4KUDD

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudD00
1HQ3D 1ID3D 5AV5D 4AWLC 3LZ0C 3LZ0B 2L5AA 1TZYB 3AZNB 2PYOC 1BFMA 3UT9C 1P3PD 1BH8A 1ULYA 4HGAC 3WAAD 4Z66B 1P3FA 2AROB 2LY8A 1P3MA 3X1TB 1F66B 5JRGC 3X1VD 5AV6C 4J8UA 5F99D 3RELA 3VH6T 2AROA 2FJ7A 1P3MC 4X23A 1EQZD 4YM6C 4H9RB 4J8UB 1M19D 5AVBD 3O62A 4Z2MG 1P3IA 3VH6W 3WKJC 5GT0A 5B2JA 1TAFA 1HQ3B 4YS3B 3KWQC 3B0DB 3TU4D 3AYWD 3KXBC 4J8WB 1P3GC 4JJNC 5GT0C 5B2JC 4KGCD 1KX4B 3NQJA 5CPJC 4KUDC 5CHLB 4H9SA 5B0ZC 2F8NB 2RVQD 5CP6C 3UTBB 3X1TA 1F66A 2NQBD 1U35B 5GT3B 3O62C 5AV8B 3MGSA 1KX5D 1ZLAA 3MGRB 3AV1A 4YM6A 2BYMB 5AVCB 5E5AB 3AZGD 5BS7C 4J8VA 5B32G 1B6WA 3AN2C 3AZMC 3AZGB 1ZLAC 2BYMA 3WA9D 4Z66C 3R45A 5DNMD 4HGAB 5CPKC 5GT3D 4Z5TC 5GXQC 3C1CD 3AZJA 1P3AC 1P3KB 5B2ID 3VH5T 2BYKB 3WA9A 4KGCB 5B31A 4JJNB 3W97A 5AV9D 3MVDC 4X23B 4G92B 3MGPC 5B31B 3X1UB 4JJNA 3AZLC 4YS3D 4H9PB 3UTAD 5AVBB 3W98C 4NE3A 5E5AD 4Z66A 3MNND 2FJ7C 3REIB 3LELD 4WNNB 1M18B 3AN2A 5AV6A 3W96C 3AZID 4H9OB 3AV2C 3KUYA 2NQBB 4G91C 3C1BA 5JRGB 3AYWA 5B32B 4KHAB 1F1EA 1P3AA 1KX4D 5B32D 5CPIA 5FUGA 5B33C 1P34A 4J8WC 2NZDA 3KXBB 3AZKD 4XZQC 4R8PC 5AY8C 3REID 1P34D 3REHC 2F8NG 1KX4A 4NE5A 4J8UD 1M19B 3KUYC 3KUYB 3UTAB 5GSUD 4UUZA 4WU8B 4WZSB 3LJAC 5CPKB 1EQZB 3REJC 3AZIA 3AZMB 1AOIA 3B0CT 2PYOA 5AV9B 3AZKA 4XUJD 4ZUXC 5BNXB 5KDMA 2HIOA 5BT1C 5B0YB 3LZ1B 1P3BD 1P3OB 3AZED 5GXQB 2HIOD 3C1BD 3REHA 1P3BB 3WA9B 1TZYC 3AZNC 5B0ZB 2PYOB 2YFVB 5B0YD 5AV5B 4J8XC 5GXQA 3MNNA 4ZUXB 2NZDC 3V9RA 1S32C 4H9QA 3UTAA 3AZJD 1KX3A 3RELC 3MGRD 3REJB 3MGQC 3REKC 5B1MA 3WKJB 3B6GD 5AV8D 5JRGA 4WU8D 2HUEC 5B1LC 3X1SC 4WU9C 3AFAA 2HUEB 5B1LB 1KX3B 3B6GB 3AZHA 2F8ND 5CPJB 4WV4B 5AV8A 3X1UC 5B32A 1WWIA 3MGSD 5B33B 4H9NB 1P3LA 2NQBA 3W99C 3AZFC 1P3OA 3AZHB 3A6NC 4EO5C 1H3OB 2HIOB 5B0YA 5DNNC 4E44A 1P3OD 1M18D 3LZ1D 5B1MC 1P3LD 3AZEA 1M1AC 3O62B 3WTPD 1U35C 5AV6B 3X1SB 5CPKA 3LZ1A 5KDMB 2CV5C 3X1TD 1F66D 3W97B 5AVCC 1AOID 5AV9A 3W97D 5B31D 1A7WA 4X23D 5C3IB 4J8VC 3MVDB 3B6FD 5BS7A 5GSUA 4LD9C 1HQ3C 1ID3C 4CAYA 3MGRA 3LZ0D 3VH6A 3WTPE 3W99A 5GT3A 3UT9D 5G49B 4CSRA 1P3AB 1P3ID 3AZKB 1P3KC 4NE6A 2YFWB 3AZHD 2F8NA 3AFAD 1EQZA 5CPID 3AN2B 5JRGD 4WU8A 5B31G 3X1VC 5B24C 3B6GA 3MGSB 5JA4A 3AV1D 5F99C 3KWQA 1B67A 1M1AB 1P3MD 3LELB 1EQZC 3WKJA 1KX5B 3UTBA 1P3FD 4H9PA 4DRAA 4XUJA 3NQJB 1KX3C 4QLCD 4QLCA 3AV1B 4WU9B 4H9QB 4J8WA 3UTBD 3B0BA 5CPIB 3WKJD 4R8PB 1U35A 2AROC 4J8XA 3KWQD 3RELB 5AV5A 1HQ3A 3NQUA 3TU4C 1P3BA 4JJND 1P3IB 5B40D 5B2JD 5GT0D 4KGCC 4H9RA 4J8XB 3B0CW 4WNNA 5AV5C 5B0ZD 2PYOD 1BH8B 2NQBC 1P3PC 5B2IA 5C3IC 5DNMB 3AZEB 3LZ0A 3WAAC 2F8NH 5JA4B 5DNNA 5AV6D 3AN2D 3AZMD 3WAAA 3AV2B 3WTPB 1P3LB 3AZLB 3WA9C 4Z66D 5DNMC 5CPKD 4YM6D 4ZBJB 4XZQA 4Z5TD 5AVCA 1P3AD 3WTPA 1M19C 5AVBC 5B2IC 1ID3A 3W98B 3W99B 1P34B 4XZQB 3B6FB 1P3GB 1HTAA 3MVDD 1TZYA 3AZNA 3AYWB 3AYWC 3KXBD 1JFIB 3LELA 1P3GD 4NFTA 5E5AA 3AV2A 3TU4A 2IO5C 5CPJD 1ZLAB 4KUDD 5CP6D 2RVQC 1N1JB 3UTAC 3W98D 4Z5TB 1TAFB 4YS3A 5E5AC 5AVBA 3O62D 5CP6A 2YFVA 3LELC 4KUDA 1KX5C 3AV2D 3AZGC 5DNNB 3LJAA 3X1VB 5B24B 1BH9B 1ZLAD 4WU9A 5B32C 5B33D 5DNMA 5GT3C 3AZKC 4Z5TA 5GXQD 3C1CC 4XZQD 2CWEA 1P3PA 3REIC 1Q9CA 2FJ7B 3REHD 3X1SA 5BNVB 4J8UC 5B40B 3AZGA 4XUJB 5AV9C 5GSUC 1KX5A 4J8VB 3MGPD 1JFIA 3VH5W 3AZLD 2YFWA 3KWQB 3REJD 4YS3C 4R8PA 4CAYB 4ZUXD 4QLCB 3MNNC 2FJ7D 4H9SC 5B0ZA 3AZEC 1M1AA 3W96D 3AZIC 3C1BB 5B40A 3C1BC 3V9RB 4Z2MH 4EO5B 3W96A 3REIA 3AZFB 4AWLB 3AFAB 4J8XD 1KX4C 5GT0B 5B2JB 4J8WD 2NZDD 1S32D 4M6BA 3AZIB 5F99A 3RELD 3VH5A 3MGQD 3REKD 4R8PD 5AY8D 1P34C 5AV8C 3LJAB 3X1VA 4WU8C 4LD9B 5GSUB 4WU9D 3KUYD 5AY8A 3MGQA 3REKA 3LJAD 4KUDB 3NQUB 5AY8B 1AOIB 1P3MB 3X1UD 3MGSC 2NZDB 4XUJC 5BNXA 3UT9A 1R4VA 1WWSA 5B33A 3W99D 3AZFD 5BT1D 3A6ND 1P3BC 4DRBA 3C1CB 3B6FA 3UT9B 2HIOC 4H9OA 1H3OA 4YM6B 2F8NK 3W96B 3A6NB 5BNVA 2CV5A 3KXBA 1M18C 1TZYD 3AZND 1P3LC 5B0YC 4ZUXA 1ID3B 3MNNB 3C1CA 5BO0B 4E45A 3REJA 3X1TC 5BO0A 3AZLA 1F66C 5G49A 4CSRB 3AZJC 5AVCD 1AOIC 3MGRC 5CPJA 3W97C 3X1UA 4LD9A 1M18A 2CV5B 5B24A 3B6GC 5FUGB 4J8VD 5B1LD 5B1LA 3X1SD 3B6FC 3MVDA 4LD9D 3REHB 5B1MB 3MGQB 3REKB 5B2IB 3AZJB 1P3KD 1P3KA 1P3IC 1S32B 3R45B 3AZHC 3B0DC 4UUZB 1S32A 1KU5A 3AFAC 4KGCA 5CPIC 5B24D 2BYKA 3AZMA 4G91B 3AV1C 5DNND 4ZBJC 2JSSA 3AZFA 1P3OC 1BH9A 1P3FB 3LZ1C 5B1MD 1P3FC 1M1AD 5F99B 3W98A 3WTPC 1M19A 3KSYA 4QLCC 4H9NA 1U35D 1KX3D 5CP6B 3UTBC 2CV5D 1P3GA 2AROD 2IO5B 3WAAB 3MGPB 1N1JA 5B31C 3A6NA 4X23C 4G92C 1P3PB 3TU4B 3MGPA 5B40C 4KHAA
