1F66B

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66B00
5DNMC 5JRGC 5GT0D 4YS3B 1KX3A 1JFIB 5B31G 3REHA 1KX3D 3W98B 3VH5A 4YM6A 3KWQC 5B0ZB 3REHD 1P3PA 4DRBA 3A6NC 4YM6D 1HQ3C 5BO0A 5B2IC 1AOID 4UUZB 1ID3C 1U35B 1P3LB 5BNVB 3C1BA 3WKJD 3AZHC 4LD9C 1ULYA 3KXBB 5CPIA 1M18B 3C1CC 4XZQA 3AZJD 1S32D 3C1BD 3W96B 3MGQB 3REKA 3UT9C 5AVBB 1P34B 5DNNB 4XZQD 5B24C 5AV5C 1R4VA 5B40C 3REKD 4J8UB 5B1LA 3WA9C 4QLCA 4H9OA 5B1MB 5B1LD 5F99D 5B0YC 1N1JB 1EQZA 1P3GB 3W98C 4QLCD 5E5AA 4WNNB 4X23A 2BYKB 3B0DC 1EQZD 3AV1A 5E5AD 4R8PB 4X23D 5B32G 3AV1D 1KX5A 3AZKB 4KGCA 3B0CW 1U35C 3X1VA 1KX5D 3X1SB 3W97C 1BH8B 2F8NB 5AY8A 2BYMA 3KXBC 1M18C 1P3KB 3X1VD 2AROC 5FUGB 3W96C 1M1AC 5AVBC 1P34C 5DNNC 4E45A 1BH9A 5BT1C 3LELB 3NQUB 4H9SA 5GT0B 5B1MC 4EO5C 2YFVB 2NQBA 3AN2B 3B6GA 4Z66C 1P3GC 4CSRA 3AFAA 1KX3B 2L5AA 2NQBD 3B6GD 3REHB 1HTAA 4KUDC 3AFAD 4R8PC 4YM6B 3AYWA 3AZKC 1AOIB 3REIA 3AYWD 5BO0B 1P3IA 3TU4A 2RVQC 3X1SC 3MGSA 3WKJB 4H9PA 1P3KC 3NQJB 3TU4D 4JJND 5CP6A 3AZJB 3MGSD 3C1BB 1S32B 1P3MA 3KSYA 3WTPA 2FJ7C 5KDMB 4XZQB 5CP6D 1P3MD 3REKB 3WTPD 3AZFA 2CV5C 5CPKA 3LELC 3VH6W 3MGRA 3AZFD 5CPKD 5B1LB 5F99B 3AN2C 4J8VA 1KX3C 3MVDA 3MGRD 4QLCB 2PYOA 5BS7C 4J8WA 5AV8A 4J8VD 3LJAD 3REHC 1EQZB 3MVDD 1WWIA 5E5AB 4NE5A 4X23B 1M19A 4J8WD 5AV8D 1AOIC 3AV1B 1ZLAA 1TZYA 1M19D 3LZ1A 3LZ0A 3B0BA 1KX5B 1ZLAD 2HIOA 2YFWB 5G49B 3V9RA 1TZYD 3AV2D 3WKJC 3LZ1D 3LZ0D 1P3FD 3X1VB 3AZJC 1S32C 3C1BC 4H9NA 2HIOD 3MNNC 1F66A 3W99A 2HUEB 1F1EA 2BYMB 4XZQC 1Q9CA 3O62A 3AZIA 1F66D 3W99D 3REKC 1P3PD 4Z5TA 3O62D 1P3BA 3AZID 4CAYA 5GT3A 4XUJA 3AZLC 3AZNA 4ZUXB 5F99C 5B2JA 5CPJC 1P3BD 5GT3D 4QLCC 4ZBJB 4XUJD 3AZND 5C3IC 5B2JD 2NQBB 