1TB 1EQZA 1BH8B 3TU4B 3AZMA 3W98C 3WAAC 4QLCD 3REKB 1KX5C 2RVQC 4J8UA 1KX3B 4G91B 3WA9A 4Z2MG 2HIOC 5CPKB 1EQZD 4WNNB 4XUJB 3AZMD 3REJD 3B0DC 3WTPD 5F99C 4J8UD 1M19C 3KXBC 1BH8A 2CWEA 3MGSC 3UTBB 3AZIC 3REKA 3WA9D 4YM6C 5B31B 1M18A 5GT0B 5AV8C 3MGPB 3MVDC 3X1SC 3REKD 1H3OB 4J8XB 1M18D 1P3OB 1A7WA 4G92C 5B40C 1P3GB 2NQBA 1P3PC 5B31A 5B1LD 3VH5T 5GT0A 3B6GA 5B2JB 3MGPA 3REHA 2YFWA 1F66B 2YFVA 1P34B 4DRAA 5B24B 2AROA 3AYWB 5BS7C 3AZGA 3A6NC 2HUEC 3WAAB 1H3OA 2CV5A 3NQJB 2NQBD 4J8XA 4UUZA 5B31D 3REID 4H9RB 5GSUC 5GT0D 1P3OA 3B6GD 4J8VC 3MGPD 5GXQB 3REHD 1P3LA 5BT1C 1P3AC 2AROD 4ZUXA 5DNMD 3X1VD 3AZGD 5E5AC 3KSYA 2CV5D 4J8XD 3W99B 1P3OD 4KGCB 5AV6C 1P3LD 3W98A 5GT3C 3AZIB 2PYOC 3AZJC 3WAAA 1TZYC 4ZUXD 1KX5A 1HQ3C 1N1JB 4H9RA 4NE6A 5FUGB 1ID3B 3NQUB 5B0YC 4E44A 1P3BC 3AZEC 2HIOA 2IO5C 3LZ0C 4CAYA 3W98D 3WAAD 3AZLB 4LD9C 5B32C 1KX5D 2RVQD 3W99A 5F99A 5B0ZC 1M19A 3KXBA 2F8NB 4Z5TB 3MGSA 3AZNB 4G92B 3AZIA 1ZLAC 2HIOD 5B40B 3KUYB 1ID3A 5AV8A 5G49A 1JFIA 4KUDC 5F99D 4HGAC 4KHAB 3X1SA 5JA4B 3KXBD 3MGRB 5AV9B 5BNVA 1M19D 3V9RB 5CP6B 3MGSD 3AZID 3AV1C 3VH5A 3AZHC 4YM6D 5GSUB 3W96C 5AV8D 3X1TC 5B40A 1P3AB 3O62B 3MVDD 3KUYA 3TU4C 4H9SC 3X1SD 1P3PA 5E5AB 4NFTA 2FJ7B 4WU9B 1U35B 1KX3C 4G91C 5BS7A 5CPKC 3A6NA 3AN2B 5B40D 3KWQB 4XUJC 1P3PD 3W97B 5GSUA 5BO0B 2NZDB 1P3AA 3UTBC 3A6ND 5E5AA 3B6FB 3R45B 4WU9A 4LD9B 3VH6W 5GSUD 5BNXB 4J8VD 5AV6A 5BT1D 5GT3A 1P3AD 2PYOA 3AZJA 1HQ3A 5E5AD 2F8NH 5AY8C 5B0YA 2NZDA 3AZEA 4H9PB 5AV6D 3LELB 1P3GC 3R45A 3B0BA 5GT3D 3AZJD 2PYOD 1TZYD 5B32A 4LD9A 1HQ3D 5B2JC 4WU8B 5B0ZA 5CPJB 1F66C 5B0YD 1P34C 1P3BD 5B24C 3AYWC 3AZED 1ZLAA 4AWLB 3LZ0D
chains in the Genus database with same CATH superfamily
3AZKC 4KUDA 4LD9D 5B32D 4H9PA 2UWXA 5GXQC 5B0ZD 3LELA 1F1EA 3AV1A 1ZLAD 4DRBA 3AZHA 1KX4B 3MNNB 1M1AB 5CPJA 3W96A 4H9NB 4KUDD 3W99C 4X23C 4KGCC 3AFAB 3X1TA 4J8WB 5AVBB 3TU4A 4H9SA 3F6TA 1S32B 5AVCB 3AV1D 4H9QB 3AZHD 1ID3C 1T3UA 1KX3A 3B0CT 2BYKB 3W96D 5B31G 5CPKA 3X1TD 3H0MC 4WNNA 3TU4D 4XUJA 3AV2B 1KX4A 1M1AA 5B33B 3AZLC 5AY8B 3C1BB 1KX3D 4Z5TC 3AZFB 3UTBA 3AZNC 1S32A 5CPKD 3KUYC 2Y2PA 4XUJD 1P3MB 1P3KB 5AV5B 5B1MB 3MGRC 5KDMB 5AV9C 5CP6C 3UTBD 5AY8A 3AZKB 2ZY5A 5JRGB 3O62C 1P3GA 3P5JB 4WV4B 3LZ1B 4JJNB 5DNNB 3MGQB 5B2JA 2VQRA 2FJ7C 4WU9C 1F66A 1P3KA 1U35C 5AY8D 1P34A 1WWIA 5B24A 4X23B 3AYWA 3EPKA 3AN2C 3KWQC 1P3GD 3NQJA 3W97C 4YS3C 3AZKA 4EO5B 4XZQB 3X1UB 5B2JD 5GXQA 5JRGA 1F66D 2NZDC 1P34D 5B24D 3AYWD 2JSSA 5DNNA 3B6FC 5B2IB 3AZKD 4UPKA 4X23A 4KGCA 2LY8A 5CPIB 5GXQD 4Z2MH 2J8PA 2XD5A 1N1JA 2ZY4A 5FUGA 3NQUA 3WKJB 3W99D 4X23D 4KGCD 1TAFB 3LELC 1AOIB 3H0RC 3AZLA 5B2IA 4WU8C 5CPJC 1ID3D 2F8NA 4Z5TA 3AZNA 2F2AC 4AWLC 1BH9B 3AZLD 5JA4A 4KHAA 3MGRA 2F8ND 5AV9A 4Z5TD 3V9RA 5CP6A 3AZND 1P3IB 1KX4C 3KUYD 3MNNC 4H9OB 1M1AC 4YS3B 3AFAC 4J8WC 3O62A 5AVBC 3MGRD 3UTAC 4CSRB 5AV9D 1S32C 5CP6D 1BH9A 5AVCC 3C1CB 3UT9C 2FJ7A 1U35A 2BYMB 1P3FC 5B32G 3AN2A 3KWQA 3O62D 3AV2C 3W97A 2JE5A 4Z66B 5B33C 4YS3A 2FJ7D 2ZY2A 5BO0A 4WU9D 3RELB 3C1BC 1U35D 3LJAB 4DQYB 3IP4C 4CSRA 3AZFC 1BFMA 4R8PB 3B6FA 3AN2D 3EPHA 3KWQD 3W97D 4YS3D 1P3MC 2BYMA 1W2EA 5BNXA 1P3KC 5AV5C 5B1MC 3EPLA 2NZDD 3KFUG 3REIC 4ZBJB 3B6FD 5JRGC 2Y2MA 3AZMB 3REJB 3LZ1C 4JJNC 2Y2QA 3WTPB 5DNNC 3MGQC 2F8NK 4WU8A 4J8UB 3UTAB 3LELD 3UT9B 3VH6A 4EO5C 4XZQC 3X1UC 1B6WA 4WU8D 5CPJD 1P3FB 3REJA 3WTPA 3MNNA 1M18B 1B67A 4H9NA 5B2IC 1ULYA 3AFAA 5CPIC 4J8WA 5AVBA 3UTAA 4E45A 5C3IB 5B1LB 5AVCA 3UT9A 4H9QA 4WZSB 1KX4D 3MNND 3WKJC 1M1AD 2BYKA 1P3FA 3AFAD 4J8WD 1AOIC 5AVBD 2NQBB 3AV2A 3REIB 3UTAD 1S32D 5B33A 3B6GB 5AVCD 3UT9D 3REHB 2YFWB 2YFVB 3C1BA 2AROB 3AZFA 1P3FD 5DNMB 5B1LA 3AZGB 2L5AA 3X1VB 5CHLB 2CV5B 3AV2D 4UUZB 5B33D 1P3MA 3B0CW 1P3LB 5AV5A 5B1MA 3C1BD 2Y2IA 5KDMA 4ZUXB 3REIA 3AZFD 1P3IC 1P3MD 5DNMA 3X1VA 1P3KD 5AV5D 5B1MD 3W98B 3LZ1A 4JJNA 1KX5B 3MGQA 3C1CC 2XD1A 3VH5W 2HIOB 5JRGD 4CAYB 2F8NG 4Z66C 3LZ1D 4JJND 3B0DB 4XZQA 5DNND 3MGQD 3X1UA 5F99B 3RELC 3KXBB 1M19B 2G5IC 3H0LC 3LJAC 3MGSB 4R8PC 4YM6B 2W8SA 5AV8B 5G49B 1JFIB 