5F99C

X-ray structure of the mmtv-a nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title X-ray structure of the MMTV-A nucleosome core.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 111
sequence length 111
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5f99C00
1KX5D 3W98A 2JSSA 4X23B 5B2JD 3KWQD 5CP6A 1M19B 4LD9B 1TZYC 3AZHA 4Z66C 4WU8B 1P3OA 1F66B 5G49A 5B32A 3O62C 3B0DB 4Z5TB 5DNNA 3MNNA 5AVCB 3AZKD 3NQUA 3C1BB 3WTPE 5BNXB 1P3IA 1AOIC 3AZIB 3AZGC 1F1EA 5CHLB 3VH5T 5AV5A 3WAAA 3KXBD 2LY8A 3LELC 3AYWA 1U35D 1P3AB 4AWLB 3AV2A 4XZQA 5AY8C 3RELA 4Z2MG 3WTPA 1WWIA 2NQBB 5GXQB 1P34B 5B2IB 1A7WA 1H3OB 3AZJC 4YS3D 1S32D 4CAYB 3W96A 5B33D 5JRGD 4WNNA 4KUDB 3AZLA 5B1MC 2BYKB 4H9SC 5B31G 3LZ0D 3REID 2YFWB 4H9QB 1HQ3D 3AZMB 5DNMB 3AV1A 3MVDB 3B6FC 3LZ1B 3MGRD 1KX5A 5F99D 3AN2B 5B2JA 2NZDB 3UT9B 5E5AB 5AV9C 3KWQA 3X1SD 4H9OB 3AZEB 5BS7A 2PYOD 1P3FC 4EO5C 3X1TD 3AZFD 4WU9B 3MGSC 3KUYB 3AZKA 5GT0D 3REJC 3X1VB 3R45B 1P3GD 5CP6C 4YM6B 4J8UB 5B31B 5BT1D 4R8PD 3WA9D 3KXBA 1U35A 3REHB 3AZHC 1P3OC 4HGAC 2YFVA 4ZUXB 1M18D 5B32C 5DNNC 3MNNC 3B6GD 3NQJB 1P3IC 3UTBC 3AFAD 1KX3D 5B0ZB 1S32A 4YS3A 3W99D 3WAAC 5AV5C 5B1LB 5B33A 5JRGA 2IO5C 3AYWC 3V9RA 3AV2C 2BYMB 3RELC 3WTPC 3LZ0A 3REIA 1BH9B 3WKJB 1EQZD 2CV5D 4M6BA 1KU5A 1KX4B 4KHAB 3VH5W 3MGQB 3MGRA 3W96C 2HUEB 5F99A 5CPIB 3A6NB 1P3LB 3W97B 3AZLC 3B0BA 1N1JA 3X1SA 3MGPB 4J8XB 1P3AD 4WV4B 4KGCB 3X1UD 5CPJD 3KSYA 2PYOA 1P3MD 3X1TA 3AZFA 5FUGB 2F8ND 3AV1C 2AROB 5GT0A 4G91C 1KX5C 5B0YD 4J8WD 3TU4D 1TZYB 4JJND 4Z66B 5GT3B 5B2JC 5B2ID 1P3GA 2F8NK 3KWQC 3O62B 1M1AD 5AV8D 4R8PA 5GSUD 3WA9A 3B0CT 4QLCC 5BS7C 1AOIB 5BO0B 1M18A 3AZGB 3B6GA 3AZKC 3AZMD 3LELB 3AFAA 1KX3A 3VH6W 4E45A 5AY8B 3W99A 5KDMB 1JFIA 3KXBC 1U35C 3LJAC 1HTAA 3AZJB 1EQZA 2CV5A 1ZLAD 5B1MB 1S32C 4YS3C 5B40D 4QLCD 5B33C 5JRGC 1P3BB 5C3IC 5BNVA 1BH8B 5B32G 3C1CD 1R4VA 3LZ0C 3REIC 3UTBA 3B6FB 3X1UA 5CPJA 1HQ3C 1P3MA 2F8NA 4ZBJC 5AV9B 3MGRC 5F99C 5B0YA 3LJAD 4J8WA 3TU4A 2FJ7D 4JJNA 5JA4B 1P3FB 4EO5B 1BFMA 4H9NB 3X1SC 1M1AA 5AV8A 3MGSB 5GSUA 3REJB 4UUZB 4XUJD 3W98B 1P3PD 2PYOC 3X1TC 4NE6A 3AZFC 1ULYA 5GT0C 5CP6B 5AVBD 3AZHB 1P3OB 1P3GC 1ID3D 5G49B 5B32B 5DNNB 3WA9C 4R8PC 5BT1C 5B24D 3NQUB 1P3IB 4DRBA 1M18C 3B6GC 2HIOD 5AV5B 2F8NH 3WAAB 5CPKD 2IO5B 3AYWB 3AFAC 1ZLAA 1KX3C 3AV2B 4XZQB 4H9RA 3RELB 3W99C 3WTPB 4QLCA 5B40A 5GT3D 5AV6D 1TAFA 4J8VD 3C1CA 1P3KD 4CSRA 3W96B 4WNNB 1EQZC 2CV5C 3AZLB 2FJ7A 3LJAA 3AV1B 3AZND 4XUJA 1P3AC 4G91B 3X1UC 1KX5B 5CPJC 1P3PA 4G92C 1P3MC 5B2JB 3KWQB 4X23D 5B0YC 4J8WC 3TU4C 5AVBA 4JJNC 1ID3A 5B2IC 1M19D 4LD9D 1M1AC 5AV8C 5GSUC 5B24A 3AZKB 4WU8D 4H9PA 1P3BD 1HQ3A 1F66D 2RVQD 4Z5TD 4WZSB 5AVCD 3C1BD 2HIOA 4DRAA 3AZID 3AZMC 3KXBB 5CPKA 1U35B 3REKB 5DNMC 2YFVB 3UTAB 1Q9CA 5GT3A 5AV6A 4J8VA 1S32B 4YS3B 2NQBD 1P3KA 3W98D 5GXQD 5B33B 1P34D 5JRGB 5C3IB 1ZLAC 3V9RB 4KUDD 5B40C 3REIB 4E44A 3AZNA 1B67A 3C1CC 3MGRB 5F99B 5DNMD 3MVDD 4ZUXC 3LZ1D 1N1JB 3X1SB 3AN2D 4X23A 2NZDD 3UT9D 2FJ7C 5E5AD 2PYOB 3X1TB 3AZFB 3AZED 1M19A 4LD9A 4WU8A 5GT0B 4XUJC 1F66A 4WU9D 1P3PC 4Z5TA 3KUYD 4J8XC 5AVCA 1P3GB 3X1VD 3C1BA 5BNXA 3WA9B 4R8PB 3AZIA 4NE3A 5AVBC 1ID3C 4YM6D 4J8UD 5B31D 1M18B 3B6GB 3REHD 1P3AA 5B24C 4ZUXD 3AFAB 1KX3B 2F8NG 2HIOC 4NFTA 2NQBA 3W99B 5GXQA 1P34A 1JFIB 5B2IA 5CPKC 1H3OA 5B0ZD 2AROC 1WWSA 5B1LD 4CAYA 4KUDA 5GT3C 2BYKA 1EQZB 2CV5B 5AV6C 4J8VC 2YFWA 3WKJD 4H9QA 3AZMA 1P3KC 5DNMA 3MVDA 1KX4D 4HGAB 5BNVB 3LZ1A 3MGQD 3MNNB 1P3LD 5CPID 3W97D 3A6ND 3AN2A 3VH6A 2NZDA 3UT9A 3REKD 3UTBB 5E5AA 3X1UB 5CPJB 3MGPD 4G92B 4H9OA 1P3MB 2F8NB 4J8XD 3UTAD 3AZEA 4KGCD 3AZNC 5B0YB 4J8WB 3TU4B 4WU9A 3KUYA 4JJNB 2AROD 3X1VA 3R45A 3B0CW 1M1AB 1TZYD 5AV8B 5GSUB 4Z66D 4X23C 3O62D 4YM6A 4J8UA 5B31A 1M19C 4LD9C 3REHA 4WU8C 1P3BC 1AOID 1F66C 4ZUXA 2RVQC 3B0DC 4Z5TC 3AZGD 3NQJA 5AVCC 3C1BC 3LELD 3AZIC 5AY8D 5B0ZA 3VH6T 5B1LA 4Z2MH 4AWLC 2BYMA 1ZLAB 2CWEA 3AZJD 1BH9A 4NE5A 4H9RB 3WKJA 2NQBC 3W98C 5B40B 4QLCB 5GXQC 1P34C 1KX4A 5B1MD 4KHAA 3MGQA 1P3LA 4KUDC 1TAFB 3W97A 3A6NA 5CPIA 3C1CB 3REKA 4CSRB 3MGPA 2L5AA 4J8XA 3UTAA 3B6FD 4KGCA 5FUGA 2FJ7B 3LJAB 3MVDC 5AV9D 2AROA 3LZ1C 3AN2C 1TZYA 4Z66A 2NZDC 3UT9C 4XUJB 1P3FD 5E5AC 3O62A 1P3PB 3MGSD 4XZQC 3REJD 3AZEC 1AOIA 5BO0A 4WU9C 5AVBB 3KUYC 3AZGA 1ID3B 5CP6D 3X1VC 3LELA 3LZ0B 3AZHD 1P3OD 5B24B 4H9PB 1HQ3B 5AY8A 5B32D 5DNND 4YM6C 5B31C 4ZBJB 5KDMA 1B6WA 3MNND 4J8UC 3REHC 2HIOB 1P3ID 3UTBD 5CPKB 3AZJA 5AV5D 3WAAD 3AYWD 3AV2D 5B1MA 4XZQD 5B0ZC 3RELD 3WTPD 5B1LC 4H9SA 5AV6B 4J8VB 1P3BA 1P3KB 1BH8A 3B6FA 3W96D 3WKJC 3VH5A 3AZLD 1KX4C 5AV9A 3MGQC 1P3LC 2HUEC 5CPIC 3W97C 3A6NC 3AZNB 5JA4A 3REKC 1P3FA 4H9NA 3AV1D 3MGPC 3MGSA 3REJA 4UUZA 3UTAC 4KGCC