chains in the Genus database with same CATH superfamily
1HQ3D 1ID3D 5AV5D 4AWLC 3LZ0C 3LZ0B 2L5AA 1TZYB 3AZNB 2PYOC 1BFMA 3UT9C 1P3PD 1BH8A 1ULYA 4HGAC 3WAAD 4Z66B 1P3FA 2AROB 2LY8A 1P3MA 3X1TB 2ZY5A 1F66B 5JRGC 3X1VD 5AV6C 4J8UA 5F99D 3RELA 3VH6T 2AROA 2FJ7A 1P3MC 4X23A 1EQZD 4YM6C 4H9RB 4J8UB 1M19D 5AVBD 3O62A 4Z2MG 1P3IA 3VH6W 3WKJC 5GT0A 5B2JA 1TAFA 1HQ3B 4YS3B 3KWQC 2RIQA 3B0DB 3TU4D 2ZY3A 3KXBC 3AYWD 4J8WB 1P3GC 4JJNC 5GT0C 5B2JC 4KGCD 1KX4B 3NQJA 5CPJC 4KUDC 5CHLB 4H9SA 5B0ZC 2F8NB 2RVQD 5CP6C 3UTBB 3X1TA 1F66A 2NQBD 1U35B 5GT3B 3O62C 5AV8B 3MGSA 1KX5D 1ZLAA 3MGRB 3AV1A 4YM6A 2BYMB 5AVCB 5E5AB 3AZGD 5BS7C 4J8VA 5B32G 1B6WA 3AN2C 3AZMC 3AZGB 1ZLAC 2BYMA 3WA9D 4Z66C 3R45A 5DNMD 4HGAB 5CPKC 5GT3D 4Z5TC 5GXQC 3C1CD 3AZJA 1P3AC 2G5IC 1P3KB 5B2ID 3VH5T 2BYKB 2Y2QA 3WA9A 4KGCB 5B31A 4JJNB 3W97A 5AV9D 3MVDC 4X23B 4G92B 3MGPC 5B31B 3X1UB 4JJNA 3AZLC 4YS3D 4H9PB 3UTAD 5AVBB 3W98C 4NE3A 4DQYB 5E5AD 4Z66A 3MNND 2FJ7C 3REIB 3LELD 4WNNB 1M18B 3AN2A 5AV6A 3W96C 3AZID 4H9OB 3AV2C 3KUYA 2NQBB 4G91C 3C1BA 5JRGB 3AYWA 5B32B 4KHAB 1F1EA 1P3AA 1KX4D 5B32D 5CPIA 5FUGA 5B33C 1P34A 4J8WC 2NZDA 3KXBB 3AL0C 3AZKD 2Y2KA 4XZQC 4R8PC 5AY8C 3REID 1P34D 3REHC 2F8NG 1KX4A 4NE5A 4J8UD 2Y2NA 3KUYC 3KUYB 1M19B 3UTAB 5GSUD 4UUZA 4WU8B 4WZSB 3LJAC 5CPKB 1EQZB 3REJC 2Y2OA 3AZIA 3AZMB 1AOIA 3B0CT 2PYOA 3H0MC 5AV9B 3AZKA 4XUJD 4ZUXC 5BNXB 5KDMA 1T3UA 2HIOA 3EG5B 5BT1C 5B0YB 3LZ1B 1P3BD 1P3OB 3AZED 5GXQB 2HIOD 3C1BD 4UPKA 3REHA 1P3BB 3WA9B 1TZYC 3AZNC 5B0ZB 2PYOB 2YFVB 5B0YD 5AV5B 4J8XC 5GXQA 3MNNA 4ZUXB 2NZDC 3V9RA 1S32C 4H9QA 3UTAA 3AZJD 1KX3A 3RELC 3MGRD 3REJB 3MGQC 3REKC 5B1MA 3WKJB 3B6GD 5AV8D 5JRGA 4WU8D 2HUEC 5B1LC 3X1SC 4WU9C 3AFAA 2HUEB 2G5HC 5B1LB 1KX3B 3B6GB 3AZHA 2F8ND 5CPJB 4WV4B 5AV8A 3X1UC 5B32A 1WWIA 3MGSD 1PZRA 5B33B 4WJ3C 4H9NB 1P3LA 2NQBA 3EPKA 3W99C 3AZFC 1P3OA 3AZHB 3A6NC 4EO5C 1H3OB 2HIOB 5B0YA 5DNNC 4E44A 1P3OD 1M18D 3LZ1D 5B1MC 2JE5A 3AZEA 1P3LD 1M1AC 3O62B 3WTPD 1U35C 5AV6B 3X1SB 5CPKA 5KDMB 3LZ1A 2CV5C 3X1TD 1F66D 3W97B 5AVCC 2Y2MA 1AOID 5AV9A 3EPJA 3W97D 5B31D 1A7WA 4X23D 5C3IB 4J8VC 3MVDB 3B6FD 5BS7A 5GSUA 4LD9C 1HQ3C 1ID3C 4CAYA 3MGRA 3LZ0D 3VH6A 3WTPE 3W99A 2DQNC 5GT3A 3UT9D 5G49B 4CSRA 1P3AB 1P3ID 3AZKB 1P3KC 4NE6A 2YFWB 2ZM5A 3AZHD 2F8NA 3KFUG 3AFAD 1EQZA 5CPID 3AN2B 5JRGD 4WU8A 5B31G 3X1VC 5B24C 3B6GA 3MGSB 5JA4A 3AV1D 5F99C 3KWQA 1B67A 1M1AB 1P3MD 3LELB 1EQZC 3WKJA 1KX5B 3UTBA 2DF4C 1P3FD 4H9PA 4DRAA 4XUJA 2ZY4A 3NQJB 1KX3C 4QLCD 4QLCA 3AV1B 4WU9B 4H9QB 2Y2JA 4J8WA 3IP4C 3UTBD 3B0BA 5CPIB 3WKJD 4R8PB 1U35A 2AROC 4J8XA 3KWQD 3RELB 5AV5A 1HQ3A 3NQUA 3TU4C 1P3BA 4JJND 1P3IB 5B40D 5B2JD 5GT0D 4KGCC 4H9RA 4J8XB 3B0CW 3EPHA 4WNNA 5AV5C 5B0ZD 2PYOD 1BH8B 2NQBC 1P3PC 5B2IA 5C3IC 5DNMB 3AZEB 3LZ0A 3WAAC 2F8NH 5JA4B 5DNNA 5AV6D 3AN2D 3AZMD 3WAAA 3AV2B 3WTPB 1P3LB 3AZLB 3WA9C 4Z66D 5DNMC 5CPKD 4YM6D 4ZBJB 4XZQA 4Z5TD 5AVCA 1P3AD 3WTPA 1M19C 5AVBC 5B2IC 2J8PA 1ID3A 3W98B 2XD1A 3W99B 1P34B 4XZQB 3B6FB 1P3GB 1HTAA 3MVDD 1TZYA 3AZNA 3AYWB 3AYWC 3KXBD 1JFIB 3LELA 1P3GD 4NFTA 5E5AA 3AV2A 3TU4A 2IO5C 2XD5A 5CPJD 1ZLAB 4KUDD 5CP6D 2RVQC 1N1JB 3UTAC 3W98D 4Z5TB 1TAFB 4YS3A 5E5AC 5AVBA 3O62D 5CP6A 2YFVA 3LELC 4KUDA 1KX5C 3AV2D 3AZGC 5DNNB 3LJAA 3X1VB 5B24B 1BH9B 1ZLAD 4WU9A 5B32C 5B33D 5DNMA 5GT3C 3AZKC 1W2EA 2Y2LA 4Z5TA 5GXQD 3C1CC 4XZQD 2CWEA 1P3PA 3REIC 1Q9CA 2FJ7B 3REHD 3X1SA 5BNVB 4J8UC 5B40B 3AZGA 4XUJB 2Y2HA 2F2AC 5AV9C 5GSUC 1KX5A 4J8VB 3A1KA 3MGPD 1JFIA 3VH5W 3AZLD 2YFWA 3KWQB 3REJD 4YS3C 4R8PA 2FFFB 4CAYB 4ZUXD 4QLCB 3MNNC 2FJ7D 4H9SC 5B0ZA 3AZEC 1M1AA 3W96D 3AZIC 3C1BB 2Y2GA 5B40A 3C1BC 3V9RB 4Z2MH 4EO5B 3W96A 3REIA 3AZFB 4AWLB 3AFAB 4J8XD 1KX4C 5GT0B 5B2JB 4J8WD 2NZDD 1S32D 3FDDA 4M6BA 3AZIB 5F99A 3RELD 3VH5A 3MGQD 3F6TA 3A1IA 4R8PD 5AY8D 3REKD 1P34C 5AV8C 3LJAB 3X1VA 4WU8C 4LD9B 5GSUB 2Y2IA 4WU9D 3KUYD 5AY8A 3MGQA 3REKA 3LJAD 4KUDB 3NQUB 5AY8B 1AOIB 1P3MB 3X1UD 2BG1A 3MGSC 2NZDB 3H0LC 4XUJC 5BNXA 3UT9A 1R4VA 1WWSA 5B33A 3W99D 3AZFD 3H0RC 5BT1D 2JCHA 3A6ND 1P3BC 2UWXA 4DRBA 1Z2CB 3C1CB 3B6FA 3UT9B 2HIOC 4H9OA 1H3OA 4YM6B 2F8NK 3W96B 3A6NB 5BNVA 2CV5A 3KXBA 1M18C 1TZYD 3AZND 1P3LC 5B0YC 4ZUXA 1ID3B 3MNNB 3C1CA 2ZY2A 2VQRA 5BO0B 4E45A 3REJA 3X1TC 5BO0A 3AZLA 1F66C 5G49A 4CSRB 3AZJC 5AVCD 1AOIC 3MGRC 5CPJA 3W97C 3X1UA 4LD9A 1M18A 2CV5B 5B24A 3B6GC 5FUGB 4J8VD 5B1LD 5B1LA 3X1SD 3B6FC 3MVDA 4LD9D 3REHB 5B1MB 3MGQB 3REKB 5B2IB 3AZJB 1P3KD 1P3KA 1P3IC 1S32B 3R45B 3AZHC 3B0DC 4UUZB 1S32A 1KU5A 3AFAC 4KGCA 5CPIC 5B24D 2BYKA 3AZMA 4G91B 3AV1C 5DNND 3EPLA 4ZBJC 2JSSA 3AZFA 1P3OC 1BH9A 1P3FB 3LZ1C 5B1MD 1P3FC 1M1AD 5F99B 3W98A 3WTPC 1M19A 3KSYA 4QLCC 4H9NA 1U35D 1KX3D 5CP6B 3UTBC 2CV5D 1P3GA 2AROD 2IO5B 2W8SA 3P5JB 3WAAB 3MGPB 1N1JA 5B31C 3A6NA 4X23C 4G92C 1P3PB 3TU4B 3MGPA 5B40C 2Y2PA 4KHAA