4XZQD 3X1UD 3MVDB 5CPIA 3X1SB 4QLCC 1HTAA 5BNVB 2G5HC 4ZBJC 3WKJA 4M6BA 5B2ID 1Q9CA 1EQZC 5CPID 1TAFA 1AOIA 3AZMC 4YM6A 3REJC 1P3PB 4WJ3C 3WTPC 3VH6T 4J8UC 3WKJD 3MVDA 3WA9C 4NE5A 1WWSA 2Y2LA 3A6NB 2HUEB 1AOID 4J8VB 3REKC 1R4VA 1P3IA 4H9OA 1M18C 2ZY3A 5AV6B 5GT3B 2PYOB 5C3IC 3AZJB 5B1LC 1TZYB 1KU5A 1HQ3B 3C1CA 1P3ID 4J8VA 5B0YB 1P3BB 3AZEB 2IO5B 4QLCB 3LZ0B 2NQBC 5B31C 4Z66A 5GT0C 3B6GC 5B32B 3C1CD 3MGPC 1PZRA 5B0ZB 3REHC 3RELA 3LJAA 2AROC 1ZLAB 5DNMC 3X1VC 1TZYA 3AZGC 1EQZB 4R8PA 3EG5B 2CV5C 4J8XC 4Z66D 1P3BA 4KUDB 1P3OC 4NE3A 3EPJA 4HGAB 1P3LC 3RELD 4QLCA 3WA9B 3LZ0A 3LJAD 4ZUXC 3AV1B 3AZHB 4R8PD 2Y2GA 2Y2KA 3W96B 3WTPE 3X1TB 1EQZA 1BH8B 3TU4B 3AZMA 3W98C 3WAAC 4QLCD 3REKB 1KX5C 2RVQC 1Z2CB 4J8UA 1KX3B 4G91B 3WA9A 4Z2MG 2HIOC 5CPKB 1EQZD 4WNNB 4XUJB 3AZMD 3REJD 3B0DC 3WTPD 5F99C 4J8UD 1M19C 3KXBC 1BH8A 2CWEA 3MGSC 3UTBB 2DF4C 3REKA 3AZIC 3WA9D 4YM6C 5B31B 1M18A 5GT0B 5AV8C 3MGPB 3MVDC 3X1SC 3REKD 1H3OB 4J8XB 1M18D 1P3OB 1A7WA 4G92C 2FFFB 5B40C 1P3GB 2NQBA 1P3PC 5B31A 5B1LD 3VH5T 5GT0A 3B6GA 5B2JB 3MGPA 3REHA 2YFWA 1F66B 2YFVA 1P34B 4DRAA 5B24B 2AROA 3AYWB 5BS7C 3AZGA 3A6NC 2HUEC 3WAAB 1H3OA 2CV5A 3NQJB 2NQBD 4J8XA 4UUZA 5B31D 3REID 4H9RB 5GSUC 5GT0D 1P3OA 3B6GD 4J8VC 3MGPD 5GXQB 3REHD 2Y2JA 1P3LA 5BT1C 1P3AC 2AROD 3FDDA 4ZUXA 5DNMD 3X1VD 3AZGD 5E5AC 3KSYA 2CV5D 4J8XD 3W99B 1P3OD 4KGCB 5AV6C 1P3LD 3W98A 5GT3C 3AZIB 2PYOC 3AZJC 2RIQA 3WAAA 1TZYC 4ZUXD 1KX5A 1HQ3C 1N1JB 4H9RA 4NE6A 5FUGB 1ID3B 3NQUB 5B0YC 4E44A 1P3BC 3AZEC 3A1KA 2HIOA 2IO5C 3LZ0C 4CAYA 3W98D 3WAAD 3AZLB 4LD9C 5B32C 1KX5D 2RVQD 3W99A 5F99A 5B0ZC 2JCHA 1M19A 3KXBA 2F8NB 4Z5TB 2ZM5A 3MGSA 3AZNB 4G92B 3AZIA 1ZLAC 2HIOD 5B40B 3KUYB 3A1IA 1ID3A 5AV8A 5G49A 1JFIA 4KUDC 5F99D 4HGAC 4KHAB 3X1SA 5JA4B 3KXBD 3MGRB 5AV9B 5BNVA 1M19D 5CP6B 3V9RB 3MGSD 3AZID 3AV1C 2Y2OA 3VH5A 3AZHC 4YM6D 5GSUB 3W96C 5AV8D 3X1TC 5B40A 1P3AB 3O62B 3MVDD 3KUYA 3TU4C 4H9SC 3X1SD 1P3PA 2Y2NA 5E5AB 4NFTA 2FJ7B 4WU9B 1U35B 1KX3C 4G91C 5BS7A 5CPKC 3A6NA 3AN2B 5B40D 3KWQB 4XUJC 1P3PD 3W97B 5GSUA 5BO0B 2NZDB 1P3AA 3UTBC 3A6ND 5E5AA 3B6FB 3R45B 4WU9A 4LD9B 3VH6W 2BG1A 5GSUD 5BNXB 4J8VD 5AV6A 5BT1D 5GT3A 1P3AD 2PYOA 3AZJA 1HQ3A 5E5AD 2F8NH 5AY8C 5B0YA 2NZDA 3AZEA 4H9PB 5AV6D 3LELB 1P3GC 3R45A 3B0BA 5GT3D 3AZJD 2PYOD 3AL0C 1TZYD 5B32A 4LD9A 1HQ3D 5B2JC 4WU8B 5B0ZA 5CPJB 1F66C 5B0YD 1P34C 1P3BD 5B24C 3AYWC 3AZED 1ZLAA 2Y2HA 2DQNC 4AWLB 3LZ0D
chains in the Genus database with same CATH topology
3AZKC 4KUDA 4LD9D 5B32D 4H9PA 2UWXA 5GXQC 5B0ZD 3LELA 1F1EA 3AV1A 1ZLAD 4DRBA 3AZHA 1KX4B 3MNNB 1M1AB 5CPJA 3W96A 4H9NB 4KUDD 3W99C 4X23C 4KGCC 3AFAB 3X1TA 4J8WB 5AVBB 3TU4A 4H9SA 3F6TA 1S32B 5AVCB 3AV1D 4H9QB 3AZHD 1ID3C 1T3UA 1KX3A 3B0CT 2BYKB 3W96D 5B31G 5CPKA 3X1TD 3H0MC 4WNNA 3TU4D 4XUJA 3AV2B 1KX4A 1M1AA 5B33B 3AZLC 5AY8B 3C1BB 1KX3D 4Z5TC 3AZFB 3UTBA 3AZNC 1S32A 5CPKD 3KUYC 2Y2PA 4XUJD 1P3MB 1P3KB 5AV5B 5B1MB 3MGRC 5KDMB 5AV9C 5CP6C 3UTBD 5AY8A 3AZKB 2ZY5A 5JRGB 3O62C 1P3GA 3P5JB 4WV4B 3LZ1B 4JJNB 5DNNB 3MGQB 5B2JA 2VQRA 2FJ7C 4WU9C 1F66A 1P3KA 1U35C 5AY8D 1P34A 1WWIA 5B24A 4X23B 3AYWA 3EPKA 3AN2C 3KWQC 1P3GD 3NQJA 3W97C 4YS3C 3AZKA 4EO5B 4XZQB 3X1UB 5B2JD 5GXQA 5JRGA 1F66D 2NZDC 1P34D 5B24D 3AYWD 2JSSA 5DNNA 3B6FC 5B2IB 3AZKD 4UPKA 4X23A 4KGCA 2LY8A 5CPIB 5GXQD 4Z2MH 2J8PA 2XD5A 1N1JA 2ZY4A 5FUGA 3NQUA 3WKJB 3W99D 4X23D 4KGCD 1TAFB 3LELC 1AOIB 3H0RC 3AZLA 5B2IA 4WU8C 5CPJC 1ID3D 2F8NA 4Z5TA 3AZNA 2F2AC 4AWLC 1BH9B 3AZLD 5JA4A 4KHAA 3MGRA 2F8ND 5AV9A 4Z5TD 3V9RA 5CP6A 3AZND 1P3IB 1KX4C 3KUYD 3MNNC 4H9OB 1M1AC 4YS3B 3AFAC 4J8WC 3O62A 5AVBC 3MGRD 3UTAC 4CSRB 5AV9D 1S32C 5CP6D 1BH9A 5AVCC 3C1CB 3UT9C 2FJ7A 1U35A 2BYMB 1P3FC 5B32G 3AN2A 3KWQA 3O62D 3AV2C 3W97A 2JE5A 4Z66B 5B33C 4YS3A 2FJ7D 2ZY2A 5BO0A 4WU9D 3RELB 3C1BC 1U35D 3LJAB 4DQYB 3IP4C 4CSRA 3AZFC 1BFMA 4R8PB 3B6FA 3AN2D 3EPHA 3KWQD 3W97D 4YS3D 1P3MC 2BYMA 1W2EA 5BNXA 1P3KC 5AV5C 5B1MC 3EPLA 2NZDD 3KFUG 3REIC 4ZBJB 3B6FD 5JRGC 2Y2MA 3AZMB 3REJB 3LZ1C 4JJNC 2Y2QA 3WTPB 5DNNC 3MGQC 2F8NK 4WU8A 