chains in the Genus database with same CATH superfamily
1KX5D 3W98A 2JSSA 4X23B 5B2JD 2Y2HA 3KWQD 5CP6A 1M19B 4LD9B 1TZYC 3AZHA 4Z66C 4WU8B 1P3OA 1F66B 5G49A 5B32A 3O62C 3B0DB 4Z5TB 5DNNA 3MNNA 5AVCB 3AZKD 3NQUA 2Y2LA 3C1BB 3WTPE 5BNXB 1P3IA 1AOIC 3AZIB 3AZGC 1F1EA 5CHLB 3VH5T 5AV5A 3WAAA 1W2EA 3KXBD 2LY8A 3LELC 3AYWA 1U35D 1P3AB 4AWLB 3AV2A 4XZQA 5AY8C 3RELA 4Z2MG 3WTPA 1WWIA 3EPJA 2Y2OA 2NQBB 2ZY3A 5GXQB 1P34B 5B2IB 1A7WA 1H3OB 3AZJC 4YS3D 1S32D 4CAYB 3W96A 5B33D 5JRGD 4WNNA 4KUDB 3AZLA 5B1MC 2BYKB 4H9SC 5B31G 3LZ0D 3REID 2YFWB 1HQ3D 4H9QB 3AZMB 3IP4C 5DNMB 3MVDB 3AV1A 2ZY4A 3B6FC 3LZ1B 3MGRD 1KX5A 5F99D 2JCHA 3AN2B 5B2JA 2NZDB 3UT9B 5E5AB 5AV9C 3KWQA 3X1SD 4H9OB 3AZEB 5BS7A 2PYOD 1P3FC 4EO5C 3X1TD 3AZFD 4WU9B 3MGSC 3KUYB 3AZKA 5GT0D 3REJC 3X1VB 3R45B 1P3GD 5CP6C 4YM6B 4J8UB 5B31B 5BT1D 4R8PD 3WA9D 3KXBA 1U35A 3REHB 3AZHC 1P3OC 4HGAC 2YFVA 4ZUXB 1M18D 5B32C 5DNNC 3MNNC 3B6GD 3NQJB 2Y2IA 1P3IC 3UTBC 3AFAD 1KX3D 5B0ZB 1S32A 4YS3A 3W99D 3WAAC 5AV5C 5B1LB 5B33A 5JRGA 2IO5C 3AYWC 3V9RA 3AV2C 2BYMB 3RELC 3WTPC 3LZ0A 3REIA 1BH9B 2Y2GA 3WKJB 1EQZD 2CV5D 4M6BA 1KU5A 1KX4B 4KHAB 3VH5W 2ZM5A 3MGQB 3MGRA 3W96C 2HUEB 5F99A 5CPIB 3A6NB 1P3LB 3W97B 3AZLC 3B0BA 1N1JA 3X1SA 3MGPB 4J8XB 1P3AD 4WV4B 4KGCB 3X1UD 5CPJD 3KSYA 2PYOA 1P3MD 3X1TA 3AZFA 5FUGB 2F8ND 3AV1C 3P5JB 2AROB 5GT0A 4G91C 1KX5C 5B0YD 4J8WD 3TU4D 1TZYB 4JJND 4Z66B 5GT3B 5B2JC 5B2ID 1P3GA 2F8NK 3KWQC 3O62B 3H0RC 1M1AD 5AV8D 4R8PA 5GSUD 3WA9A 3B0CT 4QLCC 5BS7C 1AOIB 5BO0B 2DF4C 2Y2JA 1M18A 3AZGB 3B6GA 2F2AC 3AZKC 2W8SA 3AZMD 3LELB 3AFAA 1KX3A 3VH6W 4E45A 1T3UA 5AY8B 3W99A 5KDMB 1JFIA 3KXBC 2G5IC 1U35C 3LJAC 1HTAA 3EPLA 2ZY5A 3H0MC 3AZJB 1EQZA 2CV5A 1ZLAD 5B1MB 1S32C 4YS3C 5B40D 4QLCD 5B33C 5JRGC 1P3BB 5C3IC 5BNVA 1BH8B 5B32G 3C1CD 1R4VA 3LZ0C 3REIC 3UTBA 3B6FB 3X1UA 5CPJA 1HQ3C 1P3MA 2F8NA 4ZBJC 5AV9B 2XD1A 3MGRC 5F99C 5B0YA 3LJAD 4J8WA 3TU4A 2FJ7D 4JJNA 5JA4B 1P3FB 4EO5B 1BFMA 4H9NB 3X1SC 1M1AA 5AV8A 3MGSB 5GSUA 3REJB 4UUZB 4XUJD 3W98B 1P3PD 2PYOC 3X1TC 4NE6A 3AZFC 2Y2PA 1ULYA 3A1KA 5GT0C 5CP6B 5AVBD 3AZHB 1P3OB 1P3GC 1ID3D 3EPHA 5G49B 5B32B 5DNNB 3WA9C 4R8PC 5BT1C 5B24D 3NQUB 1P3IB 4DRBA 1M18C 3B6GC 2HIOD 5AV5B 2F8NH 3WAAB 5CPKD 2IO5B 3AYWB 3AFAC 1ZLAA 2Y2NA 1KX3C 3AV2B 4XZQB 4H9RA 3RELB 3W99C 3WTPB 4QLCA 5B40A 5GT3D 5AV6D 1TAFA 4J8VD 3UTAC 3C1CA 1P3KD 4CSRA 3W96B 4WNNB 1EQZC 2CV5C 3AZLB 2FJ7A 3LJAA 3AV1B 3AZND 4XUJA 1P3AC 4G91B 3X1UC 1KX5B 5CPJC 1P3PA 4G92C 1P3MC 5B2JB 3KWQB 4X23D 5B0YC 4J8WC 3TU4C 5AVBA 4JJNC 1ID3A 5B2IC 1M19D 4LD9D 2G5HC 5AV8C 1M1AC 5GSUC 5B24A 3AZKB 4WU8D 4H9PA 1P3BD 1HQ3A 1F66D 2RVQD 2Y2QA 4Z5TD 4WZSB 5AVCD 3C1BD 2HIOA 4DRAA 3EPKA 3AZID 1Z2CB 3AZMC 3KXBB 5CPKA 2Y2MA 1U35B 3REKB 5DNMC 2YFVB 2Y2KA 3UTAB 2DQNC 1Q9CA 5GT3A 5AV6A 4J8VA 3F6TA 3FDDA 1S32B 4YS3B 2NQBD 1P3KA 3W98D 5GXQD 5B33B 1P34D 5JRGB 5C3IB 1ZLAC 3V9RB 4KUDD 5B40C 2VQRA 3REIB 2XD5A 4E44A 3AZNA 1B67A 3C1CC 3MGRB 5F99B 5DNMD 3MVDD 4ZUXC 3LZ1D 1N1JB 3X1SB 3AN2D 4X23A 2NZDD 3UT9D 2FJ7C 5E5AD 2PYOB 3X1TB 3AZFB 3AZED 1M19A 4LD9A 4WU8A 5GT0B 4XUJC 1F66A 4WU9D 1P3PC 4Z5TA 3KUYD 4J8XC 5AVCA 1P3GB 3X1VD 3C1BA 4WJ3C 5BNXA 3WA9B 4R8PB 3AZIA 4NE3A 5AVBC 1ID3C 4UPKA 3AL0C 4YM6D 4J8UD 5B31D 2ZY2A 1M18B 3B6GB 3REHD 1P3AA 5B24C 4ZUXD 3AFAB 1KX3B 2F8NG 2HIOC 2JE5A 4NFTA 2NQBA 3W99B 5GXQA 1P34A 1JFIB 5B2IA 5CPKC 1H3OA 5B0ZD 2AROC 1WWSA 5B1LD 4CAYA 4KUDA 5GT3C 2BYKA 1EQZB 2CV5B 5AV6C 4J8VC 2UWXA 2YFWA 3WKJD 4H9QA 3AZMA 1P3KC 2FFFB 5DNMA 3MVDA 1KX4D 4HGAB 5BNVB 3LZ1A 3MGQD 3MNNB 1P3LD 5CPID 3W97D 3A6ND 3AN2A 3VH6A 2NZDA 3UT9A 3REKD 3UTBB 5E5AA 3X1UB 5CPJB 3MGPD 4G92B 4H9OA 1P3MB 2F8NB 4J8XD 3UTAD 3AZEA 4KGCD 3AZNC 5B0YB 4J8WB 3TU4B 4WU9A 3KUYA 4JJNB 2AROD 3X1VA 3R45A 3B0CW 1M1AB 1TZYD 5AV8B 5GSUB 4Z66D 2BG1A 4X23C 3O62D 4YM6A 4J8UA 5B31A 1M19C 4LD9C 3REHA 4WU8C 1P3BC 1AOID 1F66C 4ZUXA 1PZRA 2RVQC 3B0DC 4Z5TC 3AZGD 3NQJA 5AVCC 3EG5B 3C1BC 3LELD 3AZIC 5AY8D 5B0ZA 3VH6T 5B1LA 4Z2MH 4AWLC 2BYMA 1ZLAB 2CWEA 3AZJD 1BH9A 4NE5A 4H9RB 3WKJA 2NQBC 3W98C 5B40B 4QLCB 5GXQC 1P34C 1KX4A 5B1MD 4KHAA 3MGQA 1P3LA 4KUDC 1TAFB 3W97A 3A6NA 5CPIA 3C1CB 3REKA 4CSRB 3MGPA 2L5AA 4J8XA 3UTAA 3B6FD 4KGCA 5FUGA 2FJ7B 3LJAB 3MVDC 5AV9D 2AROA 3LZ1C 3AN2C 1TZYA 4Z66A 2NZDC 3UT9C 4XUJB 1P3FD 5E5AC 3O62A 1P3PB 3MGSD 4XZQC 3REJD 3AZEC 1AOIA 5BO0A 4WU9C 3KFUG 5AVBB 3KUYC 3AZGA 1ID3B 5CP6D 3X1VC 3LELA 3LZ0B 3AZHD 1P3OD 5B24B 4H9PB 1HQ3B 5AY8A 5B32D 5DNND 4YM6C 5B31C 4ZBJB 5KDMA 1B6WA 3MNND 4J8UC 3REHC 2HIOB 1P3ID 3UTBD 5CPKB 3AZJA 5AV5D 3WAAD 2J8PA 3AYWD 3H0LC 3AV2D 5B1MA 4XZQD 5B0ZC 3RELD 3WTPD 5B1LC 4H9SA 5AV6B 4J8VB 1P3BA 1P3KB 1BH8A 3B6FA 3W96D 3WKJC 3VH5A 3AZLD 1KX4C 5AV9A 4DQYB 3MGQC 1P3LC 2HUEC 5CPIC 3W97C 3A6NC 3AZNB 5JA4A 3REKC 1P3FA 3A1IA 4H9NA 3AV1D 3MGPC 3MGSA 3REJA 4UUZA 2RIQA 4KGCC