3X1TA 3B6GB 3AFAB 5AV9A 5B32A 3VH5W 5E5AC 4X23C 5GSUA 4WU8C 5AVCA 4WU9A 3X1TD 5CPID 3AV1C 5AV9D 5B32D 5GSUD 1P3AC 5AVCD 3UTAA 4WU9D 3AYWB 1KX5C 4YS3C 5DNMA 5JRGA 4E44A 3X1VC 3TU4B 4JJNB 3MGSB 3R45A 5DNMD 4H9PB 3AZMA 5B0ZC 5CP6B 1P3MB 3AZMD 3WTPB 4NFTA 1TAFB 4HGAB 1HQ3A 5B2IA 4ZUXC 3AZFB 5CPKB 1ID3A 1P3LC 4KGCD 4ZBJC 1HQ3D 3MGRB 5B2ID 3KUYA 1P3OA 1A7WA 1ID3D 3AZHA 4J8VB 3LJAB 3KUYD 3MVDB 1P3OD 3REJA 3MGQC 5AY8D 3AZHD 3UT9A 4J8WB 5AV8B 3REJD 5B24A 3UTBA 4J8UC 5AV5A 1M19B 1H3OA 3AYWC 5BNXB 3WA9A 5B24D 3UTBD 3AV2B 5AV5D 1TZYB 3LZ1B 3LZ0B 1JFIA 1P3FB 5B0YA 3TU4C 4JJNC 3WA9D 4J8XA 2HIOB 3W98A 5B0YD 3RELA 4H9NB 4J8XD 1P3MC 1F66B 3W99B 3WAAA 5AV6A 3RELD 1P3PB 3O62B 3AZIB 1KX4A 2F8NK 3WAAD 4G92B 5AV6D 3B0CT 1U35A 1P3BB 4G91B 5BNVA 2CWEA 1KX4D 3MGRC 4CAYB 5GT3B 4XUJB 3AZNB 3W97A 3REID 5B2JB 3LJAC 5B33A 1P3ID 1M18A 2AROA 3W97D 1M1AA 4H9QA 4J8WC 3X1TB 5CPIB 5B33D 5AVBA 5DNNA 1P34A 2AROD 5AV9B 5GSUB 1M19C 1M1AD 5AVCB 4WU9B 5GT0C 3AV2C 5JA4A 3LZ1C 3LZ0C 5B31A 1P3FC 2HIOC 1N1JA 3WTPE 4Z66A 5DNMB 4H9OB 1P3GA 5B31D 2BYKA 4Z66D 3MGPA 4KUDA 3AZMB 2PYOD 4YM6C 1P3PC 3AZIC 3MGPD 4KUDD 1P3BC 4KGCB 5GT3C 4XUJC 1HQ3B 2NZDA 5B2IB 3X1SA 1BH8A 5B2JC 1ID3B 1P3KA 3KUYB 1P3OB 2NZDD 5AY8B 5CPIC 3AZHB 1KU5A 4DRAA 1P3KD 5GXQA 2FJ7A 3REJB 5AVCC 2CV5A 1BH9B 5GXQD 2FJ7D 3NQUA 4AWLB 3UTBB 3B6FA 5AV5B 5B1LC 2CV5D 4Z5TD 3AN2A 3WA9B 3B6FD 5B0YB 2F8NG 1EQZC 3AN2D 5BS7A 4CSRB 4J8XB 3AZMC 4Z2MG 3RELB 3AZEA 3B0DB 1AOIA 3WAAB 3AZGA 3X1UA 5AV6B 3AZED 4KGCC 1KX4B 3AZGD 3X1UD 3UTAD 3REIB 3WKJA 2LY8A 1P3IB 2JSSA 3KUYC 1P3OC 3NQJA 4NE3A 3AZJA 1S32A 2HUEC 5AY8C 5JRGD 3MNNA 3W97B 5B33B 5KDMA 3KWQA 2AROB 3REJC 3MNND 1M1AB 4H9QB 3A6NA 1B67A 