chains in the Genus database with same CATH topology
1HQ3D 1ID3D 5AV5D 4AWLC 3LZ0C 3LZ0B 2L5AA 1TZYB 3AZNB 2PYOC 1BFMA 3UT9C 1P3PD 1BH8A 1ULYA 4HGAC 3WAAD 4Z66B 1P3FA 2AROB 2LY8A 1P3MA 3X1TB 2ZY5A 1F66B 5JRGC 3X1VD 5AV6C 4J8UA 5F99D 3RELA 3VH6T 2AROA 2FJ7A 1P3MC 4X23A 1EQZD 4YM6C 4H9RB 4J8UB 1M19D 5AVBD 3O62A 4Z2MG 1P3IA 3VH6W 3WKJC 5GT0A 5B2JA 1TAFA 1HQ3B 4YS3B 3KWQC 2RIQA 3B0DB 3TU4D 2ZY3A 3KXBC 3AYWD 4J8WB 1P3GC 4JJNC 5GT0C 5B2JC 4KGCD 1KX4B 3NQJA 5CPJC 4KUDC 5CHLB 4H9SA 5B0ZC 2F8NB 2RVQD 5CP6C 3UTBB 3X1TA 1F66A 2NQBD 1U35B 5GT3B 3O62C 5AV8B 3MGSA 1KX5D 1ZLAA 3MGRB 3AV1A 4YM6A 2BYMB 5AVCB 5E5AB 3AZGD 5BS7C 4J8VA 5B32G 1B6WA 3AN2C 3AZMC 3AZGB 1ZLAC 2BYMA 3WA9D 4Z66C 3R45A 5DNMD 4HGAB 5CPKC 5GT3D 4Z5TC 5GXQC 3C1CD 3AZJA 1P3AC 2G5IC 1P3KB 5B2ID 3VH5T 2BYKB 2Y2QA 3WA9A 4KGCB 5B31A 4JJNB 3W97A 5AV9D 3MVDC 4X23B 4G92B 3MGPC 5B31B 3X1UB 4JJNA 3AZLC 4YS3D 4H9PB 3UTAD 5AVBB 3W98C 4NE3A 4DQYB 5E5AD 4Z66A 3MNND 2FJ7C 3REIB 3LELD 4WNNB 1M18B 3AN2A 5AV6A 3W96C 3AZID 4H9OB 3AV2C 3KUYA 2NQBB 4G91C 3C1BA 5JRGB 3AYWA 5B32B 4KHAB 1F1EA 1P3AA 1KX4D 5B32D 5CPIA 5FUGA 5B33C 1P34A 4J8WC 2NZDA 3KXBB 3AL0C 3AZKD 2Y2KA 4XZQC 4R8PC 5AY8C 3REID 1P34D 3REHC 2F8NG 1KX4A 4NE5A 4J8UD 2Y2NA 3KUYC 3KUYB 1M19B 3UTAB 5GSUD 4UUZA 4WU8B 4WZSB 3LJAC 5CPKB 1EQZB 3REJC 2Y2OA 3AZIA 3AZMB 1AOIA 3B0CT 2PYOA 3H0MC 5AV9B 3AZKA 4XUJD 4ZUXC 5BNXB 5KDMA 1T3UA 2HIOA 3EG5B 5BT1C 5B0YB 3LZ1B 1P3BD 1P3OB 3AZED 5GXQB 2HIOD 3C1BD 4UPKA 3REHA 1P3BB 3WA9B 1TZYC 3AZNC 5B0ZB 2PYOB 2YFVB 5B0YD 5AV5B 4J8XC 5GXQA 3MNNA 4ZUXB 2NZDC 3V9RA 1S32C 4H9QA 3UTAA 3AZJD 1KX3A 3RELC 3MGRD 3REJB 3MGQC 3REKC 5B1MA 3WKJB 3B6GD 5AV8D 5JRGA 4WU8D 2HUEC 5B1LC 3X1SC 4WU9C 3AFAA 2HUEB 2G5HC 5B1LB 1KX3B 3B6GB 3AZHA 2F8ND 5CPJB 4WV4B 5AV8A 3X1UC 5B32A 1WWIA 3MGSD 1PZRA 5B33B 4WJ3C 4H9NB 1P3LA 2NQBA 3EPKA 3W99C 3AZFC 1P3OA 3AZHB 3A6NC 4EO5C 1H3OB 2HIOB 5B0YA 5DNNC 4E44A 1P3OD 1M18D 3LZ1D 5B1MC 2JE5A 3AZEA 1P3LD 1M1AC 3O62B 3WTPD 1U35C 5AV6B 3X1SB 5CPKA 5KDMB 3LZ1A 2CV5C 3X1TD 1F66D 3W97B 5AVCC 2Y2MA 1AOID 5AV9A 3EPJA 3W97D 5B31D 1A7WA 4X23D 5C3IB 4J8VC 3MVDB 3B6FD 5BS7A 5GSUA 4LD9C 1HQ3C 1ID3C 4CAYA 3MGRA 3LZ0D 3VH6A 3WTPE 3W99A 2DQNC 5GT3A 3UT9D 5G49B 4CSRA 1P3AB 1P3ID 3AZKB 1P3KC 4NE6A 2YFWB 2ZM5A 3AZHD 2F8NA 3KFUG 3AFAD 1EQZA 5CPID 3AN2B 5JRGD 4WU8A 5B31G 3X1VC 5B24C 3B6GA 3MGSB 5JA4A 3AV1D 5F99C 3KWQA 1B67A 1M1AB 1P3MD 3LELB 1EQZC 3WKJA 1KX5B 3UTBA 2DF4C 1P3FD 4H9PA 4DRAA 4XUJA 2ZY4A 3NQJB 1KX3C 4QLCD 4QLCA 3AV1B 4WU9B 4H9QB 2Y2JA 4J8WA 3IP4C 3UTBD 3B0BA 5CPIB 3WKJD 4R8PB 1U35A 2AROC 4J8XA 3KWQD 3RELB 5AV5A 1HQ3A 3NQUA 3TU4C 1P3BA 4JJND 1P3IB 5B40D 5B2JD 5GT0D 4KGCC 4H9RA 4J8XB 3B0CW 3EPHA 4WNNA 5AV5C 5B0ZD 2PYOD 1BH8B 2NQBC 1P3PC 5B2IA 5C3IC 5DNMB 3AZEB 3LZ0A 3WAAC 2F8NH 5JA4B 5DNNA 5AV6D 3AN2D 3AZMD 3WAAA 3AV2B 3WTPB 1P3LB 3AZLB 3WA9C 4Z66D 5DNMC 5CPKD 4YM6D 4ZBJB 4XZQA 4Z5TD 5AVCA 1P3AD 3WTPA 1M19C 5AVBC 5B2IC 2J8PA 1ID3A 3W98B 2XD1A 3W99B 1P34B 4XZQB 3B6FB 1P3GB 1HTAA 3MVDD 1TZYA 3AZNA 3AYWB 3AYWC 3KXBD 1JFIB 3LELA 1P3GD 4NFTA 5E5AA 3AV2A 3TU4A 2IO5C 2XD5A 5CPJD 1ZLAB 4KUDD 5CP6D 2RVQC 1N1JB 3UTAC 3W98D 4Z5TB 1TAFB 4YS3A 5E5AC 5AVBA 3O62D 5CP6A 2YFVA 3LELC 4KUDA 1KX5C 3AV2D 3AZGC 5DNNB 3LJAA 3X1VB 5B24B 1BH9B 1ZLAD 4WU9A 5B32C 5B33D 5DNMA 5GT3C 3AZKC 1W2EA 2Y2LA 4Z5TA 5GXQD 3C1CC 4XZQD 2CWEA 1P3PA 3REIC 1Q9CA 2FJ7B 3REHD 3X1SA 5BNVB 4J8UC 5B40B 3AZGA 4XUJB 2Y2HA 2F2AC 5AV9C 5GSUC 1KX5A 4J8VB 3A1KA 3MGPD 1JFIA 3VH5W 3AZLD 2YFWA 3KWQB 3REJD 4YS3C 4R8PA 2FFFB 4CAYB 4ZUXD 4QLCB 3MNNC 2FJ7D 4H9SC 5B0ZA 3AZEC 1M1AA 3W96D 3AZIC 3C1BB 2Y2GA 5B40A 3C1BC 3V9RB 4Z2MH 4EO5B 3W96A 3REIA 3AZFB 4AWLB 3AFAB 4J8XD 1KX4C 5GT0B 5B2JB 4J8WD 2NZDD 1S32D 3FDDA 4M6BA 3AZIB 5F99A 3RELD 3VH5A 3MGQD 3F6TA 3A1IA 4R8PD 5AY8D 3REKD 1P34C 5AV8C 3LJAB 3X1VA 4WU8C 4LD9B 5GSUB 2Y2IA 4WU9D 3KUYD 5AY8A 3MGQA 3REKA 3LJAD 4KUDB 3NQUB 