chains in the Genus database with same CATH topology
1KX5D 3W98A 2JSSA 4X23B 5B2JD 2Y2HA 3KWQD 5CP6A 1M19B 4LD9B 1TZYC 3AZHA 4Z66C 4WU8B 1P3OA 1F66B 5G49A 5B32A 3O62C 3B0DB 4Z5TB 5DNNA 3MNNA 5AVCB 3AZKD 3NQUA 2Y2LA 3C1BB 3WTPE 5BNXB 1P3IA 1AOIC 3AZIB 3AZGC 1F1EA 5CHLB 3VH5T 5AV5A 3WAAA 1W2EA 3KXBD 2LY8A 3LELC 3AYWA 1U35D 1P3AB 4AWLB 3AV2A 4XZQA 5AY8C 3RELA 4Z2MG 3WTPA 1WWIA 3EPJA 2Y2OA 2NQBB 2ZY3A 5GXQB 1P34B 5B2IB 1A7WA 1H3OB 3AZJC 4YS3D 1S32D 4CAYB 3W96A 5B33D 5JRGD 4WNNA 4KUDB 3AZLA 5B1MC 2BYKB 4H9SC 5B31G 3LZ0D 3REID 2YFWB 1HQ3D 4H9QB 3AZMB 3IP4C 5DNMB 3MVDB 3AV1A 2ZY4A 3B6FC 3LZ1B 3MGRD 1KX5A 5F99D 2JCHA 3AN2B 5B2JA 2NZDB 3UT9B 5E5AB 5AV9C 3KWQA 3X1SD 4H9OB 3AZEB 5BS7A 2PYOD 1P3FC 4EO5C 3X1TD 3AZFD 4WU9B 3MGSC 3KUYB 3AZKA 5GT0D 3REJC 3X1VB 3R45B 1P3GD 5CP6C 4YM6B 4J8UB 5B31B 5BT1D 4R8PD 3WA9D 3KXBA 1U35A 3REHB 3AZHC 1P3OC 4HGAC 2YFVA 4ZUXB 1M18D 5B32C 5DNNC 3MNNC 3B6GD 3NQJB 2Y2IA 1P3IC 3UTBC 3AFAD 1KX3D 5B0ZB 1S32A 4YS3A 3W99D 3WAAC 5AV5C 5B1LB 5B33A 5JRGA 2IO5C 3AYWC 3V9RA 3AV2C 2BYMB 3RELC 3WTPC 3LZ0A 3REIA 1BH9B 2Y2GA 3WKJB 1EQZD 2CV5D 4M6BA 1KU5A 1KX4B 4KHAB 3VH5W 2ZM5A 3MGQB 3MGRA 3W96C 2HUEB 5F99A 5CPIB 3A6NB 1P3LB 3W97B 3AZLC 3B0BA 1N1JA 3X1SA 3MGPB 4J8XB 1P3AD 4WV4B 4KGCB 3X1UD 5CPJD 3KSYA 2PYOA 1P3MD 3X1TA 3AZFA 5FUGB 2F8ND 3AV1C 3P5JB 2AROB 5GT0A 4G91C 1KX5C 5B0YD 4J8WD 3TU4D 1TZYB 4JJND 4Z66B 5GT3B 5B2JC 5B2ID 1P3GA 2F8NK 3KWQC 3O62B 3H0RC 1M1AD 5AV8D 4R8PA 5GSUD 3WA9A 3B0CT 4QLCC 5BS7C 1AOIB 5BO0B 2DF4C 2Y2JA 1M18A 3AZGB 3B6GA 2F2AC 3AZKC 2W8SA 3AZMD 3LELB 3AFAA 1KX3A 3VH6W 4E45A 1T3UA 5AY8B 3W99A 5KDMB 1JFIA 3KXBC 2G5IC 1U35C 3LJAC 1HTAA 3EPLA 2ZY5A 3H0MC 3AZJB 1EQZA 2CV5A 1ZLAD 5B1MB 1S32C 4YS3C 5B40D 4QLCD 5B33C 5JRGC 1P3BB 5C3IC 5BNVA 1BH8B 5B32G 3C1CD 1R4VA 3LZ0C 3REIC 3UTBA 3B6FB 3X1UA 5CPJA 1HQ3C 1P3MA 2F8NA 4ZBJC 5AV9B 2XD1A 3MGRC 5F99C 5B0YA 3LJAD 4J8WA 3TU4A 2FJ7D 4JJNA 5JA4B 1P3FB 4EO5B 1BFMA 4H9NB 3X1SC 1M1AA 5AV8A 3MGSB 5GSUA 3REJB 4UUZB 4XUJD 3W98B 1P3PD 2PYOC 3X1TC 4NE6A 3AZFC 2Y2PA 1ULYA 3A1KA 5GT0C 5CP6B 5AVBD 3AZHB 1P3OB 1P3GC 1ID3D 3EPHA 5G49B 5B32B 5DNNB 3WA9C 4R8PC 5BT1C 5B24D 3NQUB 1P3IB 4DRBA 1M18C 3B6GC 2HIOD 5AV5B 2F8NH 3WAAB 5CPKD 2IO5B 3AYWB 3AFAC 1ZLAA 2Y2NA 1KX3C 3AV2B 4XZQB 4H9RA 3RELB 3W99C 3WTPB 4QLCA 5B40A 5GT3D 5AV6D 1TAFA 4J8VD 3UTAC 3C1CA 1P3KD 4CSRA 3W96B 4WNNB 1EQZC 2CV5C 3AZLB 2FJ7A 3LJAA 3AV1B 3AZND 4XUJA 1P3AC 4G91B 3X1UC 1KX5B 5CPJC 1P3PA 4G92C 1P3MC 5B2JB 3KWQB 4X23D 5B0YC 4J8WC 3TU4C 5AVBA 4JJNC 1ID3A 5B2IC 1M19D 4LD9D 2G5HC 5AV8C 1M1AC 5GSUC 5B24A 3AZKB 4WU8D 4H9PA 1P3BD 1HQ3A 1F66D 2RVQD 2Y2QA 4Z5TD 4WZSB 5AVCD 3C1BD 2HIOA 4DRAA 3EPKA 3AZID 1Z2CB 3AZMC 3KXBB 5CPKA 2Y2MA 1U35B 3REKB 5DNMC 2YFVB 2Y2KA 3UTAB 2DQNC 1Q9CA 5GT3A 5AV6A 4J8VA 3F6TA 3FDDA 1S32B 4YS3B 2NQBD 1P3KA 3W98D 5GXQD 5B33B 1P34D 5JRGB 5C3IB 1ZLAC 3V9RB 4KUDD 5B40C 2VQRA 3REIB 2XD5A 4E44A 3AZNA 1B67A 3C1CC 3MGRB 5F99B 5DNMD 3MVDD 4ZUXC 3LZ1D 1N1JB 3X1SB 3AN2D 4X23A 2NZDD 3UT9D 2FJ7C 5E5AD 2PYOB 3X1TB 3AZFB 3AZED 1M19A 4LD9A 4WU8A 5GT0B 4XUJC 1F66A 4WU9D 1P3PC 4Z5TA 3KUYD 4J8XC 5AVCA 1P3GB 3X1VD 3C1BA 4WJ3C 5BNXA 3WA9B 4R8PB 3AZIA 4NE3A 5AVBC 1ID3C 4UPKA 3AL0C 4YM6D 4J8UD 5B31D 2ZY2A 1M18B 3B6GB 3REHD 1P3AA 5B24C 4ZUXD 3AFAB 1KX3B 2F8NG 2HIOC 2JE5A 4NFTA 2NQBA 3W99B 5GXQA 1P34A 1JFIB 5B2IA 5CPKC 1H3OA 5B0ZD 2AROC 1WWSA 5B1LD 4CAYA 4KUDA 5GT3C 2BYKA 1EQZB 2CV5B 5AV6C 4J8VC 2UWXA 2YFWA 3WKJD 4H9QA 3AZMA 1P3KC 2FFFB 5DNMA 3MVDA 1KX4D 4HGAB 5BNVB 3LZ1A 3MGQD 3MNNB 1P3LD 5CPID 3W97D 3A6ND 3AN2A 3VH6A 2NZDA 3UT9A 3REKD 3UTBB 5E5AA 3X1UB 5CPJB 3MGPD 4G92B 4H9OA 1P3MB 2F8NB 4J8XD 3UTAD 3AZEA 4KGCD 3AZNC 5B0YB 4J8WB 3TU4B 4WU9A 3KUYA 4JJNB 2AROD 3X1VA 3R45A 3B0CW 1M1AB 1TZYD 5AV8B 