4WV4B 3KWQD 4AWLC 3UTBC 2F8NH 3AZLA 3A6ND 5F99A 4H9SC 4M6BA 5CPJA 4Z2MH 5JA4B 2IO5B 3AZLD 2NQBC 5B31B 4EO5B 3B6GC 4LD9A 4J8XC 5CPJD 3AFAC 4KHAA 4Z66B 3C1CA 2PYOB 3VH5T 3RELC 4WU8A 4LD9D 3C1CD 3MGPB 3WAAC 4KUDB 5B40A 1P3AA 5AV6C 3UT9D 4WU8D 4H9RA 1KX4C 1ZLAB 1BFMA 4YS3A 5G49A 2YFWA 5B40D 3REIC 1P3AD 1P3IC 3MGSC 2NZDB 3V9RB 4YS3D 5B33C 5CP6C 5B0ZA 3W98D 3WTPC 5GXQB 5B0ZD 2FJ7B 4HGAC 3AZFC 4UUZA 5CPKC 4ZUXA 2CV5B 4Z5TB 1P3LA 3B6FB 2IO5C 5B31C 4ZUXD 1U35D 4J8VC 1P3LD 3KXBA 3MVDC 2PYOC 3W96A 3MGQA 5AV8C 3KXBD 1M18D 3MGPC 5B32B 1WWSA 3W96D 3MGQD 4J8UA 3AZEB 5AVBD 1P34D 5DNND 1ZLAC 3AZGB 1TZYC 3VH6A 3X1UB 4J8UD 5B1MA 5BT1D 3UTAB 2NZDC 4JJNA 5JRGB 5B1MD 4WNNA 1F66C 3R45B 3W99C 1P3GD 3MNNB 4R8PA 5GXQC 3O62C 3KWQB 3AZKA 1TAFA 4G92C 4WZSB 4R8PD 4Z5TC 3A6NB 4G91C 3AZNC 3AZKD 3B6FC 3AZLB 2F8NA 5CPJB 5FUGA 3LJAA 2RVQD 5CHLB 3X1SD 2F8ND 3X1TC 4NE6A 5C3IB 4LD9B 5AV9C 4KHAB 5B32C 3C1CB 5GSUC 4WU9C 3UT9B 4WU8B 3AZEC 3LELA 1B6WA 3AZGC 5BNXA 5B24B 5GT0A 3X1UC 3VH6T 5B40B 3UTAC 3AV2A 1H3OB 1P3AB 2YFVA 4H9RB 3LELD 1P3FA
chains in the Genus database with same CATH superfamily
5DNMC 5JRGC 5GT0D 4YS3B 1KX3A 2DF4C 1JFIB 5B31G 3REHA 1KX3D 3W98B 3VH5A 4YM6A 3EG5B 3H0RC 5B0ZB 3KWQC 3REHD 1P3PA 4DRBA 3A6NC 4YM6D 2Y2JA 3F6TA 1HQ3C 5BO0A 5B2IC 1AOID 4UUZB 1ID3C 2BG1A 1U35B 1P3LB 5BNVB 3C1BA 3WKJD 3AZHC 4LD9C 1ULYA 3KXBB 5CPIA 1M18B 3C1CC 4XZQA 3AZJD 1S32D 3C1BD 3W96B 3MGQB 3REKA 3UT9C 5AVBB 1P34B 5DNNB 4XZQD 5B24C 5AV5C 1R4VA 5B40C 3REKD 4J8UB 5B1LA 3EPKA 3WA9C 4QLCA 4H9OA 5B1MB 5B1LD 5F99D 5B0YC 2W8SA 1N1JB 1EQZA 1P3GB 3W98C 4QLCD 1PZRA 5E5AA 4WNNB 4X23A 2BYKB 3B0DC 1EQZD 3AV1A 5E5AD 4R8PB 2Y2KA 3H0LC 5B32G 4X23D 