4J8UB 3UTAB 3LELD 3UT9B 3VH6A 4EO5C 4XZQC 3X1UC 1B6WA 4WU8D 5CPJD 1P3FB 3REJA 3WTPA 3MNNA 1M18B 1B67A 4H9NA 5B2IC 1ULYA 3AFAA 5CPIC 4J8WA 5AVBA 3UTAA 4E45A 5C3IB 5B1LB 5AVCA 3UT9A 4H9QA 4WZSB 1KX4D 3MNND 3WKJC 1M1AD 2BYKA 1P3FA 3AFAD 4J8WD 1AOIC 5AVBD 2NQBB 3AV2A 3REIB 3UTAD 1S32D 5B33A 3B6GB 5AVCD 3UT9D 3REHB 2YFWB 2YFVB 3C1BA 2AROB 3AZFA 1P3FD 5DNMB 5B1LA 3AZGB 2L5AA 3X1VB 5CHLB 2CV5B 3AV2D 4UUZB 5B33D 1P3MA 3B0CW 1P3LB 5AV5A 5B1MA 3C1BD 2Y2IA 5KDMA 4ZUXB 3REIA 3AZFD 1P3IC 1P3MD 5DNMA 3X1VA 1P3KD 5AV5D 5B1MD 3W98B 3LZ1A 4JJNA 1KX5B 3MGQA 3C1CC 2XD1A 3VH5W 2HIOB 5JRGD 4CAYB 2F8NG 4Z66C 3LZ1D 4JJND 3B0DB 4XZQA 5DNND 3MGQD 3X1UA 5F99B 3RELC 3KXBB 1M19B 2G5IC 3H0LC 3LJAC 3MGSB 4R8PC 4YM6B 2W8SA 5AV8B 5G49B 1JFIB 4XZQD 3X1UD 3MVDB 5CPIA 3X1SB 4QLCC 1HTAA 5BNVB 2G5HC 4ZBJC 3WKJA 4M6BA 5B2ID 1Q9CA 1EQZC 5CPID 1TAFA 1AOIA 3AZMC 4YM6A 3REJC 1P3PB 4WJ3C 3WTPC 3VH6T 4J8UC 3WKJD 3MVDA 3WA9C 4NE5A 1WWSA 2Y2LA 3A6NB 2HUEB 1AOID 4J8VB 3REKC 1R4VA 1P3IA 4H9OA 1M18C 2ZY3A 5AV6B 5GT3B 2PYOB 5C3IC 3AZJB 5B1LC 1TZYB 1KU5A 1HQ3B 3C1CA 1P3ID 4J8VA 5B0YB 1P3BB 3AZEB 2IO5B 4QLCB 3LZ0B 2NQBC 5B31C 4Z66A 5GT0C 3B6GC 5B32B 3C1CD 3MGPC 1PZRA 5B0ZB 3REHC 3RELA 3LJAA 2AROC 1ZLAB 5DNMC 3X1VC 1TZYA 3AZGC 1EQZB 4R8PA 3EG5B 2CV5C 4J8XC 4Z66D 1P3BA 4KUDB 1P3OC 4NE3A 3EPJA 4HGAB 1P3LC 3RELD 4QLCA 3WA9B 3LZ0A 3LJAD 4ZUXC 3AV1B 3AZHB 4R8PD 2Y2GA 2Y2KA 3W96B 3WTPE 3X1TB 1EQZA 1BH8B 3TU4B 3AZMA 3W98C 3WAAC 4QLCD 3REKB 1KX5C 2RVQC 1Z2CB 4J8UA 1KX3B 4G91B 3WA9A 4Z2MG 2HIOC 5CPKB 1EQZD 4WNNB 4XUJB 3AZMD 3REJD 3B0DC 3WTPD 5F99C 4J8UD 1M19C 3KXBC 1BH8A 2CWEA 3MGSC 3UTBB 2DF4C 3REKA 3AZIC 3WA9D 4YM6C 5B31B 1M18A 5GT0B 5AV8C 3MGPB 3MVDC 3X1SC 3REKD 1H3OB 4J8XB 1M18D 1P3OB 1A7WA 4G92C 2FFFB 5B40C 1P3GB 2NQBA 1P3PC 5B31A 5B1LD 3VH5T 5GT0A 3B6GA 5B2JB 3MGPA 3REHA 2YFWA 1F66B 2YFVA 1P34B 4DRAA 5B24B 2AROA 3AYWB 5BS7C 3AZGA 3A6NC 2HUEC 3WAAB 1H3OA 2CV5A 3NQJB 2NQBD 4J8XA 4UUZA 5B31D 3REID 4H9RB 5GSUC 5GT0D 1P3OA 3B6GD 4J8VC 3MGPD 5GXQB 3REHD 2Y2JA 1P3LA 5BT1C 1P3AC 2AROD 3FDDA 4ZUXA 5DNMD 3X1VD 3AZGD 5E5AC 3KSYA 2CV5D 4J8XD 3W99B 1P3OD 4KGCB 5AV6C 1P3LD 3W98A 5GT3C 3AZIB 2PYOC 3AZJC 2RIQA 3WAAA 1TZYC 4ZUXD 1KX5A 1HQ3C 1N1JB 4H9RA 4NE6A 5FUGB 1ID3B 3NQUB 5B0YC 4E44A 1P3BC 3AZEC 3A1KA 2HIOA 2IO5C 3LZ0C 4CAYA 3W98D 3WAAD 3AZLB 4LD9C 5B32C 1KX5D 2RVQD 3W99A 5F99A 5B0ZC 2JCHA 1M19A 3KXBA 2F8NB 4Z5TB 2ZM5A 3MGSA 3AZNB 4G92B 3AZIA 1ZLAC 2HIOD 5B40B 3KUYB 3A1IA 1ID3A 5AV8A 5G49A 1JFIA 4KUDC 5F99D 4HGAC 4KHAB 3X1SA 5JA4B 3KXBD 3MGRB 5AV9B 5BNVA 1M19D 5CP6B 3V9RB 3MGSD 3AZID 3AV1C 2Y2OA 3VH5A 3AZHC 4YM6D 5GSUB 3W96C 5AV8D 3X1TC 5B40A 1P3AB 3O62B 3MVDD 3KUYA 3TU4C 4H9SC 3X1SD 1P3PA 2Y2NA 5E5AB 4NFTA 2FJ7B 4WU9B 1U35B 1KX3C 4G91C 5BS7A 5CPKC 3A6NA 3AN2B 5B40D 3KWQB 4XUJC 1P3PD 3W97B 5GSUA 5BO0B 2NZDB 1P3AA 3UTBC 3A6ND 5E5AA 3B6FB 3R45B 4WU9A 4LD9B 3VH6W 2BG1A 5GSUD 5BNXB 4J8VD 5AV6A 5BT1D 5GT3A 1P3AD 2PYOA 3AZJA 1HQ3A 5E5AD 2F8NH 5AY8C 5B0YA 2NZDA 3AZEA 4H9PB 5AV6D 3LELB 1P3GC 3R45A 3B0BA 5GT3D 3AZJD 2PYOD 3AL0C 1TZYD 5B32A 4LD9A 1HQ3D 5B2JC 4WU8B 5B0ZA 5CPJB 1F66C 5B0YD 1P34C 1P3BD 5B24C 3AYWC 3AZED 1ZLAA 2Y2HA 2DQNC 4AWLB 3LZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK C;  4KUD A;  4LD9 D;  5B32 D;  4H9P A;  5GXQ C;  5B0Z D;  3LEL A;  1F1E A;  3AV1 A;  1ZLA D;  4DRB A;  3AZH A;  1KX4 B;  3MNN B;  1M1A B;  5CPJ A;  3W96 A;  4H9N B;  4KUD D;  3W99 C;  4X23 C;  4KGC C;  3AFA B;  3X1T A;  4J8W B;  5AVB B;  3TU4 A;  4H9S A;  1S32 B;  5AVC B;  3AV1 D;  4H9Q B;  3AZH D;  1ID3 C;  1KX3 A;  3B0C T;  2BYK B;  3W96 D;  5B31 G;  5CPK A;  3X1T D;  4WNN A;  3TU4 D;  4XUJ A;  3AV2 B;  1KX4 A;  1M1A A;  5B33 B;  3AZL C;  5AY8 B;  3C1B B;  1KX3 D;  4Z5T C;  3AZF B;  3UTB A;  3AZN C;  1S32 A;  5CPK D;  3KUY C;  4XUJ D;  1P3M B;  1P3K B;  5AV5 B;  5B1M B;  3MGR C;  5KDM B;  5AV9 C;  5CP6 C;  3UTB D;  5AY8 A;  3AZK B;  5JRG B;  3O62 C;  1P3G A;  4WV4 B;  3LZ1 B;  4JJN B;  5DNN B;  3MGQ B;  5B2J A;  2FJ7 C;  4WU9 C;  1F66 A;  1P3K A;  1U35 C;  5AY8 D;  1P34 A;  1WWI A;  5B24 A;  4X23 B;  3AYW A;  3AN2 C;  3KWQ C;  1P3G D;  3NQJ A;  3W97 C;  4YS3 C;  3AZK A;  4EO5 B;  4XZQ B;  3X1U B;  5B2J D;  5GXQ A;  5JRG A;  1F66 D;  2NZD C;  1P34 D;  5B24 D;  3AYW D;  2JSS A;  5DNN A;  3B6F C;  5B2I B;  3AZK D;  4X23 A;  4KGC A;  2LY8 A;  5CPI B;  5GXQ D;  4Z2M H;  1N1J A;  5FUG A;  3NQU A;  3WKJ B;  3W99 D;  4X23 D;  4KGC D;  1TAF B;  3LEL C;  1AOI B;  3AZL A;  5B2I A;  4WU8 C;  5CPJ C;  1ID3 D;  2F8N A;  4Z5T A;  3AZN A;  4AWL C;  1BH9 B;  3AZL D;  5JA4 A;  4KHA A;  3MGR A;  2F8N D;  5AV9 A;  4Z5T D;  3V9R A;  5CP6 A;  3AZN D;  1P3I B;  1KX4 C;  3KUY D;  3MNN C;  4H9O B;  1M1A C;  4YS3 B;  3AFA C;  4J8W C;  3O62 A;  5AVB C;  3MGR D;  3UTA C;  4CSR B;  5AV9 D;  1S32 C;  5CP6 D;  1BH9 A;  5AVC C;  3C1C B;  3UT9 C;  2FJ7 A;  1U35 A;  2BYM B;  1P3F C;  5B32 G;  3AN2 A;  3KWQ A;  3O62 D;  3AV2 C;  3W97 A;  4Z66 B;  4YS3 A;  5B33 C;  2FJ7 D;  5BO0 A;  4WU9 D;  3REL B;  3C1B C;  1U35 D;  3LJA B;  3AZF C;  4CSR A;  1BFM A;  4R8P B;  3B6F A;  3AN2 D;  3KWQ D;  3W97 D;  4YS3 D;  1P3M C;  2BYM A;  5BNX A;  1P3K C;  5AV5 C;  5B1M C;  2NZD D;  3REI C;  4ZBJ B;  3B6F D;  5JRG C;  3AZM B;  3REJ B;  3LZ1 C;  4JJN C;  3WTP B;  5DNN C;  3MGQ C;  2F8N K;  4WU8 A;  4J8U B;  3UTA B;  3LEL D;  3UT9 B;  3VH6 A;  4EO5 C;  4XZQ C;  3X1U C;  1B6W A;  4WU8 D;  5CPJ D;  1P3F B;  3REJ A;  3WTP A;  3MNN A;  1M18 B;  1B67 A;  4H9N A;  5B2I C;  1ULY A;  3AFA A;  5CPI C;  4J8W A;  5AVB A;  3UTA A;  4E45 A;  5C3I B;  5B1L B;  5AVC A;  3UT9 A;  4H9Q A;  4WZS B;  1KX4 D;  3MNN D;  3WKJ C;  1M1A D;  2BYK A;  1P3F A;  3AFA D;  4J8W D;  1AOI C;  5AVB D;  2NQB B;  3AV2 A;  3REI B;  3UTA D;  1S32 D;  5B33 A;  3B6G B;  5AVC D;  3UT9 D;  3REH B;  2YFW B;  2YFV B;  3C1B A;  2ARO B;  3AZF A;  1P3F D;  5DNM B;  5B1L A;  3AZG B;  2L5A A;  3X1V B;  5CHL B;  2CV5 B;  3AV2 D;  4UUZ B;  5B33 D;  1P3M A;  3B0C W;  1P3L B;  5AV5 A;  5B1M A;  3C1B D;  5KDM A;  4ZUX B;  3REI A;  3AZF D;  1P3I C;  1P3M D;  5DNM A;  3X1V A;  1P3K D;  5AV5 D;  5B1M D;  3W98 B;  3LZ1 A;  4JJN A;  1KX5 B;  3MGQ A;  3C1C C;  3VH5 W;  2HIO B;  5JRG D;  4CAY B;  2F8N G;  4Z66 C;  3LZ1 D;  4JJN D;  3B0D B;  4XZQ A;  5DNN D;  3MGQ D;  3X1U A;  5F99 B;  3REL C;  3KXB B;  1M19 B;  3LJA C;  3MGS B;  4R8P C;  4YM6 B;  5AV8 B;  5G49 B;  1JFI B;  4XZQ D;  3X1U D;  3MVD B;  5CPI A;  3X1S B;  4QLC C;  1HTA A;  5BNV B;  4ZBJ C;  3WKJ A;  4M6B A;  5B2I D;  1Q9C A;  1EQZ C;  5CPI D;  1TAF A;  1AOI A;  3AZM C;  4YM6 A;  3REJ C;  1P3P B;  3WTP C;  3VH6 T;  4J8U C;  3WKJ D;  3MVD A;  3WA9 C;  4NE5 A;  1WWS A;  3A6N B;  2HUE B;  1AOI D;  4J8V B;  3REK C;  1R4V A;  1P3I A;  4H9O A;  1M18 C;  5AV6 B;  5GT3 B;  2PYO B;  5C3I C;  3AZJ B;  5B1L C;  1TZY B;  1KU5 A;  1HQ3 B;  3C1C A;  1P3I D;  4J8V A;  5B0Y B;  1P3B B;  3AZE B;  2IO5 B;  4QLC B;  3LZ0 B;  2NQB C;  5B31 C;  4Z66 A;  5GT0 C;  3B6G C;  5B32 B;  3C1C D;  3MGP C;  3REH C;  5B0Z B;  3REL A;  3LJA A;  2ARO C;  1ZLA B;  5DNM C;  3X1V C;  1TZY A;  3AZG C;  1EQZ B;  4R8P A;  2CV5 C;  4J8X C;  4Z66 D;  1P3B A;  4KUD B;  1P3O C;  4NE3 A;  4HGA B;  1P3L C;  3REL D;  4QLC A;  3WA9 B;  3LZ0 A;  3LJA D;  4ZUX C;  3AV1 B;  3AZH B;  4R8P D;  3W96 B;  3WTP E;  3X1T B;  1EQZ A;  1BH8 B;  3TU4 B;  3AZM A;  3W98 C;  3WAA C;  4QLC D;  3REK B;  1KX5 C;  2RVQ C;  4J8U A;  1KX3 B;  4G91 B;  3WA9 A;  4Z2M G;  2HIO C;  5CPK B;  1EQZ D;  4WNN B;  4XUJ B;  3AZM D;  3REJ D;  3B0D C;  3WTP D;  5F99 C;  4J8U D;  1M19 C;  3KXB C;  1BH8 A;  2CWE A;  3MGS C;  3UTB B;  3AZI C;  3REK A;  3WA9 D;  4YM6 C;  5B31 B;  1M18 A;  5GT0 B;  5AV8 C;  3MGP B;  3MVD C;  3X1S C;  3REK D;  1H3O B;  4J8X B;  1M18 D;  1P3O B;  1A7W A;  4G92 C;  5B40 C;  1P3G B;  2NQB A;  1P3P C;  5B31 A;  5B1L D;  3VH5 T;  5GT0 A;  3B6G A;  5B2J B;  3MGP A;  3REH A;  2YFW A;  1F66 B;  2YFV A;  1P34 B;  4DRA A;  5B24 B;  2ARO A;  3AYW B;  5BS7 C;  3AZG A;  3A6N C;  2HUE C;  3WAA B;  1H3O A;  2CV5 A;  