5GSUB 4Z66D 2BG1A 4X23C 3O62D 4YM6A 4J8UA 5B31A 1M19C 4LD9C 3REHA 4WU8C 1P3BC 1AOID 1F66C 4ZUXA 1PZRA 2RVQC 3B0DC 4Z5TC 3AZGD 3NQJA 5AVCC 3EG5B 3C1BC 3LELD 3AZIC 5AY8D 5B0ZA 3VH6T 5B1LA 4Z2MH 4AWLC 2BYMA 1ZLAB 2CWEA 3AZJD 1BH9A 4NE5A 4H9RB 3WKJA 2NQBC 3W98C 5B40B 4QLCB 5GXQC 1P34C 1KX4A 5B1MD 4KHAA 3MGQA 1P3LA 4KUDC 1TAFB 3W97A 3A6NA 5CPIA 3C1CB 3REKA 4CSRB 3MGPA 2L5AA 4J8XA 3UTAA 3B6FD 4KGCA 5FUGA 2FJ7B 3LJAB 3MVDC 5AV9D 2AROA 3LZ1C 3AN2C 1TZYA 4Z66A 2NZDC 3UT9C 4XUJB 1P3FD 5E5AC 3O62A 1P3PB 3MGSD 4XZQC 3REJD 3AZEC 1AOIA 5BO0A 4WU9C 3KFUG 5AVBB 3KUYC 3AZGA 1ID3B 5CP6D 3X1VC 3LELA 3LZ0B 3AZHD 1P3OD 5B24B 4H9PB 1HQ3B 5AY8A 5B32D 5DNND 4YM6C 5B31C 4ZBJB 5KDMA 1B6WA 3MNND 4J8UC 3REHC 2HIOB 1P3ID 3UTBD 5CPKB 3AZJA 5AV5D 3WAAD 2J8PA 3AYWD 3H0LC 3AV2D 5B1MA 4XZQD 5B0ZC 3RELD 3WTPD 5B1LC 4H9SA 5AV6B 4J8VB 1P3BA 1P3KB 1BH8A 3B6FA 3W96D 3WKJC 3VH5A 3AZLD 1KX4C 5AV9A 4DQYB 3MGQC 1P3LC 2HUEC 5CPIC 3W97C 3A6NC 3AZNB 5JA4A 3REKC 1P3FA 3A1IA 4H9NA 3AV1D 3MGPC 3MGSA 3REJA 4UUZA 2RIQA 4KGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX5 D;  3W98 A;  2JSS A;  4X23 B;  5B2J D;  3KWQ D;  5CP6 A;  1M19 B;  4LD9 B;  1TZY C;  3AZH A;  4Z66 C;  4WU8 B;  1P3O A;  1F66 B;  5G49 A;  5B32 A;  3O62 C;  3B0D B;  4Z5T B;  5DNN A;  3MNN A;  5AVC B;  3AZK D;  3NQU A;  3C1B B;  3WTP E;  5BNX B;  1P3I A;  1AOI C;  3AZI B;  3AZG C;  1F1E A;  5CHL B;  3VH5 T;  5AV5 A;  3WAA A;  3KXB D;  2LY8 A;  3LEL C;  3AYW A;  1U35 D;  1P3A B;  4AWL B;  3AV2 A;  4XZQ A;  5AY8 C;  3REL A;  4Z2M G;  3WTP A;  1WWI A;  2NQB B;  5GXQ B;  1P34 B;  5B2I B;  1A7W A;  1H3O B;  3AZJ C;  4YS3 D;  1S32 D;  4CAY B;  3W96 A;  5B33 D;  5JRG D;  4WNN A;  4KUD B;  3AZL A;  5B1M C;  2BYK B;  4H9S C;  5B31 G;  3LZ0 D;  3REI D;  2YFW B;  4H9Q B;  1HQ3 D;  3AZM B;  5DNM B;  3AV1 A;  3MVD B;  3B6F C;  3LZ1 B;  3MGR D;  1KX5 A;  5F99 D;  3AN2 B;  5B2J A;  2NZD B;  3UT9 B;  5E5A B;  5AV9 C;  3KWQ A;  3X1S D;  4H9O B;  3AZE B;  5BS7 A;  2PYO D;  1P3F C;  4EO5 C;  3X1T D;  3AZF D;  4WU9 B;  3MGS C;  3KUY B;  3AZK A;  5GT0 D;  3REJ C;  3X1V B;  3R45 B;  1P3G D;  5CP6 C;  4YM6 B;  4J8U B;  5B31 B;  5BT1 D;  4R8P D;  3WA9 D;  3KXB A;  1U35 A;  3REH B;  3AZH C;  1P3O C;  4HGA C;  2YFV A;  4ZUX B;  1M18 D;  5B32 C;  5DNN C;  3MNN C;  3B6G D;  3NQJ B;  1P3I C;  3UTB C;  3AFA D;  1KX3 D;  5B0Z B;  1S32 A;  4YS3 A;  3W99 D;  3WAA C;  5AV5 C;  5B1L B;  5B33 A;  5JRG A;  2IO5 C;  3AYW C;  3V9R A;  3AV2 C;  2BYM B;  3REL C;  3WTP C;  3LZ0 A;  3REI A;  1BH9 B;  3WKJ B;  1EQZ D;  2CV5 D;  4M6B A;  1KU5 A;  1KX4 B;  4KHA B;  3VH5 W;  3MGQ B;  3MGR A;  3W96 C;  2HUE B;  5F99 A;  5CPI B;  3A6N B;  1P3L B;  3W97 B;  3AZL C;  3B0B A;  1N1J A;  3X1S A;  3MGP B;  4J8X B;  1P3A D;  4WV4 B;  4KGC B;  3X1U D;  5CPJ D;  3KSY A;  2PYO A;  1P3M D;  3X1T A;  3AZF A;  5FUG B;  2F8N D;  3AV1 C;  2ARO B;  5GT0 A;  4G91 C;  1KX5 C;  5B0Y D;  4J8W D;  3TU4 D;  1TZY B;  4JJN D;  4Z66 B;  5GT3 B;  5B2J C;  5B2I D;  1P3G A;  2F8N K;  3KWQ C;  3O62 B;  1M1A D;  5AV8 D;  4R8P A;  5GSU D;  3WA9 A;  3B0C T;  4QLC C;  5BS7 C;  1AOI B;  5BO0 B;  1M18 A;  3AZG B;  3B6G A;  3AZK C;  3AZM D;  3LEL B;  3AFA A;  1KX3 A;  3VH6 W;  4E45 A;  5AY8 B;  3W99 A;  5KDM B;  1JFI A;  3KXB C;  1U35 C;  3LJA C;  1HTA A;  3AZJ B;  1EQZ A;  2CV5 A;  1ZLA D;  5B1M B;  1S32 C;  4YS3 C;  5B40 D;  4QLC D;  5B33 C;  5JRG C;  1P3B B;  5C3I C;  5BNV A;  1BH8 B;  5B32 G;  3C1C D;  1R4V A;  3LZ0 C;  3REI C;  3UTB A;  3B6F B;  3X1U A;  5CPJ A;  1HQ3 C;  1P3M A;  2F8N A;  4ZBJ C;  5AV9 B;  3MGR C;  5F99 C;  5B0Y A;  3LJA D;  4J8W A;  3TU4 A;  2FJ7 D;  4JJN A;  5JA4 B;  1P3F B;  4EO5 B;  1BFM A;  4H9N B;  3X1S C;  1M1A A;  5AV8 A;  3MGS B;  5GSU A;  3REJ B;  4UUZ B;  4XUJ D;  3W98 B;  1P3P D;  2PYO C;  3X1T C;  4NE6 A;  3AZF C;  1ULY A;  5GT0 C;  5CP6 B;  5AVB D;  3AZH B;  1P3O B;  1P3G C;  1ID3 D;  5G49 B;  5B32 B;  5DNN B;  3WA9 C;  4R8P C;  5BT1 C;  5B24 D;  3NQU B;  1P3I B;  4DRB A;  1M18 C;  3B6G C;  2HIO D;  5AV5 B;  2F8N H;  3WAA B;  5CPK D;  2IO5 B;  3AYW B;  3AFA C;  1ZLA A;  1KX3 C;  3AV2 B;  4XZQ B;  4H9R A;  3REL B;  3W99 C;  3WTP B;  4QLC A;  5B40 A;  5GT3 D;  5AV6 D;  1TAF A;  4J8V D;  3C1C A;  1P3K D;  4CSR A;  3W96 B;  4WNN B;  1EQZ C;  2CV5 C;  3AZL B;  2FJ7 A;  3LJA A;  3AV1 B;  3AZN D;  4XUJ A;  1P3A C;  4G91 B;  3X1U C;  1KX5 B;  5CPJ C;  1P3P A;  4G92 C;  1P3M C;  5B2J B;  3KWQ B;  4X23 D;  5B0Y C;  4J8W C;  3TU4 C;  5AVB A;  4JJN C;  1ID3 A;  5B2I C;  1M19 D;  4LD9 D;  1M1A C;  5AV8 C;  5GSU C;  5B24 A;  3AZK B;  4WU8 D;  4H9P A;  1P3B D;  1HQ3 A;  1F66 D;  2RVQ D;  4Z5T D;  4WZS B;  5AVC D;  3C1B D;  2HIO A;  4DRA A;  3AZI D;  3AZM C;  3KXB B;  5CPK A;  1U35 B;  3REK B;  5DNM C;  2YFV B;  3UTA B;  1Q9C A;  5GT3 A;  5AV6 A;  4J8V A;  1S32 B;  4YS3 B;  2NQB D;  1P3K A;  3W98 D;  5GXQ D;  5B33 B;  1P34 D;  5JRG B;  5C3I B;  1ZLA C;  3V9R B;  4KUD D;  5B40 C;  3REI B;  4E44 A;  3AZN A;  1B67 A;  3C1C C;  3MGR B;  5F99 B;  5DNM D;  3MVD D;  4ZUX C;  3LZ1 D;  1N1J B;  3X1S B;  3AN2 D;  4X23 A;  2NZD D;  3UT9 D;  2FJ7 C;  5E5A D;  2PYO B;  3X1T B;  3AZF B;  3AZE D;  1M19 A;  4LD9 A;  4WU8 A;  5GT0 B;  4XUJ C;  1F66 A;  4WU9 D;  1P3P C;  4Z5T A;  3KUY D;  4J8X C;  5AVC A;  1P3G B;  3X1V D;  3C1B A;  5BNX A;  3WA9 B;  4R8P B;  3AZI A;  4NE3 A;  5AVB C;  1ID3 C;  4YM6 D;  4J8U D;  5B31 D;  1M18 B;  3B6G B;  3REH D;  1P3A A;  5B24 C;  4ZUX D;  3AFA B;  1KX3 B;  2F8N G;  2HIO C;  4NFT A;  2NQB A;  3W99 B;  5GXQ A;  1P34 A;  1JFI B;  5B2I A;  5CPK C;  1H3O A;  5B0Z D;  2ARO C;  1WWS A;  5B1L D;  4CAY A;  4KUD A;  5GT3 C;  2BYK A;  1EQZ B;  2CV5 B;  5AV6 C;  4J8V C;  2YFW A;  3WKJ D;  4H9Q A;  3AZM A;  1P3K C;  5DNM A;  3MVD A;  1KX4 D;  4HGA B;  5BNV B;  3LZ1 A;  3MGQ D;  3MNN B;  1P3L D;  5CPI D;  3W97 D;  3A6N D;  3AN2 A;  3VH6 A;  2NZD A;  3UT9 A;  3REK D;  3UTB B;  5E5A A;  3X1U B;  5CPJ B;  3MGP D;  4G92 B;  4H9O A;  1P3M B;  2F8N B;  4J8X D;  3UTA D;  3AZE A;  4KGC D;  3AZN C;  5B0Y B;  4J8W B;  3TU4 B;  4WU9 A;  3KUY A;  4JJN B;  2ARO D;  3X1V A;  3R45 A;  3B0C W;  1M1A B;  1TZY D;  5AV8 B;  5GSU B;  4Z66 D;  4X23 C;  3O62 D;  4YM6 A;  4J8U A;  5B31 A;  1M19 C;  4LD9 C;  3REH A;  4WU8 C;  1P3B C;  1AOI D;  1F66 C;  4ZUX A;  2RVQ C;  3B0D C;  4Z5T C;  3AZG D;  3NQJ A;  5AVC C;  3C1B C;  3LEL D;  3AZI C;  5AY8 D;  5B0Z A;  3VH6 T;  5B1L A;  4Z2M H;  4AWL C;  2BYM A;  1ZLA B;  2CWE A;  3AZJ D;  1BH9 A;  4NE5 A;  4H9R B;  3WKJ A;  2NQB C;  3W98 C;  5B40 B;  4QLC B;  5GXQ C;  1P34 C;  1KX4 A;  5B1M D;  4KHA A;  3MGQ A;  1P3L A;  4KUD C;  1TAF B;  3W97 A;  3A6N A;  5CPI A;  3C1C B;  3REK A;  4CSR B;  3MGP A;  2L5A A;  4J8X A;  3UTA A;  3B6F D;  4KGC A;  5FUG A;  2FJ7 B;  3LJA B;  3MVD C;  5AV9 D;  2ARO A;  3LZ1 C;  3AN2 C;  1TZY A;  4Z66 A;  2NZD C;  3UT9 C;  4XUJ B;  1P3F D;  5E5A C;  3O62 A;  1P3P B;  3MGS D;  4XZQ C;  3REJ D;  3AZE C;  1AOI A;  5BO0 A;  4WU9 C;  5AVB B;  3KUY C;  3AZG A;  1ID3 B;  5CP6 D;  3X1V C;  3LEL A;  3LZ0 B;  3AZH D;  1P3O D;  5B24 B;  4H9P B;  1HQ3 B;  5AY8 A;  5B32 D;  5DNN D;  4YM6 C;  5B31 C;  4ZBJ B;  5KDM A;  1B6W A;  3MNN D;  4J8U C;  3REH C;  2HIO B;  1P3I D;  3UTB D;  5CPK B;  3AZJ A;  5AV5 D;  3WAA D;  3AYW D;  3AV2 D;  5B1M A;  4XZQ D;  5B0Z C;  3REL D;  3WTP D;  5B1L C;  4H9S A;  5AV6 B;  4J8V B;  1P3B A;  1P3K B;  1BH8 A;  3B6F A;  3W96 D;  3WKJ C;  3VH5 A;  3AZL D;  1KX4 C;  5AV9 A;  3MGQ C;  1P3L C;  2HUE C;  5CPI C;  3W97 C;  3A6N C;  3AZN B;  5JA4 A;  3REK C;  1P3F A;  4H9N A;  3AV1 D;  3MGP C;  3MGS A;  3REJ A;  4UUZ A;  3UTA C;  4KGC C; 
#chains in the Genus database with same CATH topology
 1KX5 D;  3W98 A;  2JSS A;  4X23 B;  5B2J D;  2Y2H A;  3KWQ D;  5CP6 A;  1M19 B;  4LD9 B;  1TZY C;  3AZH A;  4Z66 C;  4WU8 B;  1P3O A;  1F66 B;  5G49 A;  5B32 A;  3O62 C;  3B0D B;  4Z5T B;  5DNN A;  3MNN A;  5AVC B;  3AZK D;  3NQU A;  2Y2L A;  3C1B B;  3WTP E;  5BNX B;  1P3I A;  1AOI C;  3AZI B;  3AZG C;  1F1E A;  5CHL B;  3VH5 T;  5AV5 A;  3WAA A;  1W2E A;  3KXB D;  2LY8 A;  3LEL C;  3AYW A;  1U35 D;  1P3A B;  4AWL B;  3AV2 A;  4XZQ A;  5AY8 C;  3REL A;  4Z2M G;  3WTP A;  1WWI A;  3EPJ A;  2Y2O A;  2NQB B;  2ZY3 A;  5GXQ B;  1P34 B;  5B2I B;  1A7W A;  1H3O B;  3AZJ C;  4YS3 D;  1S32 D;  4CAY B;  3W96 A;  5B33 D;  5JRG D;  4WNN A;  4KUD B;  3AZL A;  5B1M C;  2BYK B;  4H9S C;  5B31 G;  3LZ0 D;  3REI D;  2YFW B;  1HQ3 D;  4H9Q B;  3AZM B;  3IP4 C;  5DNM B;  3MVD B;  3AV1 A;  2ZY4 A;  3B6F C;  3LZ1 B;  3MGR D;  1KX5 A;  5F99 D;  2JCH A;  3AN2 B;  5B2J A;  2NZD B;  3UT9 B;  5E5A B;  5AV9 C;  3KWQ A;  3X1S D;  4H9O B;  3AZE B;  5BS7 A;  2PYO D;  1P3F C;  4EO5 C;  3X1T D;  3AZF D;  4WU9 B;  3MGS C;  3KUY B;  3AZK A;  5GT0 D;  