3AV1D 1KX5A 3AZKB 4KGCA 2UWXA 2VQRA 3B0CW 1U35C 2Y2HA 3X1VA 1KX5D 3X1SB 3W97C 1BH8B 2F8NB 5AY8A 2BYMA 3KXBC 1M18C 1P3KB 3X1VD 2AROC 5FUGB 3W96C 1M1AC 5AVBC 1P34C 5DNNC 2J8PA 4E45A 1BH9A 5BT1C 3LELB 3NQUB 4H9SA 5GT0B 5B1MC 4EO5C 2YFVB 2NQBA 3AN2B 3B6GA 4Z66C 1P3GC 4CSRA 3AFAA 1KX3B 2L5AA 2NQBD 3B6GD 3REHB 1HTAA 4KUDC 3AFAD 4R8PC 4YM6B 3EPLA 3AYWA 3AZKC 1AOIB 1W2EA 2Y2GA 3REIA 3AYWD 5BO0B 1P3IA 3TU4A 3EPJA 2RVQC 3X1SC 3MGSA 3WKJB 4H9PA 1P3KC 3NQJB 3TU4D 4JJND 3A1IA 5CP6A 3MGSD 3C1BB 3AZJB 1S32B 3KSYA 1P3MA 3WTPA 2Y2MA 5KDMB 2FJ7C 3A1KA 4XZQB 5CP6D 1P3MD 3REKB 3WTPD 3AZFA 2CV5C 5CPKA 3LELC 2JE5A 3VH6W 3MGRA 3AZFD 5CPKD 5B1LB 5F99B 3AN2C 2Y2NA 4J8VA 1KX3C 3MVDA 3MGRD 4QLCB 2PYOA 5BS7C 4J8WA 5AV8A 4J8VD 3LJAD 3REHC 1EQZB 3MVDD 1WWIA 5E5AB 4NE5A 4X23B 1M19A 4J8WD 5AV8D 1AOIC 2ZM5A 3AV1B 1ZLAA 1TZYA 1M19D 3LZ1A 3LZ0A 2ZY4A 3B0BA 1KX5B 1ZLAD 2HIOA 2YFWB 5G49B 3V9RA 1TZYD 3AV2D 3WKJC 2ZY5A 3FDDA 3LZ0D 3LZ1D 1P3FD 3X1VB 3AZJC 1S32C 3C1BC 4H9NA 2HIOD 3MNNC 1F66A 3W99A 2HUEB 1F1EA 2BYMB 4XZQC 1Q9CA 3O62A 3AZIA 1F66D 3W99D 3REKC 2G5HC 1P3PD 4Z5TA 3O62D 1P3BA 3AZID 4CAYA 5GT3A 4XUJA 3AZLC 3AZNA 4ZUXB 5F99C 5B2JA 5CPJC 1P3BD 5GT3D 4QLCC 4ZBJB 4XUJD 3AZND 5C3IC 5B2JD 2NQBB 3X1TA 2Y2PA 3B6GB 3AFAB 5AV9A 5B32A 3VH5W 5E5AC 4X23C 5GSUA 4WU8C 5AVCA 4WU9A 3X1TD 5CPID 3AV1C 5AV9D 5B32D 5GSUD 1P3AC 5AVCD 3UTAA 4WU9D 3AYWB 1KX5C 4YS3C 5DNMA 5JRGA 4E44A 3X1VC 3TU4B 4JJNB 3MGSB 3R45A 5DNMD 4H9PB 3AZMA 5B0ZC 5CP6B 1P3MB 3AZMD 3WTPB 4NFTA 1TAFB 4HGAB 1HQ3A 5B2IA 4ZUXC 3AZFB 5CPKB 1ID3A 1P3LC 4KGCD 2Y2IA 1HQ3D 4ZBJC 5B2ID 3MGRB 3KUYA 1P3OA 1A7WA 1ID3D 3AZHA 4J8VB 3LJAB 3KUYD 3MVDB 1P3OD 3REJA 3MGQC 5AY8D 1T3UA 