5AY8B 1AOIB 1P3MB 3X1UD 2BG1A 3MGSC 2NZDB 3H0LC 4XUJC 5BNXA 3UT9A 1R4VA 1WWSA 5B33A 3W99D 3AZFD 3H0RC 5BT1D 2JCHA 3A6ND 1P3BC 2UWXA 4DRBA 1Z2CB 3C1CB 3B6FA 3UT9B 2HIOC 4H9OA 1H3OA 4YM6B 2F8NK 3W96B 3A6NB 5BNVA 2CV5A 3KXBA 1M18C 1TZYD 3AZND 1P3LC 5B0YC 4ZUXA 1ID3B 3MNNB 3C1CA 2ZY2A 2VQRA 5BO0B 4E45A 3REJA 3X1TC 5BO0A 3AZLA 1F66C 5G49A 4CSRB 3AZJC 5AVCD 1AOIC 3MGRC 5CPJA 3W97C 3X1UA 4LD9A 1M18A 2CV5B 5B24A 3B6GC 5FUGB 4J8VD 5B1LD 5B1LA 3X1SD 3B6FC 3MVDA 4LD9D 3REHB 5B1MB 3MGQB 3REKB 5B2IB 3AZJB 1P3KD 1P3KA 1P3IC 1S32B 3R45B 3AZHC 3B0DC 4UUZB 1S32A 1KU5A 3AFAC 4KGCA 5CPIC 5B24D 2BYKA 3AZMA 4G91B 3AV1C 5DNND 3EPLA 4ZBJC 2JSSA 3AZFA 1P3OC 1BH9A 1P3FB 3LZ1C 5B1MD 1P3FC 1M1AD 5F99B 3W98A 3WTPC 1M19A 3KSYA 4QLCC 4H9NA 1U35D 1KX3D 5CP6B 3UTBC 2CV5D 1P3GA 2AROD 2IO5B 2W8SA 3P5JB 3WAAB 3MGPB 1N1JA 5B31C 3A6NA 4X23C 4G92C 1P3PB 3TU4B 3MGPA 5B40C 2Y2PA 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 D;  1ID3 D;  5AV5 D;  4AWL C;  3LZ0 C;  3LZ0 B;  2L5A A;  1TZY B;  3AZN B;  2PYO C;  1BFM A;  3UT9 C;  1P3P D;  1BH8 A;  1ULY A;  4HGA C;  3WAA D;  4Z66 B;  1P3F A;  2ARO B;  2LY8 A;  1P3M A;  3X1T B;  1F66 B;  5JRG C;  3X1V D;  5AV6 C;  4J8U A;  5F99 D;  3REL A;  3VH6 T;  2ARO A;  2FJ7 A;  1P3M C;  4X23 A;  1EQZ D;  4YM6 C;  4H9R B;  4J8U B;  1M19 D;  5AVB D;  3O62 A;  4Z2M G;  1P3I A;  3VH6 W;  3WKJ C;  5GT0 A;  5B2J A;  1TAF A;  1HQ3 B;  4YS3 B;  3KWQ C;  3B0D B;  3TU4 D;  3AYW D;  3KXB C;  4J8W B;  1P3G C;  4JJN C;  5GT0 C;  5B2J C;  4KGC D;  1KX4 B;  3NQJ A;  5CPJ C;  4KUD C;  5CHL B;  4H9S A;  5B0Z C;  2F8N B;  2RVQ D;  5CP6 C;  3UTB B;  3X1T A;  1F66 A;  2NQB D;  1U35 B;  5GT3 B;  3O62 C;  5AV8 B;  3MGS A;  1KX5 D;  1ZLA A;  3MGR B;  3AV1 A;  4YM6 A;  2BYM B;  5AVC B;  5E5A B;  3AZG D;  5BS7 C;  4J8V A;  5B32 G;  1B6W A;  3AN2 C;  3AZM C;  3AZG B;  1ZLA C;  2BYM A;  3WA9 D;  4Z66 C;  3R45 A;  5DNM D;  4HGA B;  5CPK C;  5GT3 D;  4Z5T C;  5GXQ C;  3C1C D;  3AZJ A;  1P3A C;  1P3K B;  5B2I D;  3VH5 T;  2BYK B;  3WA9 A;  4KGC B;  5B31 A;  4JJN B;  3W97 A;  5AV9 D;  3MVD C;  4X23 B;  4G92 B;  3MGP C;  5B31 B;  3X1U B;  4JJN A;  3AZL C;  4YS3 D;  4H9P B;  3UTA D;  5AVB B;  3W98 C;  4NE3 A;  5E5A D;  4Z66 A;  3MNN D;  2FJ7 C;  3REI B;  3LEL D;  4WNN B;  1M18 B;  3AN2 A;  5AV6 A;  3W96 C;  3AZI D;  4H9O B;  3AV2 C;  3KUY A;  2NQB B;  4G91 C;  3C1B A;  5JRG B;  3AYW A;  5B32 B;  4KHA B;  1F1E A;  1P3A A;  1KX4 D;  5B32 D;  5CPI A;  5FUG A;  5B33 C;  1P34 A;  4J8W C;  2NZD A;  3KXB B;  3AZK D;  4XZQ C;  4R8P C;  5AY8 C;  3REI D;  1P34 D;  3REH C;  2F8N G;  1KX4 A;  4NE5 A;  4J8U D;  1M19 B;  3KUY C;  3KUY B;  3UTA B;  5GSU D;  4UUZ A;  4WU8 B;  4WZS B;  3LJA C;  5CPK B;  1EQZ B;  3REJ C;  3AZI A;  3AZM B;  1AOI A;  3B0C T;  2PYO A;  5AV9 B;  3AZK A;  4XUJ D;  4ZUX C;  5BNX B;  5KDM A;  2HIO A;  5BT1 C;  5B0Y B;  3LZ1 B;  1P3B D;  1P3O B;  3AZE D;  5GXQ B;  2HIO D;  3C1B D;  3REH A;  1P3B B;  3WA9 B;  1TZY C;  3AZN C;  5B0Z B;  2PYO B;  2YFV B;  5B0Y D;  5AV5 B;  4J8X C;  5GXQ A;  3MNN A;  4ZUX B;  2NZD C;  3V9R A;  1S32 C;  4H9Q A;  3UTA A;  3AZJ D;  1KX3 A;  3REL C;  3MGR D;  3REJ B;  3MGQ C;  3REK C;  5B1M A;  3WKJ B;  3B6G D;  5AV8 D;  5JRG A;  4WU8 D;  2HUE C;  5B1L C;  3X1S C;  4WU9 C;  3AFA A;  2HUE B;  5B1L B;  1KX3 B;  3B6G B;  3AZH A;  2F8N D;  5CPJ B;  4WV4 B;  5AV8 A;  3X1U C;  5B32 A;  1WWI A;  3MGS D;  5B33 B;  4H9N B;  1P3L A;  2NQB A;  3W99 C;  3AZF C;  1P3O A;  3AZH B;  3A6N C;  4EO5 C;  1H3O B;  2HIO B;  5B0Y A;  5DNN C;  4E44 A;  1P3O D;  1M18 D;  3LZ1 D;  5B1M C;  1P3L D;  3AZE A;  1M1A C;  3O62 B;  3WTP D;  1U35 C;  5AV6 B;  3X1S B;  5CPK A;  3LZ1 A;  5KDM B;  2CV5 C;  3X1T D;  1F66 D;  3W97 B;  5AVC C;  1AOI D;  5AV9 A;  3W97 D;  5B31 D;  1A7W A;  4X23 D;  5C3I B;  4J8V C;  3MVD B;  3B6F D;  5BS7 A;  5GSU A;  4LD9 C;  1HQ3 C;  1ID3 C;  4CAY A;  3MGR A;  3LZ0 D;  3VH6 A;  3WTP E;  3W99 A;  5GT3 A;  3UT9 D;  5G49 B;  4CSR A;  1P3A B;  1P3I D;  3AZK B;  1P3K C;  4NE6 A;  2YFW B;  3AZH D;  2F8N A;  3AFA D;  1EQZ A;  5CPI D;  3AN2 B;  5JRG D;  4WU8 A;  5B31 G;  3X1V C;  5B24 C;  3B6G A;  3MGS B;  5JA4 A;  3AV1 D;  5F99 C;  3KWQ A;  1B67 A;  1M1A B;  1P3M D;  3LEL B;  1EQZ C;  3WKJ A;  1KX5 B;  3UTB A;  1P3F D;  4H9P A;  4DRA A;  4XUJ A;  3NQJ B;  1KX3 C;  4QLC D;  4QLC A;  3AV1 B;  4WU9 