3REJ C;  3X1V B;  3R45 B;  1P3G D;  5CP6 C;  4YM6 B;  4J8U B;  5B31 B;  5BT1 D;  4R8P D;  3WA9 D;  3KXB A;  1U35 A;  3REH B;  3AZH C;  1P3O C;  4HGA C;  2YFV A;  4ZUX B;  1M18 D;  5B32 C;  5DNN C;  3MNN C;  3B6G D;  3NQJ B;  2Y2I A;  1P3I C;  3UTB C;  3AFA D;  1KX3 D;  5B0Z B;  1S32 A;  4YS3 A;  3W99 D;  3WAA C;  5AV5 C;  5B1L B;  5B33 A;  5JRG A;  2IO5 C;  3AYW C;  3V9R A;  3AV2 C;  2BYM B;  3REL C;  3WTP C;  3LZ0 A;  3REI A;  1BH9 B;  2Y2G A;  3WKJ B;  1EQZ D;  2CV5 D;  4M6B A;  1KU5 A;  1KX4 B;  4KHA B;  3VH5 W;  2ZM5 A;  3MGQ B;  3MGR A;  3W96 C;  2HUE B;  5F99 A;  5CPI B;  3A6N B;  1P3L B;  3W97 B;  3AZL C;  3B0B A;  1N1J A;  3X1S A;  3MGP B;  4J8X B;  1P3A D;  4WV4 B;  4KGC B;  3X1U D;  5CPJ D;  3KSY A;  2PYO A;  1P3M D;  3X1T A;  3AZF A;  5FUG B;  2F8N D;  3AV1 C;  3P5J B;  2ARO B;  5GT0 A;  4G91 C;  1KX5 C;  5B0Y D;  4J8W D;  3TU4 D;  1TZY B;  4JJN D;  4Z66 B;  5GT3 B;  5B2J C;  5B2I D;  1P3G A;  2F8N K;  3KWQ C;  3O62 B;  3H0R C;  1M1A D;  5AV8 D;  4R8P A;  5GSU D;  3WA9 A;  3B0C T;  4QLC C;  5BS7 C;  1AOI B;  5BO0 B;  2DF4 C;  2Y2J A;  1M18 A;  3AZG B;  3B6G A;  2F2A C;  3AZK C;  2W8S A;  3AZM D;  3LEL B;  3AFA A;  1KX3 A;  3VH6 W;  4E45 A;  1T3U A;  5AY8 B;  3W99 A;  5KDM B;  1JFI A;  3KXB C;  2G5I C;  1U35 C;  3LJA C;  1HTA A;  3EPL A;  2ZY5 A;  3H0M C;  3AZJ B;  1EQZ A;  2CV5 A;  1ZLA D;  5B1M B;  1S32 C;  4YS3 C;  5B40 D;  4QLC D;  5B33 C;  5JRG C;  1P3B B;  5C3I C;  5BNV A;  1BH8 B;  5B32 G;  3C1C D;  1R4V A;  3LZ0 C;  3REI C;  3UTB A;  3B6F B;  3X1U A;  5CPJ A;  1HQ3 C;  1P3M A;  2F8N A;  4ZBJ C;  5AV9 B;  2XD1 A;  3MGR C;  5F99 C;  5B0Y A;  3LJA D;  4J8W A;  3TU4 A;  2FJ7 D;  4JJN A;  5JA4 B;  1P3F B;  4EO5 B;  1BFM A;  4H9N B;  3X1S C;  1M1A A;  5AV8 A;  3MGS B;  5GSU A;  3REJ B;  4UUZ B;  4XUJ D;  3W98 B;  1P3P D;  2PYO C;  3X1T C;  4NE6 A;  3AZF C;  2Y2P A;  1ULY A;  3A1K A;  5GT0 C;  5CP6 B;  5AVB D;  3AZH B;  1P3O B;  1P3G C;  1ID3 D;  3EPH A;  5G49 B;  5B32 B;  5DNN B;  3WA9 C;  4R8P C;  5BT1 C;  5B24 D;  3NQU B;  1P3I B;  4DRB A;  1M18 C;  3B6G C;  2HIO D;  5AV5 B;  2F8N H;  3WAA B;  5CPK D;  2IO5 B;  3AYW B;  3AFA C;  1ZLA A;  2Y2N A;  1KX3 C;  3AV2 B;  4XZQ B;  4H9R A;  3REL B;  3W99 C;  3WTP B;  4QLC A;  5B40 A;  5GT3 D;  5AV6 D;  1TAF A;  4J8V D;  3UTA C;  3C1C A;  1P3K D;  4CSR A;  3W96 B;  4WNN B;  1EQZ C;  2CV5 C;  3AZL B;  2FJ7 A;  3LJA A;  3AV1 B;  3AZN D;  4XUJ A;  1P3A C;  4G91 B;  3X1U C;  1KX5 B;  5CPJ C;  1P3P A;  4G92 C;  1P3M C;  5B2J B;  3KWQ B;  4X23 D;  5B0Y C;  4J8W C;  3TU4 C;  5AVB A;  4JJN C;  1ID3 A;  5B2I C;  1M19 D;  4LD9 D;  2G5H C;  5AV8 C;  1M1A C;  5GSU C;  5B24 A;  3AZK B;  4WU8 D;  4H9P A;  1P3B D;  1HQ3 A;  1F66 D;  2RVQ D;  2Y2Q A;  4Z5T D;  4WZS B;  5AVC D;  3C1B D;  2HIO A;  4DRA A;  3EPK A;  3AZI D;  1Z2C B;  3AZM C;  3KXB B;  5CPK A;  2Y2M A;  1U35 B;  3REK B;  5DNM C;  2YFV B;  2Y2K A;  3UTA B;  2DQN C;  1Q9C A;  5GT3 A;  5AV6 A;  4J8V A;  3F6T A;  3FDD A;  1S32 B;  4YS3 B;  2NQB D;  1P3K A;  3W98 D;  5GXQ D;  5B33 B;  1P34 D;  5JRG B;  5C3I B;  1ZLA C;  3V9R B;  4KUD D;  5B40 C;  2VQR A;  3REI B;  2XD5 A;  4E44 A;  3AZN A;  1B67 A;  3C1C C;  3MGR B;  5F99 B;  5DNM D;  3MVD D;  4ZUX C;  3LZ1 D;  1N1J B;  3X1S B;  3AN2 D;  4X23 A;  2NZD D;  3UT9 D;  2FJ7 C;  5E5A D;  2PYO B;  3X1T B;  3AZF B;  3AZE D;  1M19 A;  4LD9 A;  4WU8 A;  5GT0 B;  4XUJ C;  1F66 A;  4WU9 D;  1P3P C;  4Z5T A;  3KUY D;  4J8X C;  5AVC A;  1P3G B;  3X1V D;  3C1B A;  4WJ3 C;  5BNX A;  3WA9 B;  4R8P B;  3AZI A;  4NE3 A;  5AVB C;  1ID3 C;  4UPK A;  3AL0 C;  4YM6 D;  4J8U D;  5B31 D;  2ZY2 A;  1M18 B;  3B6G B;  3REH D;  1P3A A;  5B24 C;  4ZUX D;  3AFA B;  1KX3 B;  2F8N G;  2HIO C;  2JE5 A;  4NFT A;  2NQB A;  3W99 B;  5GXQ A;  1P34 A;  1JFI B;  5B2I A;  5CPK C;  1H3O A;  5B0Z D;  2ARO C;  1WWS A;  5B1L D;  4CAY A;  4KUD A;  5GT3 C;  2BYK A;  1EQZ B;  2CV5 B;  5AV6 C;  4J8V C;  2UWX A;  2YFW A;  3WKJ D;  4H9Q A;  3AZM A;  1P3K C;  2FFF B;  5DNM A;  3MVD A;  1KX4 D;  4HGA B;  5BNV B;  3LZ1 A;  3MGQ D;  3MNN B;  1P3L D;  5CPI D;  3W97 D;  3A6N D;  3AN2 A;  3VH6 A;  2NZD A;  3UT9 A;  3REK D;  3UTB B;  5E5A A;  3X1U B;  5CPJ B;  3MGP D;  4G92 B;  4H9O A;  1P3M B;  2F8N B;  4J8X D;  3UTA D;  3AZE A;  4KGC D;  3AZN C;  5B0Y B;  4J8W B;  3TU4 B;  4WU9 A;  3KUY A;  4JJN B;  2ARO D;  3X1V A;  3R45 