3UT9A 3AZHD 4J8WB 5AV8B 3REJD 5B24A 3P5JB 4J8UC 3UTBA 5AV5A 1M19B 1H3OA 3AYWC 3AL0C 5BNXB 3WA9A 5B24D 3UTBD 3AV2B 5AV5D 1TZYB 3LZ1B 3LZ0B 1JFIA 1P3FB 5B0YA 3TU4C 4JJNC 3WA9D 4J8XA 2HIOB 2XD5A 3W98A 5B0YD 3RELA 4H9NB 4J8XD 1P3MC 1F66B 3W99B 3WAAA 4DQYB 5AV6A 3RELD 1P3PB 3O62B 3AZIB 1KX4A 2F8NK 3WAAD 4G92B 5AV6D 3B0CT 1U35A 1P3BB 4G91B 5BNVA 2CWEA 1KX4D 3MGRC 4CAYB 5GT3B 4XUJB 3AZNB 3W97A 3REID 5B2JB 3H0MC 3LJAC 5B33A 1P3ID 1M18A 2AROA 3W97D 1M1AA 4H9QA 4J8WC 3X1TB 5CPIB 5B33D 5AVBA 5DNNA 1P34A 2AROD 5AV9B 5GSUB 1M19C 1M1AD 5AVCB 4WU9B 2Y2LA 5GT0C 3AV2C 5JA4A 3LZ1C 2Y2OA 3LZ0C 5B31A 1P3FC 2HIOC 1N1JA 3WTPE 4Z66A 5DNMB 4H9OB 1P3GA 5B31D 2BYKA 4Z66D 3MGPA 4KUDA 3AZMB 2PYOD 4YM6C 1P3PC 3AZIC 3MGPD 4KUDD 1P3BC 4KGCB 5GT3C 4XUJC 1HQ3B 2NZDA 5B2IB 3X1SA 1BH8A 5B2JC 1ID3B 2DQNC 1P3KA 3KUYB 1P3OB 2NZDD 5AY8B 3IP4C 5CPIC 3AZHB 1KU5A 4DRAA 1P3KD 5GXQA 2FJ7A 3REJB 5AVCC 2CV5A 1BH9B 5GXQD 2FJ7D 3NQUA 4AWLB 3UTBB 3B6FA 5AV5B 5B1LC 2CV5D 4Z5TD 3AN2A 3WA9B 3B6FD 2RIQA 5B0YB 2F8NG 1EQZC 2F2AC 5BS7A 4CSRB 4J8XB 3AN2D 3AZMC 4Z2MG 3RELB 3AZEA 3B0DB 1AOIA 3WAAB 3AZGA 3X1UA 5AV6B 3AZED 4KGCC 1KX4B 3AZGD 3X1UD 3UTAD 3REIB 3WKJA 2LY8A 2G5IC 1P3IB 2JSSA 3KUYC 1P3OC 3NQJA 4NE3A 1Z2CB 3AZJA 1S32A 2HUEC 5AY8C 5JRGD 3MNNA 3W97B 5B33B 5KDMA 3KWQA 2AROB 3REJC 3MNND 1M1AB 4H9QB 3A6NA 1B67A 4WV4B 3KWQD 4AWLC 3UTBC 2ZY2A 3AZLA 2F8NH 3A6ND 5F99A 4H9SC 4M6BA 5CPJA 3EPHA 4Z2MH 5JA4B 2IO5B 3AZLD 2NQBC 5B31B 4EO5B 3B6GC 4LD9A 4J8XC 5CPJD 3AFAC 4KHAA 4Z66B 3C1CA 2PYOB 3VH5T 3RELC 4WU8A 4LD9D 3C1CD 3MGPB 3WAAC 4KUDB 5B40A 1P3AA 5AV6C 3UT9D 4WU8D 4H9RA 1KX4C 1ZLAB 1BFMA 2XD1A 4YS3A 5G49A 2YFWA 5B40D 3REIC 1P3AD 1P3IC 3MGSC 2NZDB 