3NQJ B;  2NQB D;  4J8X A;  4UUZ A;  5B31 D;  3REI D;  4H9R B;  5GSU C;  5GT0 D;  1P3O A;  3B6G D;  4J8V C;  3MGP D;  5GXQ B;  3REH D;  1P3L A;  5BT1 C;  1P3A C;  2ARO D;  4ZUX A;  5DNM D;  3X1V D;  3AZG D;  5E5A C;  3KSY A;  2CV5 D;  4J8X D;  3W99 B;  1P3O D;  4KGC B;  5AV6 C;  1P3L D;  3W98 A;  5GT3 C;  3AZI B;  2PYO C;  3AZJ C;  3WAA A;  1TZY C;  4ZUX D;  1KX5 A;  1HQ3 C;  1N1J B;  4H9R A;  4NE6 A;  5FUG B;  1ID3 B;  3NQU B;  5B0Y C;  4E44 A;  1P3B C;  3AZE C;  2HIO A;  2IO5 C;  3LZ0 C;  4CAY A;  3W98 D;  3WAA D;  3AZL B;  4LD9 C;  5B32 C;  1KX5 D;  2RVQ D;  3W99 A;  5F99 A;  5B0Z C;  1M19 A;  3KXB A;  2F8N B;  4Z5T B;  3MGS A;  3AZN B;  4G92 B;  3AZI A;  1ZLA C;  2HIO D;  5B40 B;  3KUY B;  1ID3 A;  5AV8 A;  5G49 A;  1JFI A;  4KUD C;  5F99 D;  4HGA C;  4KHA B;  3X1S A;  5JA4 B;  3KXB D;  3MGR B;  5AV9 B;  5BNV A;  1M19 D;  3V9R B;  5CP6 B;  3MGS D;  3AZI D;  3AV1 C;  3VH5 A;  3AZH C;  4YM6 D;  5GSU B;  3W96 C;  5AV8 D;  3X1T C;  5B40 A;  1P3A B;  3O62 B;  3MVD D;  3KUY A;  3TU4 C;  4H9S C;  3X1S D;  1P3P A;  5E5A B;  4NFT A;  2FJ7 B;  4WU9 B;  1U35 B;  1KX3 C;  4G91 C;  5BS7 A;  5CPK C;  3A6N A;  3AN2 B;  5B40 D;  3KWQ B;  4XUJ C;  1P3P D;  3W97 B;  5GSU A;  5BO0 B;  2NZD B;  1P3A A;  3UTB C;  3A6N D;  5E5A A;  3B6F B;  3R45 B;  4WU9 A;  4LD9 B;  3VH6 W;  5GSU D;  5BNX B;  4J8V D;  5AV6 A;  5BT1 D;  5GT3 A;  1P3A D;  2PYO A;  3AZJ A;  1HQ3 A;  5E5A D;  2F8N H;  5AY8 C;  5B0Y A;  2NZD A;  3AZE A;  4H9P B;  5AV6 D;  3LEL B;  1P3G C;  3R45 A;  3B0B A;  5GT3 D;  3AZJ D;  2PYO D;  1TZY D;  5B32 A;  4LD9 A;  1HQ3 D;  5B2J C;  4WU8 B;  5B0Z A;  5CPJ B;  1F66 C;  5B0Y D;  1P34 C;  1P3B D;  5B24 C;  3AYW C;  3AZE D;  1ZLA A;  4AWL B;  3LZ0 D; 
#chains in the Genus database with same CATH topology
 3AZK C;  4KUD A;  4LD9 D;  5B32 D;  4H9P A;  2UWX A;  5GXQ C;  5B0Z D;  3LEL A;  1F1E A;  3AV1 A;  1ZLA D;  4DRB A;  3AZH A;  1KX4 B;  3MNN B;  1M1A B;  5CPJ A;  3W96 A;  4H9N B;  4KUD D;  3W99 C;  4X23 C;  4KGC C;  3AFA B;  3X1T A;  4J8W B;  5AVB B;  3TU4 A;  4H9S A;  3F6T A;  1S32 B;  5AVC B;  3AV1 D;  4H9Q B;  3AZH D;  1ID3 C;  1T3U A;  1KX3 A;  3B0C T;  2BYK B;  3W96 D;  5B31 G;  5CPK A;  3X1T D;  3H0M C;  4WNN A;  3TU4 D;  4XUJ A;  3AV2 B;  1KX4 A;  1M1A A;  5B33 B;  3AZL C;  5AY8 B;  3C1B B;  1KX3 D;  4Z5T C;  3AZF B;  3UTB A;  3AZN C;  1S32 A;  5CPK D;  3KUY C;  2Y2P A;  4XUJ D;  1P3M B;  1P3K B;  5AV5 B;  5B1M B;  3MGR C;  5KDM B;  5AV9 C;  5CP6 C;  3UTB D;  5AY8 A;  3AZK B;  2ZY5 A;  5JRG B;  3O62 C;  1P3G A;  3P5J B;  4WV4 B;  3LZ1 B;  4JJN B;  5DNN B;  3MGQ B;  5B2J A;  2VQR A;  2FJ7 C;  4WU9 C;  1F66 A;  1P3K A;  1U35 C;  5AY8 D;  1P34 A;  1WWI A;  5B24 A;  4X23 B;  3AYW A;  3EPK A;  3AN2 C;  3KWQ C;  1P3G D;  3NQJ A;  3W97 C;  4YS3 C;  3AZK A;  4EO5 B;  4XZQ B;  3X1U B;  5B2J D;  5GXQ A;  5JRG A;  1F66 D;  2NZD C;  1P34 D;  5B24 D;  3AYW D;  2JSS A;  5DNN A;  3B6F C;  5B2I B;  3AZK D;  4UPK A;  4X23 A;  4KGC A;  2LY8 A;  5CPI B;  5GXQ D;  4Z2M H;  2J8P A;  2XD5 A;  1N1J A;  2ZY4 A;  5FUG A;  3NQU A;  3WKJ B;  3W99 D;  4X23 D;  4KGC D;  1TAF B;  3LEL C;  1AOI B;  3H0R C;  3AZL A;  5B2I A;  4WU8 C;  5CPJ C;  1ID3 D;  2F8N A;  4Z5T A;  3AZN A;  2F2A C;  4AWL C;  1BH9 B;  3AZL D;  5JA4 A;  4KHA A;  3MGR A;  2F8N D;  5AV9 A;  4Z5T D;  3V9R A;  5CP6 A;  3AZN D;  1P3I B;  1KX4 C;  3KUY D;  3MNN C;  4H9O B;  1M1A C;  4YS3 B;  3AFA C;  4J8W C;  3O62 A;  5AVB C;  3MGR D;  3UTA C;  4CSR B;  5AV9 D;  1S32 C;  5CP6 D;  1BH9 A;  5AVC C;  3C1C B;  3UT9 C;  2FJ7 A;  1U35 A;  2BYM B;  1P3F C;  5B32 G;  3AN2 A;  3KWQ A;  3O62 D;  3AV2 C;  3W97 A;  2JE5 A;  4Z66 B;  5B33 C;  4YS3 A;  2FJ7 D;  2ZY2 A;  5BO0 A;  4WU9 D;  3REL B;  3C1B C;  1U35 D;  3LJA B;  4DQY B;  3IP4 C;  4CSR A;  3AZF C;  1BFM A;  4R8P B;  3B6F A;  3AN2 D;  3EPH A;  3KWQ D;  3W97 D;  4YS3 D;  1P3M C;  2BYM A;  1W2E A;  5BNX A;  1P3K C;  5AV5 C;  5B1M C;  3EPL A;  2NZD D;  3KFU G;  3REI C;  4ZBJ B;  3B6F D;  5JRG