A;  3B0C W;  1M1A B;  1TZY D;  5AV8 B;  5GSU B;  4Z66 D;  2BG1 A;  4X23 C;  3O62 D;  4YM6 A;  4J8U A;  5B31 A;  1M19 C;  4LD9 C;  3REH A;  4WU8 C;  1P3B C;  1AOI D;  1F66 C;  4ZUX A;  1PZR A;  2RVQ C;  3B0D C;  4Z5T C;  3AZG D;  3NQJ A;  5AVC C;  3EG5 B;  3C1B C;  3LEL D;  3AZI C;  5AY8 D;  5B0Z A;  3VH6 T;  5B1L A;  4Z2M H;  4AWL C;  2BYM A;  1ZLA B;  2CWE A;  3AZJ D;  1BH9 A;  4NE5 A;  4H9R B;  3WKJ A;  2NQB C;  3W98 C;  5B40 B;  4QLC B;  5GXQ C;  1P34 C;  1KX4 A;  5B1M D;  4KHA A;  3MGQ A;  1P3L A;  4KUD C;  1TAF B;  3W97 A;  3A6N A;  5CPI A;  3C1C B;  3REK A;  4CSR B;  3MGP A;  2L5A A;  4J8X A;  3UTA A;  3B6F D;  4KGC A;  5FUG A;  2FJ7 B;  3LJA B;  3MVD C;  5AV9 D;  2ARO A;  3LZ1 C;  3AN2 C;  1TZY A;  4Z66 A;  2NZD C;  3UT9 C;  4XUJ B;  1P3F D;  5E5A C;  3O62 A;  1P3P B;  3MGS D;  4XZQ C;  3REJ D;  3AZE C;  1AOI A;  5BO0 A;  4WU9 C;  3KFU G;  5AVB B;  3KUY C;  3AZG A;  1ID3 B;  5CP6 D;  3X1V C;  3LEL A;  3LZ0 B;  3AZH D;  1P3O D;  5B24 B;  4H9P B;  1HQ3 B;  5AY8 A;  5B32 D;  5DNN D;  4YM6 C;  5B31 C;  4ZBJ B;  5KDM A;  1B6W A;  3MNN D;  4J8U C;  3REH C;  2HIO B;  1P3I D;  3UTB D;  5CPK B;  3AZJ A;  5AV5 D;  3WAA D;  2J8P A;  3AYW D;  3H0L C;  3AV2 D;  5B1M A;  4XZQ D;  5B0Z C;  3REL D;  3WTP D;  5B1L C;  4H9S A;  5AV6 B;  4J8V B;  1P3B A;  1P3K B;  1BH8 A;  3B6F A;  3W96 D;  3WKJ C;  3VH5 A;  3AZL D;  1KX4 C;  5AV9 A;  4DQY B;  3MGQ C;  1P3L C;  2HUE C;  5CPI C;  3W97 C;  3A6N C;  3AZN B;  5JA4 A;  3REK C;  1P3F A;  3A1I A;  4H9N A;  3AV1 D;  3MGP C;  3MGS A;  3REJ A;  4UUZ A;  2RIQ A;  4KGC C; 
#chains in the Genus database with same CATH homology
 1KX5 D;  3W98 A;  2JSS A;  4X23 B;  5B2J D;  2Y2H A;  3KWQ D;  5CP6 A;  1M19 B;  4LD9 B;  1TZY C;  3AZH A;  4Z66 C;  4WU8 B;  1P3O A;  1F66 B;  5G49 A;  5B32 A;  3O62 C;  3B0D B;  4Z5T B;  5DNN A;  3MNN A;  5AVC B;  3AZK D;  3NQU A;  2Y2L A;  3C1B B;  3WTP E;  5BNX B;  1P3I A;  1AOI C;  3AZI B;  3AZG C;  1F1E A;  5CHL B;  3VH5 T;  5AV5 A;  3WAA A;  1W2E A;  3KXB D;  2LY8 A;  3LEL C;  3AYW A;  1U35 D;  1P3A B;  4AWL B;  3AV2 A;  4XZQ A;  5AY8 C;  3REL A;  4Z2M G;  3WTP A;  1WWI A;  3EPJ A;  2Y2O A;  2NQB B;  2ZY3 A;  5GXQ B;  1P34 B;  5B2I B;  1A7W A;  1H3O B;  3AZJ C;  4YS3 D;  1S32 D;  4CAY B;  3W96 A;  5B33 D;  5JRG D;  4WNN A;  4KUD B;  3AZL A;  5B1M C;  2BYK B;  4H9S C;  5B31 G;  3LZ0 D;  3REI D;  2YFW B;  1HQ3 D;  4H9Q B;  3AZM B;  3IP4 C;  5DNM B;  3MVD B;  3AV1 A;  2ZY4 A;  3B6F C;  3LZ1 B;  3MGR D;  1KX5 A;  5F99 D;  2JCH A;  3AN2 B;  5B2J A;  2NZD B;  3UT9 B;  5E5A B;  5AV9 C;  3KWQ A;  3X1S D;  4H9O B;  3AZE B;  5BS7 A;  2PYO D;  1P3F C;  4EO5 C;  3X1T D;  3AZF D;  4WU9 B;  3MGS C;  3KUY B;  3AZK A;  5GT0 D;  3REJ C;  3X1V B;  3R45 B;  1P3G D;  5CP6 C;  4YM6 B;  4J8U B;  5B31 B;  5BT1 D;  4R8P D;  3WA9 D;  3KXB A;  1U35 A;  3REH B;  3AZH C;  1P3O C;  4HGA C;  2YFV A;  4ZUX B;  1M18 D;  5B32 C;  5DNN C;  3MNN C;  3B6G D;  3NQJ B;  2Y2I A;  1P3I C;  3UTB C;  3AFA D;  1KX3 D;  5B0Z B;  1S32 A;  4YS3 A;  3W99 D;  3WAA C;  5AV5 C;  5B1L B;  5B33 A;  5JRG A;  2IO5 C;  3AYW C;  3V9R A;  3AV2 C;  2BYM B;  3REL C;  3WTP C;  3LZ0 A;  3REI A;  1BH9 B;  2Y2G A;  3WKJ B;  1EQZ D;  2CV5 D;  4M6B A;  1KU5 A;  1KX4 B;  4KHA B;  3VH5 W;  2ZM5 A;  3MGQ B;  3MGR A;  3W96 C;  2HUE B;  5F99 A;  5CPI B;  3A6N B;  1P3L B;  3W97 B;  3AZL C;  3B0B A;  1N1J A;  3X1S A;  3MGP B;  4J8X B;  1P3A D;  4WV4 B;  4KGC B;  3X1U D;  5CPJ D;  3KSY A;  2PYO A;  1P3M D;  3X1T A;  3AZF A;  5FUG B;  2F8N D;  3AV1 C;  3P5J B;  2ARO B;  5GT0 A;  4G91 C;  1KX5 C;  5B0Y D;  4J8W D;  3TU4 D;  1TZY B;  4JJN D;  4Z66 B;  5GT3 B;  5B2J C;  5B2I D;  1P3G A;  2F8N K;  3KWQ C;  3O62 B;  3H0R C;  1M1A D;  5AV8 D;  4R8P A;  5GSU D;  3WA9 A;  3B0C T;  4QLC C;  5BS7 C;  1AOI B;  5BO0 B;  2DF4 C;  2Y2J A;  1M18 A;  3AZG B;  3B6G A;  2F2A C;  3AZK C;  2W8S A;  3AZM D;  3LEL B;  3AFA A;  1KX3 A;  3VH6 W;  4E45 A;  1T3U A;  5AY8 B;  3W99 A;  5KDM B;  1JFI A;  3KXB C;  2G5I C;  1U35 C;  3LJA C;  1HTA A;  3EPL A;  2ZY5 A;  3H0M C;  3AZJ B;  1EQZ A;  2CV5 A;  1ZLA D;  5B1M B;  1S32 C;  4YS3 C;  5B40 D;  4QLC D;  5B33 C;  5JRG C;  1P3B B;  5C3I C;  5BNV A;  1BH8 B;  5B32 G;  3C1C D;  1R4V A;  3LZ0 C;  3REI C;  3UTB A;  3B6F B;  3X1U A;  5CPJ A;  1HQ3 C;  1P3M A;  2F8N A;  4ZBJ C;  5AV9 B;  2XD1 A;  3MGR C;  5F99 C;  