B;  4H9Q B;  4J8W A;  3UTB D;  3B0B A;  5CPI B;  3WKJ D;  4R8P B;  1U35 A;  2ARO C;  4J8X A;  3KWQ D;  3REL B;  5AV5 A;  1HQ3 A;  3NQU A;  3TU4 C;  1P3B A;  4JJN D;  1P3I B;  5B40 D;  5B2J D;  5GT0 D;  4KGC C;  4H9R A;  4J8X B;  3B0C W;  4WNN A;  5AV5 C;  5B0Z D;  2PYO D;  1BH8 B;  2NQB C;  1P3P C;  5B2I A;  5C3I C;  5DNM B;  3AZE B;  3LZ0 A;  3WAA C;  2F8N H;  5JA4 B;  5DNN A;  5AV6 D;  3AN2 D;  3AZM D;  3WAA A;  3AV2 B;  3WTP B;  1P3L B;  3AZL B;  3WA9 C;  4Z66 D;  5DNM C;  5CPK D;  4YM6 D;  4ZBJ B;  4XZQ A;  4Z5T D;  5AVC A;  1P3A D;  3WTP A;  1M19 C;  5AVB C;  5B2I C;  1ID3 A;  3W98 B;  3W99 B;  1P34 B;  4XZQ B;  3B6F B;  1P3G B;  1HTA A;  3MVD D;  1TZY A;  3AZN A;  3AYW B;  3AYW C;  3KXB D;  1JFI B;  3LEL A;  1P3G D;  4NFT A;  5E5A A;  3AV2 A;  3TU4 A;  2IO5 C;  5CPJ D;  1ZLA B;  4KUD D;  5CP6 D;  2RVQ C;  1N1J B;  3UTA C;  3W98 D;  4Z5T B;  1TAF B;  4YS3 A;  5E5A C;  5AVB A;  3O62 D;  5CP6 A;  2YFV A;  3LEL C;  4KUD A;  1KX5 C;  3AV2 D;  3AZG C;  5DNN B;  3LJA A;  3X1V B;  5B24 B;  1BH9 B;  1ZLA D;  4WU9 A;  5B32 C;  5B33 D;  5DNM A;  5GT3 C;  3AZK C;  4Z5T A;  5GXQ D;  3C1C C;  4XZQ D;  2CWE A;  1P3P A;  3REI C;  1Q9C A;  2FJ7 B;  3REH D;  3X1S A;  5BNV B;  4J8U C;  5B40 B;  3AZG A;  4XUJ B;  5AV9 C;  5GSU C;  1KX5 A;  4J8V B;  3MGP D;  1JFI A;  3VH5 W;  3AZL D;  2YFW A;  3KWQ B;  3REJ D;  4YS3 C;  4R8P A;  4CAY B;  4ZUX D;  4QLC B;  3MNN C;  2FJ7 D;  4H9S C;  5B0Z A;  3AZE C;  1M1A A;  3W96 D;  3AZI C;  3C1B B;  5B40 A;  3C1B C;  3V9R B;  4Z2M H;  4EO5 B;  3W96 A;  3REI A;  3AZF B;  4AWL B;  3AFA B;  4J8X D;  1KX4 C;  5GT0 B;  5B2J B;  4J8W D;  2NZD D;  1S32 D;  4M6B A;  3AZI B;  5F99 A;  3REL D;  3VH5 A;  3MGQ D;  3REK D;  4R8P D;  5AY8 D;  1P34 C;  5AV8 C;  3LJA B;  3X1V A;  4WU8 C;  4LD9 B;  5GSU B;  4WU9 D;  3KUY D;  5AY8 A;  3MGQ A;  3REK A;  3LJA D;  4KUD B;  3NQU B;  5AY8 B;  1AOI B;  1P3M B;  3X1U D;  3MGS C;  2NZD B;  4XUJ C;  5BNX A;  3UT9 A;  1R4V A;  1WWS A;  5B33 A;  3W99 D;  3AZF D;  5BT1 D;  3A6N D;  1P3B C;  4DRB A;  3C1C B;  3B6F A;  3UT9 B;  2HIO C;  4H9O A;  1H3O A;  4YM6 B;  2F8N K;  3W96 B;  3A6N B;  5BNV A;  2CV5 A;  3KXB A;  1M18 C;  1TZY D;  3AZN D;  1P3L C;  5B0Y C;  4ZUX A;  1ID3 B;  3MNN B;  3C1C A;  5BO0 B;  4E45 A;  3REJ A;  3X1T C;  5BO0 A;  3AZL A;  1F66 C;  5G49 A;  4CSR B;  3AZJ C;  5AVC D;  1AOI C;  3MGR C;  5CPJ A;  3W97 C;  3X1U A;  4LD9 A;  1M18 A;  2CV5 B;  5B24 A;  3B6G C;  5FUG B;  4J8V D;  5B1L D;  5B1L A;  3X1S D;  3B6F C;  3MVD A;  4LD9 D;  3REH B;  5B1M B;  3MGQ B;  3REK B;  5B2I B;  3AZJ B;  1P3K D;  1P3K A;  1P3I C;  1S32 B;  3R45 B;  3AZH C;  3B0D C;  4UUZ B;  1S32 A;  1KU5 A;  3AFA C;  4KGC A;  5CPI C;  5B24 D;  2BYK A;  3AZM A;  4G91 B;  3AV1 C;  5DNN D;  4ZBJ C;  2JSS A;  3AZF A;  1P3O C;  1BH9 A;  1P3F B;  3LZ1 C;  5B1M D;  1P3F C;  1M1A D;  5F99 B;  3W98 A;  3WTP C;  1M19 A;  3KSY A;  4QLC C;  4H9N A;  1U35 D;  1KX3 D;  5CP6 B;  3UTB C;  2CV5 D;  1P3G A;  2ARO D;  2IO5 B;  3WAA B;  3MGP B;  1N1J A;  5B31 C;  3A6N A;  4X23 C;  4G92 C;  1P3P B;  3TU4 B;  3MGP A;  5B40 C;  4KHA A; 
#chains in the Genus database with same CATH topology
 1HQ3 D;  1ID3 D;  5AV5 D;  4AWL C;  3LZ0 C;  3LZ0 B;  2L5A A;  1TZY B;  3AZN B;  2PYO C;  1BFM A;  3UT9 C;  1P3P D;  1BH8 A;  1ULY A;  4HGA C;  3WAA D;  4Z66 B;  1P3F A;  2ARO B;  2LY8 A;  1P3M A;  3X1T B;  2ZY5 A;  1F66 B;  5JRG C;  3X1V D;  5AV6 C;  4J8U A;  5F99 D;  3REL A;  3VH6 T;  2ARO A;  2FJ7 A;  1P3M C;  4X23 A;  1EQZ D;  4YM6 C;  4H9R B;  4J8U B;  1M19 D;  5AVB D;  3O62 A;  4Z2M G;  1P3I A;  3VH6 W;  3WKJ C;  5GT0 A;  5B2J A;  1TAF A;  1HQ3 B;  4YS3 B;  3KWQ C;  2RIQ A;  3B0D B;  3TU4 D;  2ZY3 A;  3KXB C;  3AYW D;  4J8W B;  1P3G C;  4JJN C;  5GT0 C;  5B2J C;  4KGC D;  1KX4 B;  3NQJ A;  5CPJ C;  4KUD C;  5CHL B;  4H9S A;  5B0Z C;  2F8N B;  2RVQ D;  5CP6 C;  3UTB B;  3X1T A;  1F66 A;  2NQB D;  1U35 B;  5GT3 B;  3O62 C;  5AV8 B;  3MGS A;  1KX5 D;  1ZLA A;  3MGR B;  3AV1 A;  4YM6 A;  2BYM B;  5AVC B;  5E5A B;  3AZG D;  5BS7 C;  4J8V A;  5B32 G;  1B6W A;  3AN2 C;  3AZM C;  3AZG B;  1ZLA C;  2BYM A;  3WA9 D;  4Z66 C;  3R45 A;  5DNM D;  4HGA B;  5CPK C;  5GT3 D;  4Z5T C;  5GXQ C;  3C1C D;  3AZJ A;  1P3A C;  2G5I C;  1P3K B;  5B2I D;  3VH5 T;  2BYK B;  2Y2Q A;  3WA9 A;  4KGC B;  5B31 A;  4JJN