3V9RB 4YS3D 4UPKA 5B33C 5CP6C 5B0ZA 3W98D 3WTPC 4WJ3C 5GXQB 5B0ZD 2FJ7B 4HGAC 3AZFC 4UUZA 5CPKC 4ZUXA 2ZY3A 2CV5B 4Z5TB 1P3LA 3B6FB 2IO5C 5B31C 4ZUXD 1U35D 4J8VC 1P3LD 3KXBA 3MVDC 2PYOC 3W96A 3MGQA 5AV8C 3KXBD 1M18D 3MGPC 5B32B 1WWSA 2JCHA 3W96D 3MGQD 4J8UA 3AZEB 5AVBD 1P34D 5DNND 1ZLAC 3AZGB 1TZYC 3VH6A 3X1UB 4J8UD 5B1MA 5BT1D 3UTAB 2NZDC 4JJNA 5JRGB 5B1MD 4WNNA 3KFUG 1F66C 3R45B 3W99C 1P3GD 3MNNB 4R8PA 2Y2QA 5GXQC 3O62C 3KWQB 3AZKA 1TAFA 4G92C 4WZSB 4R8PD 4Z5TC 3A6NB 4G91C 3AZNC 3AZKD 3B6FC 3AZLB 2F8NA 5CPJB 5FUGA 3LJAA 2RVQD 5CHLB 3X1SD 2F8ND 3X1TC 4NE6A 5C3IB 4LD9B 2FFFB 5AV9C 4KHAB 5B32C 3C1CB 5GSUC 4WU9C 3UT9B 4WU8B 3AZEC 3LELA 1B6WA 3AZGC 5BNXA 5B24B 5GT0A 3X1UC 3VH6T 5B40B 3UTAC 3AV2A 1H3OB 1P3AB 2YFVA 4H9RB 3LELD 1P3FA
chains in the Genus database with same CATH topology
5DNMC 5JRGC 5GT0D 4YS3B 1KX3A 2DF4C 1JFIB 5B31G 3REHA 1KX3D 3W98B 3VH5A 4YM6A 3EG5B 3H0RC 5B0ZB 3KWQC 3REHD 1P3PA 4DRBA 3A6NC 4YM6D 2Y2JA 3F6TA 1HQ3C 5BO0A 5B2IC 1AOID 4UUZB 1ID3C 2BG1A 1U35B 1P3LB 5BNVB 3C1BA 3WKJD 3AZHC 4LD9C 1ULYA 3KXBB 5CPIA 1M18B 3C1CC 4XZQA 3AZJD 1S32D 3C1BD 3W96B 3MGQB 3REKA 3UT9C 5AVBB 1P34B 5DNNB 4XZQD 5B24C 5AV5C 1R4VA 5B40C 3REKD 4J8UB 5B1LA 3EPKA 3WA9C 4QLCA 4H9OA 5B1MB 5B1LD 5F99D 5B0YC 2W8SA 1N1JB 1EQZA 1P3GB 3W98C 4QLCD 1PZRA 5E5AA 4WNNB 4X23A 2BYKB 3B0DC 1EQZD 3AV1A 5E5AD 4R8PB 2Y2KA 3H0LC 5B32G 4X23D 3AV1D 1KX5A 3AZKB 4KGCA 2UWXA 2VQRA 3B0CW 1U35C 2Y2HA 3X1VA 1KX5D 3X1SB 3W97C 1BH8B 2F8NB 5AY8A 2BYMA 3KXBC 1M18C 1P3KB 3X1VD 2AROC 5FUGB 3W96C 1M1AC 5AVBC 1P34C 5DNNC 2J8PA 4E45A 1BH9A 5BT1C 3LELB 3NQUB 4H9SA 5GT0B 5B1MC 4EO5C 2YFVB 2NQBA 3AN2B 3B6GA 4Z66C 1P3GC 4CSRA 3AFAA 