C;  2Y2M A;  3AZM B;  3REJ B;  3LZ1 C;  4JJN C;  2Y2Q A;  3WTP B;  5DNN C;  3MGQ C;  2F8N K;  4WU8 A;  4J8U B;  3UTA B;  3LEL D;  3UT9 B;  3VH6 A;  4EO5 C;  4XZQ C;  3X1U C;  1B6W A;  4WU8 D;  5CPJ D;  1P3F B;  3REJ A;  3WTP A;  3MNN A;  1M18 B;  1B67 A;  4H9N A;  5B2I C;  1ULY A;  3AFA A;  5CPI C;  4J8W A;  5AVB A;  3UTA A;  4E45 A;  5C3I B;  5B1L B;  5AVC A;  3UT9 A;  4H9Q A;  4WZS B;  1KX4 D;  3MNN D;  3WKJ C;  1M1A D;  2BYK A;  1P3F A;  3AFA D;  4J8W D;  1AOI C;  5AVB D;  2NQB B;  3AV2 A;  3REI B;  3UTA D;  1S32 D;  5B33 A;  3B6G B;  5AVC D;  3UT9 D;  3REH B;  2YFW B;  2YFV B;  3C1B A;  2ARO B;  3AZF A;  1P3F D;  5DNM B;  5B1L A;  3AZG B;  2L5A A;  3X1V B;  5CHL B;  2CV5 B;  3AV2 D;  4UUZ B;  5B33 D;  1P3M A;  3B0C W;  1P3L B;  5AV5 A;  5B1M A;  3C1B D;  2Y2I A;  5KDM A;  4ZUX B;  3REI A;  3AZF D;  1P3I C;  1P3M D;  5DNM A;  3X1V A;  1P3K D;  5AV5 D;  5B1M D;  3W98 B;  3LZ1 A;  4JJN A;  1KX5 B;  3MGQ A;  3C1C C;  2XD1 A;  3VH5 W;  2HIO B;  5JRG D;  4CAY B;  2F8N G;  4Z66 C;  3LZ1 D;  4JJN D;  3B0D B;  4XZQ A;  5DNN D;  3MGQ D;  3X1U A;  5F99 B;  3REL C;  3KXB B;  1M19 B;  2G5I C;  3H0L C;  3LJA C;  3MGS B;  4R8P C;  4YM6 B;  2W8S A;  5AV8 B;  5G49 B;  1JFI B;  4XZQ D;  3X1U D;  3MVD B;  5CPI A;  3X1S B;  4QLC C;  1HTA A;  5BNV B;  2G5H C;  4ZBJ C;  3WKJ A;  4M6B A;  5B2I D;  1Q9C A;  1EQZ C;  5CPI D;  1TAF A;  1AOI A;  3AZM C;  4YM6 A;  3REJ C;  1P3P B;  4WJ3 C;  3WTP C;  3VH6 T;  4J8U C;  3WKJ D;  3MVD A;  3WA9 C;  4NE5 A;  1WWS A;  2Y2L A;  3A6N B;  2HUE B;  1AOI D;  4J8V B;  3REK C;  1R4V A;  1P3I A;  4H9O A;  1M18 C;  2ZY3 A;  5AV6 B;  5GT3 B;  2PYO B;  5C3I C;  3AZJ B;  5B1L C;  1TZY B;  1KU5 A;  1HQ3 B;  3C1C A;  1P3I D;  4J8V A;  5B0Y B;  1P3B B;  3AZE B;  2IO5 B;  4QLC B;  3LZ0 B;  2NQB C;  5B31 C;  4Z66 A;  5GT0 C;  3B6G C;  5B32 B;  3C1C D;  3MGP C;  1PZR A;  5B0Z B;  3REH C;  3REL A;  3LJA A;  2ARO C;  1ZLA B;  5DNM C;  3X1V C;  1TZY A;  3AZG C;  1EQZ B;  4R8P A;  3EG5 B;  2CV5 C;  4J8X C;  4Z66 D;  1P3B A;  4KUD B;  1P3O C;  4NE3 A;  3EPJ A;  4HGA B;  1P3L C;  3REL D;  4QLC A;  3WA9 B;  3LZ0 A;  3LJA D;  4ZUX C;  3AV1 B;  3AZH B;  4R8P D;  2Y2G A;  2Y2K A;  3W96 B;  3WTP E;  3X1T B;  1EQZ A;  1BH8 B;  3TU4 B;  3AZM A;  3W98 C;  3WAA C;  4QLC D;  3REK B;  1KX5 C;  2RVQ C;  1Z2C B;  4J8U A;  1KX3 B;  4G91 B;  3WA9 A;  4Z2M G;  2HIO C;  5CPK B;  1EQZ D;  4WNN B;  4XUJ B;  3AZM D;  3REJ D;  3B0D C;  3WTP D;  5F99 C;  4J8U D;  1M19 C;  3KXB C;  1BH8 A;  2CWE A;  3MGS C;  3UTB B;  2DF4 C;  3REK A;  3AZI C;  3WA9 D;  4YM6 C;  5B31 B;  1M18 A;  5GT0 B;  5AV8 C;  3MGP B;  3MVD C;  3X1S C;  3REK D;  1H3O B;  4J8X B;  1M18 D;  1P3O B;  1A7W A;  4G92 C;  2FFF B;  5B40 C;  1P3G B;  2NQB A;  1P3P C;  5B31 A;  5B1L D;  3VH5 T;  5GT0 A;  3B6G A;  5B2J B;  3MGP A;  3REH A;  2YFW A;  1F66 B;  2YFV A;  1P34 B;  4DRA A;  5B24 B;  2ARO A;  3AYW B;  5BS7 C;  3AZG A;  3A6N C;  2HUE C;  3WAA B;  1H3O A;  2CV5 A;  3NQJ B;  2NQB D;  4J8X A;  4UUZ A;  5B31 D;  3REI D;  4H9R B;  5GSU C;  5GT0 D;  1P3O A;  3B6G D;  4J8V C;  3MGP D;  5GXQ B;  3REH D;  2Y2J A;  1P3L A;  5BT1 C;  1P3A C;  2ARO D;  3FDD A;  4ZUX A;  5DNM D;  3X1V D;  3AZG D;  5E5A C;  3KSY A;  2CV5 D;  4J8X D;  3W99 B;  1P3O D;  4KGC B;  5AV6 C;  1P3L D;  3W98 A;  5GT3 C;  3AZI B;  2PYO C;  3AZJ C;  2RIQ A;  3WAA A;  1TZY C;  4ZUX D;  1KX5 A;  1HQ3 C;  1N1J B;  4H9R A;  4NE6 A;  5FUG B;  1ID3 B;  3NQU B;  5B0Y C;  4E44 A;  1P3B C;  3AZE C;  3A1K A;  2HIO A;  2IO5 C;  3LZ0 C;  4CAY A;  3W98 D;  3WAA D;  3AZL B;  4LD9 C;  5B32 C;  1KX5 D;  2RVQ D;  3W99 A;  5F99 A;  5B0Z C;  2JCH A;  1M19 A;  3KXB A;  2F8N B;  4Z5T B;  2ZM5 A;  3MGS A;  3AZN B;  4G92 B;  3AZI A;  1ZLA C;  2HIO D;  5B40 B;  3KUY B;  3A1I A;  1ID3 A;  5AV8 A;  5G49 A;  1JFI A;  4KUD C;  5F99 D;  4HGA C;  4KHA B;  3X1S A;  5JA4 B;  3KXB D;  3MGR B;  5AV9 B;  5BNV A;  1M19 D;  5CP6 B;  3V9R B;  3MGS D;  3AZI D;  3AV1 C;  2Y2O A;  3VH5 A;  3AZH C;  4YM6 