B;  3W97 A;  5AV9 D;  3MVD C;  4X23 B;  4G92 B;  3MGP C;  5B31 B;  3X1U B;  4JJN A;  3AZL C;  4YS3 D;  4H9P B;  3UTA D;  5AVB B;  3W98 C;  4NE3 A;  4DQY B;  5E5A D;  4Z66 A;  3MNN D;  2FJ7 C;  3REI B;  3LEL D;  4WNN B;  1M18 B;  3AN2 A;  5AV6 A;  3W96 C;  3AZI D;  4H9O B;  3AV2 C;  3KUY A;  2NQB B;  4G91 C;  3C1B A;  5JRG B;  3AYW A;  5B32 B;  4KHA B;  1F1E A;  1P3A A;  1KX4 D;  5B32 D;  5CPI A;  5FUG A;  5B33 C;  1P34 A;  4J8W C;  2NZD A;  3KXB B;  3AL0 C;  3AZK D;  2Y2K A;  4XZQ C;  4R8P C;  5AY8 C;  3REI D;  1P34 D;  3REH C;  2F8N G;  1KX4 A;  4NE5 A;  4J8U D;  2Y2N A;  3KUY C;  3KUY B;  1M19 B;  3UTA B;  5GSU D;  4UUZ A;  4WU8 B;  4WZS B;  3LJA C;  5CPK B;  1EQZ B;  3REJ C;  2Y2O A;  3AZI A;  3AZM B;  1AOI A;  3B0C T;  2PYO A;  3H0M C;  5AV9 B;  3AZK A;  4XUJ D;  4ZUX C;  5BNX B;  5KDM A;  1T3U A;  2HIO A;  3EG5 B;  5BT1 C;  5B0Y B;  3LZ1 B;  1P3B D;  1P3O B;  3AZE D;  5GXQ B;  2HIO D;  3C1B D;  4UPK A;  3REH A;  1P3B B;  3WA9 B;  1TZY C;  3AZN C;  5B0Z B;  2PYO B;  2YFV B;  5B0Y D;  5AV5 B;  4J8X C;  5GXQ A;  3MNN A;  4ZUX B;  2NZD C;  3V9R A;  1S32 C;  4H9Q A;  3UTA A;  3AZJ D;  1KX3 A;  3REL C;  3MGR D;  3REJ B;  3MGQ C;  3REK C;  5B1M A;  3WKJ B;  3B6G D;  5AV8 D;  5JRG A;  4WU8 D;  2HUE C;  5B1L C;  3X1S C;  4WU9 C;  3AFA A;  2HUE B;  2G5H C;  5B1L B;  1KX3 B;  3B6G B;  3AZH A;  2F8N D;  5CPJ B;  4WV4 B;  5AV8 A;  3X1U C;  5B32 A;  1WWI A;  3MGS D;  1PZR A;  5B33 B;  4WJ3 C;  4H9N B;  1P3L A;  2NQB A;  3EPK A;  3W99 C;  3AZF C;  1P3O A;  3AZH B;  3A6N C;  4EO5 C;  1H3O B;  2HIO B;  5B0Y A;  5DNN C;  4E44 A;  1P3O D;  1M18 D;  3LZ1 D;  5B1M C;  2JE5 A;  3AZE A;  1P3L D;  1M1A C;  3O62 B;  3WTP D;  1U35 C;  5AV6 B;  3X1S B;  5CPK A;  5KDM B;  3LZ1 A;  2CV5 C;  3X1T D;  1F66 D;  3W97 B;  5AVC C;  2Y2M A;  1AOI D;  5AV9 A;  3EPJ A;  3W97 D;  5B31 D;  1A7W A;  4X23 D;  5C3I B;  4J8V C;  3MVD B;  3B6F D;  5BS7 A;  5GSU A;  4LD9 C;  1HQ3 C;  1ID3 C;  4CAY A;  3MGR A;  3LZ0 D;  3VH6 A;  3WTP E;  3W99 A;  2DQN C;  5GT3 A;  3UT9 D;  5G49 B;  4CSR A;  1P3A B;  1P3I D;  3AZK B;  1P3K C;  4NE6 A;  2YFW B;  2ZM5 A;  3AZH D;  2F8N A;  3KFU G;  3AFA D;  1EQZ A;  5CPI D;  3AN2 B;  5JRG D;  4WU8 A;  5B31 G;  3X1V C;  5B24 C;  3B6G A;  3MGS B;  5JA4 A;  3AV1 D;  5F99 C;  3KWQ A;  1B67 A;  1M1A B;  1P3M D;  3LEL B;  1EQZ C;  3WKJ A;  1KX5 B;  3UTB A;  2DF4 C;  1P3F D;  4H9P A;  4DRA A;  4XUJ A;  2ZY4 A;  3NQJ B;  1KX3 C;  4QLC D;  4QLC A;  3AV1 B;  4WU9 B;  4H9Q B;  2Y2J A;  4J8W A;  3IP4 C;  3UTB D;  3B0B A;  5CPI B;  3WKJ D;  4R8P B;  1U35 A;  2ARO C;  4J8X A;  3KWQ D;  3REL B;  5AV5 A;  1HQ3 A;  3NQU A;  3TU4 C;  1P3B A;  4JJN D;  1P3I B;  5B40 D;  5B2J D;  5GT0 D;  4KGC C;  4H9R A;  4J8X B;  3B0C W;  3EPH A;  4WNN A;  5AV5 C;  5B0Z D;  2PYO D;  1BH8 B;  2NQB C;  1P3P C;  5B2I A;  5C3I C;  5DNM B;  3AZE B;  3LZ0 A;  3WAA C;  2F8N H;  5JA4 B;  5DNN A;  5AV6 D;  3AN2 D;  3AZM D;  3WAA A;  3AV2 B;  3WTP B;  1P3L B;  3AZL B;  3WA9 C;  4Z66 D;  5DNM C;  5CPK D;  4YM6 D;  4ZBJ B;  4XZQ A;  4Z5T D;  5AVC A;  1P3A D;  3WTP A;  1M19 C;  5AVB C;  5B2I C;  2J8P A;  1ID3 A;  3W98 B;  2XD1 A;  3W99 B;  1P34 B;  4XZQ B;  3B6F B;  1P3G B;  1HTA A;  3MVD D;  1TZY A;  3AZN A;  3AYW B;  3AYW C;  3KXB D;  1JFI B;  3LEL A;  1P3G D;  4NFT A;  5E5A A;  3AV2 A;  3TU4 A;  2IO5 C;  2XD5 A;  5CPJ D;  1ZLA B;  4KUD D;  5CP6 D;  2RVQ C;  1N1J B;  3UTA C;  3W98 D;  4Z5T B;  1TAF B;  4YS3 A;  5E5A C;  5AVB A;  3O62 D;  5CP6 A;  2YFV A;  3LEL C;  4KUD A;  1KX5 C;  3AV2 D;  3AZG C;  5DNN B;  3LJA A;  3X1V B;  5B24 B;  1BH9 B;  1ZLA D;  4WU9 A;  5B32 C;  5B33 D;  5DNM A;  5GT3 C;  3AZK C;  1W2E A;  2Y2L A;  4Z5T A;  5GXQ D;  3C1C C;  4XZQ D;  2CWE A;  1P3P A;  3REI C;  1Q9C A;  2FJ7 B;  3REH D;  3X1S A;  5BNV B;  4J8U C;  5B40 B;  3AZG A;  4XUJ B;  2Y2H A;  2F2A C;  5AV9 C;  5GSU C;  1KX5 A;  4J8V B;  3A1K A;  3MGP D;  1JFI A;  3VH5 W;  3AZL D;  2YFW A;  3KWQ B;  3REJ D;  4YS3 C;  4R8P A;  2FFF B;  4CAY B;  4ZUX D;  4QLC B;  3MNN C;  2FJ7 D;  4H9S C;  5B0Z A;  3AZE C;  1M1A A;  3W96 D;  3AZI C;  3C1B B;  2Y2G A;  5B40 A;  3C1B C;  3V9R B;  4Z2M H;  4EO5 B;  3W96 A;  3REI A;  3AZF B;  4AWL B;  3AFA B;  4J8X D;  1KX4 C;  5GT0 B;  5B2J B;  4J8W D;  2NZD D;  1S32 D;  3FDD A;  4M6B A;  3AZI B;  5F99 A;  3REL D;  3VH5 A;  3MGQ D;  