5B0Y A;  3LJA D;  4J8W A;  3TU4 A;  2FJ7 D;  4JJN A;  5JA4 B;  1P3F B;  4EO5 B;  1BFM A;  4H9N B;  3X1S C;  1M1A A;  5AV8 A;  3MGS B;  5GSU A;  3REJ B;  4UUZ B;  4XUJ D;  3W98 B;  1P3P D;  2PYO C;  3X1T C;  4NE6 A;  3AZF C;  2Y2P A;  1ULY A;  3A1K A;  5GT0 C;  5CP6 B;  5AVB D;  3AZH B;  1P3O B;  1P3G C;  1ID3 D;  3EPH A;  5G49 B;  5B32 B;  5DNN B;  3WA9 C;  4R8P C;  5BT1 C;  5B24 D;  3NQU B;  1P3I B;  4DRB A;  1M18 C;  3B6G C;  2HIO D;  5AV5 B;  2F8N H;  3WAA B;  5CPK D;  2IO5 B;  3AYW B;  3AFA C;  1ZLA A;  2Y2N A;  1KX3 C;  3AV2 B;  4XZQ B;  4H9R A;  3REL B;  3W99 C;  3WTP B;  4QLC A;  5B40 A;  5GT3 D;  5AV6 D;  1TAF A;  4J8V D;  3UTA C;  3C1C A;  1P3K D;  4CSR A;  3W96 B;  4WNN B;  1EQZ C;  2CV5 C;  3AZL B;  2FJ7 A;  3LJA A;  3AV1 B;  3AZN D;  4XUJ A;  1P3A C;  4G91 B;  3X1U C;  1KX5 B;  5CPJ C;  1P3P A;  4G92 C;  1P3M C;  5B2J B;  3KWQ B;  4X23 D;  5B0Y C;  4J8W C;  3TU4 C;  5AVB A;  4JJN C;  1ID3 A;  5B2I C;  1M19 D;  4LD9 D;  2G5H C;  5AV8 C;  1M1A C;  5GSU C;  5B24 A;  3AZK B;  4WU8 D;  4H9P A;  1P3B D;  1HQ3 A;  1F66 D;  2RVQ D;  2Y2Q A;  4Z5T D;  4WZS B;  5AVC D;  3C1B D;  2HIO A;  4DRA A;  3EPK A;  3AZI D;  1Z2C B;  3AZM C;  3KXB B;  5CPK A;  2Y2M A;  1U35 B;  3REK B;  5DNM C;  2YFV B;  2Y2K A;  3UTA B;  2DQN C;  1Q9C A;  5GT3 A;  5AV6 A;  4J8V A;  3F6T A;  3FDD A;  1S32 B;  4YS3 B;  2NQB D;  1P3K A;  3W98 D;  5GXQ D;  5B33 B;  1P34 D;  5JRG B;  5C3I B;  1ZLA C;  3V9R B;  4KUD D;  5B40 C;  2VQR A;  3REI B;  2XD5 A;  4E44 A;  3AZN A;  1B67 A;  3C1C C;  3MGR B;  5F99 B;  5DNM D;  3MVD D;  4ZUX C;  3LZ1 D;  1N1J B;  3X1S B;  3AN2 D;  4X23 A;  2NZD D;  3UT9 D;  2FJ7 C;  5E5A D;  2PYO B;  3X1T B;  3AZF B;  3AZE D;  1M19 A;  4LD9 A;  4WU8 A;  5GT0 B;  4XUJ C;  1F66 A;  4WU9 D;  1P3P C;  4Z5T A;  3KUY D;  4J8X C;  5AVC A;  1P3G B;  3X1V D;  3C1B A;  4WJ3 C;  5BNX A;  3WA9 B;  4R8P B;  3AZI A;  4NE3 A;  5AVB C;  1ID3 C;  4UPK A;  3AL0 C;  4YM6 D;  4J8U D;  5B31 D;  2ZY2 A;  1M18 B;  3B6G B;  3REH D;  1P3A A;  5B24 C;  4ZUX D;  3AFA B;  1KX3 B;  2F8N G;  2HIO C;  2JE5 A;  4NFT A;  2NQB A;  3W99 B;  5GXQ A;  1P34 A;  1JFI B;  5B2I A;  5CPK C;  1H3O A;  5B0Z D;  2ARO C;  1WWS A;  5B1L D;  4CAY A;  4KUD A;  5GT3 C;  2BYK A;  1EQZ B;  2CV5 B;  5AV6 C;  4J8V C;  2UWX A;  2YFW A;  3WKJ D;  4H9Q A;  3AZM A;  1P3K C;  2FFF B;  5DNM A;  3MVD A;  1KX4 D;  4HGA B;  5BNV B;  3LZ1 A;  3MGQ D;  3MNN B;  1P3L D;  5CPI D;  3W97 D;  3A6N D;  3AN2 A;  3VH6 A;  2NZD A;  3UT9 A;  3REK D;  3UTB B;  5E5A A;  3X1U B;  5CPJ B;  3MGP D;  4G92 B;  4H9O A;  1P3M B;  2F8N B;  4J8X D;  3UTA D;  3AZE A;  4KGC D;  3AZN C;  5B0Y B;  4J8W B;  3TU4 B;  4WU9 A;  3KUY A;  4JJN B;  2ARO D;  3X1V A;  3R45 A;  3B0C W;  1M1A B;  1TZY D;  5AV8 B;  5GSU B;  4Z66 D;  2BG1 A;  4X23 C;  3O62 D;  4YM6 A;  4J8U A;  5B31 A;  1M19 C;  4LD9 C;  3REH A;  4WU8 C;  1P3B C;  1AOI D;  1F66 C;  4ZUX A;  1PZR A;  2RVQ C;  3B0D C;  4Z5T C;  3AZG D;  3NQJ A;  5AVC C;  3EG5 B;  3C1B C;  3LEL D;  3AZI C;  5AY8 D;  5B0Z A;  3VH6 T;  5B1L A;  4Z2M H;  4AWL C;  2BYM A;  1ZLA B;  2CWE A;  3AZJ D;  1BH9 A;  4NE5 A;  4H9R B;  3WKJ A;  2NQB C;  3W98 C;  5B40 B;  4QLC B;  5GXQ C;  1P34 C;  1KX4 A;  5B1M D;  4KHA A;  3MGQ A;  1P3L A;  4KUD C;  1TAF B;  3W97 A;  3A6N A;  5CPI A;  3C1C B;  3REK A;  4CSR B;  3MGP A;  2L5A A;  4J8X A;  3UTA A;  3B6F D;  4KGC A;  5FUG A;  2FJ7 B;  3LJA B;  3MVD C;  5AV9 D;  2ARO A;  3LZ1 C;  3AN2 C;  1TZY A;  4Z66 A;  2NZD C;  3UT9 C;  4XUJ B;  1P3F D;  5E5A C;  3O62 A;  1P3P B;  3MGS D;  4XZQ C;  3REJ D;  3AZE C;  1AOI A;  5BO0 A;  4WU9 C;  3KFU G;  5AVB B;  3KUY C;  3AZG A;  1ID3 B;  5CP6 D;  3X1V C;  3LEL A;  3LZ0 B;  3AZH D;  1P3O D;  5B24 B;  4H9P B;  1HQ3 B;  5AY8 A;  5B32 D;  5DNN D;  4YM6 C;  5B31 C;  4ZBJ B;  5KDM A;  1B6W A;  3MNN D;  4J8U C;  3REH C;  2HIO B;  1P3I D;  3UTB D;  5CPK B;  3AZJ A;  5AV5 D;  3WAA D;  2J8P A;  3AYW D;  3H0L C;  3AV2 D;  5B1M A;  4XZQ D;  5B0Z C;  3REL D;  3WTP D;  5B1L C;  4H9S A;  5AV6 B;  4J8V B;  1P3B A;  1P3K B;  1BH8 A;  3B6F A;  3W96 D;  3WKJ C;  3VH5 A;  3AZL D;  1KX4 C;  5AV9 A;  4DQY B;  3MGQ C;  1P3L C;  2HUE C;  5CPI C;  3W97 C;  3A6N C;  3AZN B;  5JA4 A;  3REK C;  1P3F A;  3A1I A;  4H9N A;  3AV1 D;  3MGP C;  3MGS A;  3REJ A;  4UUZ A;  2RIQ A;  4KGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...