D;  5GSU B;  3W96 C;  5AV8 D;  3X1T C;  5B40 A;  1P3A B;  3O62 B;  3MVD D;  3KUY A;  3TU4 C;  4H9S C;  3X1S D;  1P3P A;  2Y2N A;  5E5A B;  4NFT A;  2FJ7 B;  4WU9 B;  1U35 B;  1KX3 C;  4G91 C;  5BS7 A;  5CPK C;  3A6N A;  3AN2 B;  5B40 D;  3KWQ B;  4XUJ C;  1P3P D;  3W97 B;  5GSU A;  5BO0 B;  2NZD B;  1P3A A;  3UTB C;  3A6N D;  5E5A A;  3B6F B;  3R45 B;  4WU9 A;  4LD9 B;  3VH6 W;  2BG1 A;  5GSU D;  5BNX B;  4J8V D;  5AV6 A;  5BT1 D;  5GT3 A;  1P3A D;  2PYO A;  3AZJ A;  1HQ3 A;  5E5A D;  2F8N H;  5AY8 C;  5B0Y A;  2NZD A;  3AZE A;  4H9P B;  5AV6 D;  3LEL B;  1P3G C;  3R45 A;  3B0B A;  5GT3 D;  3AZJ D;  2PYO D;  3AL0 C;  1TZY D;  5B32 A;  4LD9 A;  1HQ3 D;  5B2J C;  4WU8 B;  5B0Z A;  5CPJ B;  1F66 C;  5B0Y D;  1P34 C;  1P3B D;  5B24 C;  3AYW C;  3AZE D;  1ZLA A;  2Y2H A;  2DQN C;  4AWL B;  3LZ0 D; 
#chains in the Genus database with same CATH homology
 3AZK C;  4KUD A;  4LD9 D;  5B32 D;  4H9P A;  2UWX A;  5GXQ C;  5B0Z D;  3LEL A;  1F1E A;  3AV1 A;  1ZLA D;  4DRB A;  3AZH A;  1KX4 B;  3MNN B;  1M1A B;  5CPJ A;  3W96 A;  4H9N B;  4KUD D;  3W99 C;  4X23 C;  4KGC C;  3AFA B;  3X1T A;  4J8W B;  5AVB B;  3TU4 A;  4H9S A;  3F6T A;  1S32 B;  5AVC B;  3AV1 D;  4H9Q B;  3AZH D;  1ID3 C;  1T3U A;  1KX3 A;  3B0C T;  2BYK B;  3W96 D;  5B31 G;  5CPK A;  3X1T D;  3H0M C;  4WNN A;  3TU4 D;  4XUJ A;  3AV2 B;  1KX4 A;  1M1A A;  5B33 B;  3AZL C;  5AY8 B;  3C1B B;  1KX3 D;  4Z5T C;  3AZF B;  3UTB A;  3AZN C;  1S32 A;  5CPK D;  3KUY C;  2Y2P A;  4XUJ D;  1P3M B;  1P3K B;  5AV5 B;  5B1M B;  3MGR C;  5KDM B;  5AV9 C;  5CP6 C;  3UTB D;  5AY8 A;  3AZK B;  2ZY5 A;  5JRG B;  3O62 C;  1P3G A;  3P5J B;  4WV4 B;  3LZ1 B;  4JJN B;  5DNN B;  3MGQ B;  5B2J A;  2VQR A;  2FJ7 C;  4WU9 C;  1F66 A;  1P3K A;  1U35 C;  5AY8 D;  1P34 A;  1WWI A;  5B24 A;  4X23 B;  3AYW A;  3EPK A;  3AN2 C;  3KWQ C;  1P3G D;  3NQJ A;  3W97 C;  4YS3 C;  3AZK A;  4EO5 B;  4XZQ B;  3X1U B;  5B2J D;  5GXQ A;  5JRG A;  1F66 D;  2NZD C;  1P34 D;  5B24 D;  3AYW D;  2JSS A;  5DNN A;  3B6F C;  5B2I B;  3AZK D;  4UPK A;  4X23 A;  4KGC A;  2LY8 A;  5CPI B;  5GXQ D;  4Z2M H;  2J8P A;  2XD5 A;  1N1J A;  2ZY4 A;  5FUG A;  3NQU A;  3WKJ B;  3W99 D;  4X23 D;  4KGC D;  1TAF B;  3LEL C;  1AOI B;  3H0R C;  3AZL A;  5B2I A;  4WU8 C;  5CPJ C;  1ID3 D;  2F8N A;  4Z5T A;  3AZN A;  2F2A C;  4AWL C;  1BH9 B;  3AZL D;  5JA4 A;  4KHA A;  3MGR A;  2F8N D;  5AV9 A;  4Z5T D;  3V9R A;  5CP6 A;  3AZN D;  1P3I B;  1KX4 C;  3KUY D;  3MNN C;  4H9O B;  1M1A C;  4YS3 B;  3AFA C;  4J8W C;  3O62 A;  5AVB C;  3MGR D;  3UTA C;  4CSR B;  5AV9 D;  1S32 C;  5CP6 D;  1BH9 A;  5AVC C;  3C1C B;  3UT9 C;  2FJ7 A;  1U35 A;  2BYM B;  1P3F C;  5B32 G;  3AN2 A;  3KWQ A;  3O62 D;  3AV2 C;  3W97 A;  2JE5 A;  4Z66 B;  5B33 C;  4YS3 A;  2FJ7 D;  2ZY2 A;  5BO0 A;  4WU9 D;  3REL B;  3C1B C;  1U35 D;  3LJA B;  4DQY B;  3IP4 C;  4CSR A;  3AZF C;  1BFM A;  4R8P B;  3B6F A;  3AN2 D;  3EPH A;  3KWQ D;  3W97 D;  4YS3 D;  1P3M C;  2BYM A;  1W2E A;  5BNX A;  1P3K C;  5AV5 C;  5B1M C;  3EPL A;  2NZD D;  3KFU G;  3REI C;  4ZBJ B;  3B6F D;  5JRG C;  2Y2M A;  3AZM B;  3REJ B;  3LZ1 C;  4JJN C;  2Y2Q A;  3WTP B;  5DNN C;  3MGQ C;  2F8N K;  4WU8 A;  4J8U B;  3UTA B;  3LEL D;  3UT9 B;  3VH6 A;  4EO5 C;  4XZQ C;  3X1U C;  1B6W A;  4WU8 D;  5CPJ D;  1P3F B;  3REJ A;  3WTP A;  3MNN A;  1M18 B;  1B67 A;  4H9N A;  5B2I C;  1ULY A;  3AFA A;  5CPI C;  4J8W A;  5AVB A;  3UTA A;  4E45 A;  5C3I B;  5B1L B;  5AVC A;  3UT9 A;  4H9Q A;  4WZS B;  1KX4 D;  3MNN D;  3WKJ C;  1M1A D;  2BYK A;  1P3F A;  3AFA D;  4J8W D;  1AOI C;  5AVB D;  2NQB B;  3AV2 A;  3REI B;  3UTA D;  1S32 D;  5B33 A;  3B6G B;  5AVC D;  3UT9 D;  3REH B;  2YFW B;  2YFV B;  3C1B A;  2ARO B;  3AZF A;  1P3F D;  5DNM B;  5B1L A;  3AZG B;  2L5A A;  3X1V B;  5CHL B;  2CV5 B;  3AV2 D;  4UUZ B;  5B33 D;  1P3M A;  3B0C W;  1P3L B;  5AV5 A;  5B1M A;  3C1B D;  2Y2I A;  5KDM A;  4ZUX B;  3REI A;  3AZF D;  1P3I C;  1P3M D;  5DNM A;  3X1V A;  1P3K D;  