3F6T A;  3A1I A;  4R8P D;  5AY8 D;  3REK D;  1P34 C;  5AV8 C;  3LJA B;  3X1V A;  4WU8 C;  4LD9 B;  5GSU B;  2Y2I A;  4WU9 D;  3KUY D;  5AY8 A;  3MGQ A;  3REK A;  3LJA D;  4KUD B;  3NQU B;  5AY8 B;  1AOI B;  1P3M B;  3X1U D;  2BG1 A;  3MGS C;  2NZD B;  3H0L C;  4XUJ C;  5BNX A;  3UT9 A;  1R4V A;  1WWS A;  5B33 A;  3W99 D;  3AZF D;  3H0R C;  5BT1 D;  2JCH A;  3A6N D;  1P3B C;  2UWX A;  4DRB A;  1Z2C B;  3C1C B;  3B6F A;  3UT9 B;  2HIO C;  4H9O A;  1H3O A;  4YM6 B;  2F8N K;  3W96 B;  3A6N B;  5BNV A;  2CV5 A;  3KXB A;  1M18 C;  1TZY D;  3AZN D;  1P3L C;  5B0Y C;  4ZUX A;  1ID3 B;  3MNN B;  3C1C A;  2ZY2 A;  2VQR A;  5BO0 B;  4E45 A;  3REJ A;  3X1T C;  5BO0 A;  3AZL A;  1F66 C;  5G49 A;  4CSR B;  3AZJ C;  5AVC D;  1AOI C;  3MGR C;  5CPJ A;  3W97 C;  3X1U A;  4LD9 A;  1M18 A;  2CV5 B;  5B24 A;  3B6G C;  5FUG B;  4J8V D;  5B1L D;  5B1L A;  3X1S D;  3B6F C;  3MVD A;  4LD9 D;  3REH B;  5B1M B;  3MGQ B;  3REK B;  5B2I B;  3AZJ B;  1P3K D;  1P3K A;  1P3I C;  1S32 B;  3R45 B;  3AZH C;  3B0D C;  4UUZ B;  1S32 A;  1KU5 A;  3AFA C;  4KGC A;  5CPI C;  5B24 D;  2BYK A;  3AZM A;  4G91 B;  3AV1 C;  5DNN D;  3EPL A;  4ZBJ C;  2JSS A;  3AZF A;  1P3O C;  1BH9 A;  1P3F B;  3LZ1 C;  5B1M D;  1P3F C;  1M1A D;  5F99 B;  3W98 A;  3WTP C;  1M19 A;  3KSY A;  4QLC C;  4H9N A;  1U35 D;  1KX3 D;  5CP6 B;  3UTB C;  2CV5 D;  1P3G A;  2ARO D;  2IO5 B;  2W8S A;  3P5J B;  3WAA B;  3MGP B;  1N1J A;  5B31 C;  3A6N A;  4X23 C;  4G92 C;  1P3P B;  3TU4 B;  3MGP A;  5B40 C;  2Y2P A;  4KHA A; 
#chains in the Genus database with same CATH homology
 1HQ3 D;  1ID3 D;  5AV5 D;  4AWL C;  3LZ0 C;  3LZ0 B;  2L5A A;  1TZY B;  3AZN B;  2PYO C;  1BFM A;  3UT9 C;  1P3P D;  1BH8 A;  1ULY A;  4HGA C;  3WAA D;  4Z66 B;  1P3F A;  2ARO B;  2LY8 A;  1P3M A;  3X1T B;  2ZY5 A;  1F66 B;  5JRG C;  3X1V D;  5AV6 C;  4J8U A;  5F99 D;  3REL A;  3VH6 T;  2ARO A;  2FJ7 A;  1P3M C;  4X23 A;  1EQZ D;  4YM6 C;  4H9R B;  4J8U B;  1M19 D;  5AVB D;  3O62 A;  4Z2M G;  1P3I A;  3VH6 W;  3WKJ C;  5GT0 A;  5B2J A;  1TAF A;  1HQ3 B;  4YS3 B;  3KWQ C;  2RIQ A;  3B0D B;  3TU4 D;  2ZY3 A;  3KXB C;  3AYW D;  4J8W B;  1P3G C;  4JJN C;  5GT0 C;  5B2J C;  4KGC D;  1KX4 B;  3NQJ A;  5CPJ C;  4KUD C;  5CHL B;  4H9S A;  5B0Z C;  2F8N B;  2RVQ D;  5CP6 C;  3UTB B;  3X1T A;  1F66 A;  2NQB D;  1U35 B;  5GT3 B;  3O62 C;  5AV8 B;  3MGS A;  1KX5 D;  1ZLA A;  3MGR B;  3AV1 A;  4YM6 A;  2BYM B;  5AVC B;  5E5A B;  3AZG D;  5BS7 C;  4J8V A;  5B32 G;  1B6W A;  3AN2 C;  3AZM C;  3AZG B;  1ZLA C;  2BYM A;  3WA9 D;  4Z66 C;  3R45 A;  5DNM D;  4HGA B;  5CPK C;  5GT3 D;  4Z5T C;  5GXQ C;  3C1C D;  3AZJ A;  1P3A C;  2G5I C;  1P3K B;  5B2I D;  3VH5 T;  2BYK B;  2Y2Q A;  3WA9 A;  4KGC B;  5B31 A;  4JJN B;  3W97 A;  5AV9 D;  3MVD C;  4X23 B;  4G92 B;  3MGP C;  5B31 B;  3X1U B;  4JJN A;  3AZL C;  4YS3 D;  4H9P B;  3UTA D;  5AVB B;  3W98 C;  4NE3 A;  4DQY B;  5E5A D;  4Z66 A;  3MNN D;  2FJ7 C;  3REI B;  3LEL D;  4WNN B;  1M18 B;  3AN2 A;  5AV6 A;  3W96 C;  3AZI D;  4H9O B;  3AV2 C;  3KUY A;  2NQB B;  4G91 C;  3C1B A;  5JRG B;  3AYW A;  5B32 B;  4KHA B;  1F1E A;  1P3A A;  1KX4 D;  5B32 D;  5CPI A;  5FUG A;  5B33 C;  1P34 A;  4J8W C;  2NZD A;  3KXB B;  3AL0 C;  3AZK D;  2Y2K A;  4XZQ C;  4R8P C;  5AY8 C;  3REI D;  1P34 D;  3REH C;  2F8N G;  1KX4 A;  4NE5 A;  4J8U D;  2Y2N A;  3KUY C;  3KUY B;  1M19 B;  3UTA B;  5GSU D;  4UUZ A;  4WU8 B;  4WZS B;  3LJA C;  5CPK B;  1EQZ B;  3REJ C;  2Y2O A;  3AZI A;  3AZM B;  1AOI A;  3B0C T;  2PYO A;  3H0M C;  5AV9 B;  3AZK A;  4XUJ D;  4ZUX C;  5BNX B;  5KDM A;  1T3U A;  2HIO A;  3EG5 B;  5BT1 C;  5B0Y B;  3LZ1 B;  1P3B D;  1P3O B;  3AZE D;  5GXQ B;  2HIO D;  3C1B D;  4UPK A;  3REH A;  1P3B B;  3WA9 B;  1TZY C;  3AZN C;  5B0Z B;  2PYO B;  2YFV B;  5B0Y D;  5AV5 B;  4J8X C;  5GXQ A;  3MNN A;  4ZUX B;  2NZD C;  3V9R A;  1S32 C;  4H9Q A;  3UTA A;  3AZJ D;  1KX3 A;  3REL C;  3MGR D;  3REJ B;  3MGQ C;  3REK C;  5B1M A;  3WKJ B;  3B6G D;  5AV8 D;  5JRG A;  4WU8 D;  2HUE C;  5B1L C;  3X1S C;  4WU9 C;  3AFA A;  2HUE B;  2G5H C;  5B1L B;  1KX3 B;  3B6G B;  3AZH A;  2F8N D;  5CPJ B;  4WV4 B;  5AV8 A;  3X1U C;  5B32 A;  1WWI A;  3MGS D;  1PZR A;  5B33 B;  4WJ3 C;  4H9N B;  1P3L A;  2NQB A;  3EPK A;  3W99 C;  3AZF C;  1P3O A;  3AZH B;  3A6N C;  4EO5 C;  1H3O B;  2HIO B;  5B0Y