5AV5 D;  5B1M D;  3W98 B;  3LZ1 A;  4JJN A;  1KX5 B;  3MGQ A;  3C1C C;  2XD1 A;  3VH5 W;  2HIO B;  5JRG D;  4CAY B;  2F8N G;  4Z66 C;  3LZ1 D;  4JJN D;  3B0D B;  4XZQ A;  5DNN D;  3MGQ D;  3X1U A;  5F99 B;  3REL C;  3KXB B;  1M19 B;  2G5I C;  3H0L C;  3LJA C;  3MGS B;  4R8P C;  4YM6 B;  2W8S A;  5AV8 B;  5G49 B;  1JFI B;  4XZQ D;  3X1U D;  3MVD B;  5CPI A;  3X1S B;  4QLC C;  1HTA A;  5BNV B;  2G5H C;  4ZBJ C;  3WKJ A;  4M6B A;  5B2I D;  1Q9C A;  1EQZ C;  5CPI D;  1TAF A;  1AOI A;  3AZM C;  4YM6 A;  3REJ C;  1P3P B;  4WJ3 C;  3WTP C;  3VH6 T;  4J8U C;  3WKJ D;  3MVD A;  3WA9 C;  4NE5 A;  1WWS A;  2Y2L A;  3A6N B;  2HUE B;  1AOI D;  4J8V B;  3REK C;  1R4V A;  1P3I A;  4H9O A;  1M18 C;  2ZY3 A;  5AV6 B;  5GT3 B;  2PYO B;  5C3I C;  3AZJ B;  5B1L C;  1TZY B;  1KU5 A;  1HQ3 B;  3C1C A;  1P3I D;  4J8V A;  5B0Y B;  1P3B B;  3AZE B;  2IO5 B;  4QLC B;  3LZ0 B;  2NQB C;  5B31 C;  4Z66 A;  5GT0 C;  3B6G C;  5B32 B;  3C1C D;  3MGP C;  1PZR A;  5B0Z B;  3REH C;  3REL A;  3LJA A;  2ARO C;  1ZLA B;  5DNM C;  3X1V C;  1TZY A;  3AZG C;  1EQZ B;  4R8P A;  3EG5 B;  2CV5 C;  4J8X C;  4Z66 D;  1P3B A;  4KUD B;  1P3O C;  4NE3 A;  3EPJ A;  4HGA B;  1P3L C;  3REL D;  4QLC A;  3WA9 B;  3LZ0 A;  3LJA D;  4ZUX C;  3AV1 B;  3AZH B;  4R8P D;  2Y2G A;  2Y2K A;  3W96 B;  3WTP E;  3X1T B;  1EQZ A;  1BH8 B;  3TU4 B;  3AZM A;  3W98 C;  3WAA C;  4QLC D;  3REK B;  1KX5 C;  2RVQ C;  1Z2C B;  4J8U A;  1KX3 B;  4G91 B;  3WA9 A;  4Z2M G;  2HIO C;  5CPK B;  1EQZ D;  4WNN B;  4XUJ B;  3AZM D;  3REJ D;  3B0D C;  3WTP D;  5F99 C;  4J8U D;  1M19 C;  3KXB C;  1BH8 A;  2CWE A;  3MGS C;  3UTB B;  2DF4 C;  3REK A;  3AZI C;  3WA9 D;  4YM6 C;  5B31 B;  1M18 A;  5GT0 B;  5AV8 C;  3MGP B;  3MVD C;  3X1S C;  3REK D;  1H3O B;  4J8X B;  1M18 D;  1P3O B;  1A7W A;  4G92 C;  2FFF B;  5B40 C;  1P3G B;  2NQB A;  1P3P C;  5B31 A;  5B1L D;  3VH5 T;  5GT0 A;  3B6G A;  5B2J B;  3MGP A;  3REH A;  2YFW A;  1F66 B;  2YFV A;  1P34 B;  4DRA A;  5B24 B;  2ARO A;  3AYW B;  5BS7 C;  3AZG A;  3A6N C;  2HUE C;  3WAA B;  1H3O A;  2CV5 A;  3NQJ B;  2NQB D;  4J8X A;  4UUZ A;  5B31 D;  3REI D;  4H9R B;  5GSU C;  5GT0 D;  1P3O A;  3B6G D;  4J8V C;  3MGP D;  5GXQ B;  3REH D;  2Y2J A;  1P3L A;  5BT1 C;  1P3A C;  2ARO D;  3FDD A;  4ZUX A;  5DNM D;  3X1V D;  3AZG D;  5E5A C;  3KSY A;  2CV5 D;  4J8X D;  3W99 B;  1P3O D;  4KGC B;  5AV6 C;  1P3L D;  3W98 A;  5GT3 C;  3AZI B;  2PYO C;  3AZJ C;  2RIQ A;  3WAA A;  1TZY C;  4ZUX D;  1KX5 A;  1HQ3 C;  1N1J B;  4H9R A;  4NE6 A;  5FUG B;  1ID3 B;  3NQU B;  5B0Y C;  4E44 A;  1P3B C;  3AZE C;  3A1K A;  2HIO A;  2IO5 C;  3LZ0 C;  4CAY A;  3W98 D;  3WAA D;  3AZL B;  4LD9 C;  5B32 C;  1KX5 D;  2RVQ D;  3W99 A;  5F99 A;  5B0Z C;  2JCH A;  1M19 A;  3KXB A;  2F8N B;  4Z5T B;  2ZM5 A;  3MGS A;  3AZN B;  4G92 B;  3AZI A;  1ZLA C;  2HIO D;  5B40 B;  3KUY B;  3A1I A;  1ID3 A;  5AV8 A;  5G49 A;  1JFI A;  4KUD C;  5F99 D;  4HGA C;  4KHA B;  3X1S A;  5JA4 B;  3KXB D;  3MGR B;  5AV9 B;  5BNV A;  1M19 D;  5CP6 B;  3V9R B;  3MGS D;  3AZI D;  3AV1 C;  2Y2O A;  3VH5 A;  3AZH C;  4YM6 D;  5GSU B;  3W96 C;  5AV8 D;  3X1T C;  5B40 A;  1P3A B;  3O62 B;  3MVD D;  3KUY A;  3TU4 C;  4H9S C;  3X1S D;  1P3P A;  2Y2N A;  5E5A B;  4NFT A;  2FJ7 B;  4WU9 B;  1U35 B;  1KX3 C;  4G91 C;  5BS7 A;  5CPK C;  3A6N A;  3AN2 B;  5B40 D;  3KWQ B;  4XUJ C;  1P3P D;  3W97 B;  5GSU A;  5BO0 B;  2NZD B;  1P3A A;  3UTB C;  3A6N D;  5E5A A;  3B6F B;  3R45 B;  4WU9 A;  4LD9 B;  3VH6 W;  2BG1 A;  5GSU D;  5BNX B;  4J8V D;  5AV6 A;  5BT1 D;  5GT3 A;  1P3A D;  2PYO A;  3AZJ A;  1HQ3 A;  5E5A D;  2F8N H;  5AY8 C;  5B0Y A;  2NZD A;  3AZE A;  4H9P B;  5AV6 D;  3LEL B;  1P3G C;  3R45 A;  3B0B A;  5GT3 D;  3AZJ D;  2PYO D;  3AL0 C;  1TZY D;  5B32 A;  4LD9 A;  1HQ3 D;  5B2J C;  4WU8 B;  5B0Z A;  5CPJ B;  1F66 C;  5B0Y D;  1P34 C;  1P3B D;  5B24 C;  3AYW C;  3AZE D;  1ZLA A;  2Y2H A;  2DQN C;  4AWL B;  3LZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...