A;  5DNN C;  4E44 A;  1P3O D;  1M18 D;  3LZ1 D;  5B1M C;  2JE5 A;  3AZE A;  1P3L D;  1M1A C;  3O62 B;  3WTP D;  1U35 C;  5AV6 B;  3X1S B;  5CPK A;  5KDM B;  3LZ1 A;  2CV5 C;  3X1T D;  1F66 D;  3W97 B;  5AVC C;  2Y2M A;  1AOI D;  5AV9 A;  3EPJ A;  3W97 D;  5B31 D;  1A7W A;  4X23 D;  5C3I B;  4J8V C;  3MVD B;  3B6F D;  5BS7 A;  5GSU A;  4LD9 C;  1HQ3 C;  1ID3 C;  4CAY A;  3MGR A;  3LZ0 D;  3VH6 A;  3WTP E;  3W99 A;  2DQN C;  5GT3 A;  3UT9 D;  5G49 B;  4CSR A;  1P3A B;  1P3I D;  3AZK B;  1P3K C;  4NE6 A;  2YFW B;  2ZM5 A;  3AZH D;  2F8N A;  3KFU G;  3AFA D;  1EQZ A;  5CPI D;  3AN2 B;  5JRG D;  4WU8 A;  5B31 G;  3X1V C;  5B24 C;  3B6G A;  3MGS B;  5JA4 A;  3AV1 D;  5F99 C;  3KWQ A;  1B67 A;  1M1A B;  1P3M D;  3LEL B;  1EQZ C;  3WKJ A;  1KX5 B;  3UTB A;  2DF4 C;  1P3F D;  4H9P A;  4DRA A;  4XUJ A;  2ZY4 A;  3NQJ B;  1KX3 C;  4QLC D;  4QLC A;  3AV1 B;  4WU9 B;  4H9Q B;  2Y2J A;  4J8W A;  3IP4 C;  3UTB D;  3B0B A;  5CPI B;  3WKJ D;  4R8P B;  1U35 A;  2ARO C;  4J8X A;  3KWQ D;  3REL B;  5AV5 A;  1HQ3 A;  3NQU A;  3TU4 C;  1P3B A;  4JJN D;  1P3I B;  5B40 D;  5B2J D;  5GT0 D;  4KGC C;  4H9R A;  4J8X B;  3B0C W;  3EPH A;  4WNN A;  5AV5 C;  5B0Z D;  2PYO D;  1BH8 B;  2NQB C;  1P3P C;  5B2I A;  5C3I C;  5DNM B;  3AZE B;  3LZ0 A;  3WAA C;  2F8N H;  5JA4 B;  5DNN A;  5AV6 D;  3AN2 D;  3AZM D;  3WAA A;  3AV2 B;  3WTP B;  1P3L B;  3AZL B;  3WA9 C;  4Z66 D;  5DNM C;  5CPK D;  4YM6 D;  4ZBJ B;  4XZQ A;  4Z5T D;  5AVC A;  1P3A D;  3WTP A;  1M19 C;  5AVB C;  5B2I C;  2J8P A;  1ID3 A;  3W98 B;  2XD1 A;  3W99 B;  1P34 B;  4XZQ B;  3B6F B;  1P3G B;  1HTA A;  3MVD D;  1TZY A;  3AZN A;  3AYW B;  3AYW C;  3KXB D;  1JFI B;  3LEL A;  1P3G D;  4NFT A;  5E5A A;  3AV2 A;  3TU4 A;  2IO5 C;  2XD5 A;  5CPJ D;  1ZLA B;  4KUD D;  5CP6 D;  2RVQ C;  1N1J B;  3UTA C;  3W98 D;  4Z5T B;  1TAF B;  4YS3 A;  5E5A C;  5AVB A;  3O62 D;  5CP6 A;  2YFV A;  3LEL C;  4KUD A;  1KX5 C;  3AV2 D;  3AZG C;  5DNN B;  3LJA A;  3X1V B;  5B24 B;  1BH9 B;  1ZLA D;  4WU9 A;  5B32 C;  5B33 D;  5DNM A;  5GT3 C;  3AZK C;  1W2E A;  2Y2L A;  4Z5T A;  5GXQ D;  3C1C C;  4XZQ D;  2CWE A;  1P3P A;  3REI C;  1Q9C A;  2FJ7 B;  3REH D;  3X1S A;  5BNV B;  4J8U C;  5B40 B;  3AZG A;  4XUJ B;  2Y2H A;  2F2A C;  5AV9 C;  5GSU C;  1KX5 A;  4J8V B;  3A1K A;  3MGP D;  1JFI A;  3VH5 W;  3AZL D;  2YFW A;  3KWQ B;  3REJ D;  4YS3 C;  4R8P A;  2FFF B;  4CAY B;  4ZUX D;  4QLC B;  3MNN C;  2FJ7 D;  4H9S C;  5B0Z A;  3AZE C;  1M1A A;  3W96 D;  3AZI C;  3C1B B;  2Y2G A;  5B40 A;  3C1B C;  3V9R B;  4Z2M H;  4EO5 B;  3W96 A;  3REI A;  3AZF B;  4AWL B;  3AFA B;  4J8X D;  1KX4 C;  5GT0 B;  5B2J B;  4J8W D;  2NZD D;  1S32 D;  3FDD A;  4M6B A;  3AZI B;  5F99 A;  3REL D;  3VH5 A;  3MGQ D;  3F6T A;  3A1I A;  4R8P D;  5AY8 D;  3REK D;  1P34 C;  5AV8 C;  3LJA B;  3X1V A;  4WU8 C;  4LD9 B;  5GSU B;  2Y2I A;  4WU9 D;  3KUY D;  5AY8 A;  3MGQ A;  3REK A;  3LJA D;  4KUD B;  3NQU B;  5AY8 B;  1AOI B;  1P3M B;  3X1U D;  2BG1 A;  3MGS C;  2NZD B;  3H0L C;  4XUJ C;  5BNX A;  3UT9 A;  1R4V A;  1WWS A;  5B33 A;  3W99 D;  3AZF D;  3H0R C;  5BT1 D;  2JCH A;  3A6N D;  1P3B C;  2UWX A;  4DRB A;  1Z2C B;  3C1C B;  3B6F A;  3UT9 B;  2HIO C;  4H9O A;  1H3O A;  4YM6 B;  2F8N K;  3W96 B;  3A6N B;  5BNV A;  2CV5 A;  3KXB A;  1M18 C;  1TZY D;  3AZN D;  1P3L C;  5B0Y C;  4ZUX A;  1ID3 B;  3MNN B;  3C1C A;  2ZY2 A;  2VQR A;  5BO0 B;  4E45 A;  3REJ A;  3X1T C;  5BO0 A;  3AZL A;  1F66 C;  5G49 A;  4CSR B;  3AZJ C;  5AVC D;  1AOI C;  3MGR C;  5CPJ A;  3W97 C;  3X1U A;  4LD9 A;  1M18 A;  2CV5 B;  5B24 A;  3B6G C;  5FUG B;  4J8V D;  5B1L D;  5B1L A;  3X1S D;  3B6F C;  3MVD A;  4LD9 D;  3REH B;  5B1M B;  3MGQ B;  3REK B;  5B2I B;  3AZJ B;  1P3K D;  1P3K A;  1P3I C;  1S32 B;  3R45 B;  3AZH C;  3B0D C;  4UUZ B;  1S32 A;  1KU5 A;  3AFA C;  4KGC A;  5CPI C;  5B24 D;  2BYK A;  3AZM A;  4G91 B;  3AV1 C;  5DNN D;  3EPL A;  4ZBJ C;  2JSS A;  3AZF A;  1P3O C;  1BH9 A;  1P3F B;  3LZ1 C;  5B1M D;  1P3F C;  1M1A D;  5F99 B;  3W98 A;  3WTP C;  1M19 A;  3KSY A;  4QLC C;  4H9N A;  1U35 D;  1KX3 D;  5CP6 B;  3UTB C;  2CV5 D;  1P3G A;  2ARO D;  2IO5 B;  2W8S A;  3P5J B;  3WAA B;  3MGP B;  1N1J A;  5B31 C;  3A6N A;  4X23 C;  4G92 C;  1P3P B;  3TU4 B;  3MGP A;  5B40 C;  2Y2P A;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...