1KX3B 2L5AA 2NQBD 3B6GD 3REHB 1HTAA 4KUDC 3AFAD 4R8PC 4YM6B 3EPLA 3AYWA 3AZKC 1AOIB 1W2EA 2Y2GA 3REIA 3AYWD 5BO0B 1P3IA 3TU4A 3EPJA 2RVQC 3X1SC 3MGSA 3WKJB 4H9PA 1P3KC 3NQJB 3TU4D 4JJND 3A1IA 5CP6A 3MGSD 3C1BB 3AZJB 1S32B 3KSYA 1P3MA 3WTPA 2Y2MA 5KDMB 2FJ7C 3A1KA 4XZQB 5CP6D 1P3MD 3REKB 3WTPD 3AZFA 2CV5C 5CPKA 3LELC 2JE5A 3VH6W 3MGRA 3AZFD 5CPKD 5B1LB 5F99B 3AN2C 2Y2NA 4J8VA 1KX3C 3MVDA 3MGRD 4QLCB 2PYOA 5BS7C 4J8WA 5AV8A 4J8VD 3LJAD 3REHC 1EQZB 3MVDD 1WWIA 5E5AB 4NE5A 4X23B 1M19A 4J8WD 5AV8D 1AOIC 2ZM5A 3AV1B 1ZLAA 1TZYA 1M19D 3LZ1A 3LZ0A 2ZY4A 3B0BA 1KX5B 1ZLAD 2HIOA 2YFWB 5G49B 3V9RA 1TZYD 3AV2D 3WKJC 2ZY5A 3FDDA 3LZ0D 3LZ1D 1P3FD 3X1VB 3AZJC 1S32C 3C1BC 4H9NA 2HIOD 3MNNC 1F66A 3W99A 2HUEB 1F1EA 2BYMB 4XZQC 1Q9CA 3O62A 3AZIA 1F66D 3W99D 3REKC 2G5HC 1P3PD 4Z5TA 3O62D 1P3BA 3AZID 4CAYA 5GT3A 4XUJA 3AZLC 3AZNA 4ZUXB 5F99C 5B2JA 5CPJC 1P3BD 5GT3D 4QLCC 4ZBJB 4XUJD 3AZND 5C3IC 5B2JD 2NQBB 3X1TA 2Y2PA 3B6GB 3AFAB 5AV9A 5B32A 3VH5W 5E5AC 4X23C 5GSUA 4WU8C 5AVCA 4WU9A 3X1TD 5CPID 3AV1C 5AV9D 5B32D 5GSUD 1P3AC 5AVCD 3UTAA 4WU9D 3AYWB 1KX5C 4YS3C 5DNMA 5JRGA 4E44A 3X1VC 3TU4B 4JJNB 3MGSB 3R45A 5DNMD 4H9PB 3AZMA 5B0ZC 5CP6B 1P3MB 3AZMD 3WTPB 4NFTA 1TAFB 4HGAB 1HQ3A 5B2IA 4ZUXC 3AZFB 5CPKB 1ID3A 1P3LC 4KGCD 2Y2IA 1HQ3D 4ZBJC 5B2ID 3MGRB 3KUYA 1P3OA 1A7WA 1ID3D 3AZHA 4J8VB 3LJAB 3KUYD 3MVDB 1P3OD 3REJA 3MGQC 5AY8D 1T3UA 3UT9A 3AZHD 4J8WB 5AV8B 3REJD 5B24A 3P5JB 4J8UC 3UTBA 5AV5A 1M19B 1H3OA 3AYWC 3AL0C 5BNXB 3WA9A 5B24D 3UTBD 3AV2B 5AV5D 1TZYB 3LZ1B 3LZ0B 1JFIA 1P3FB 5B0YA 3TU4C 4JJNC 3WA9D 4J8XA 2HIOB 2XD5A 3W98A 5B0YD 3RELA 4H9NB 4J8XD 1P3MC 1F66B 3W99B 3WAAA 4DQYB 5AV6A 3RELD 1P3PB 3O62B 3AZIB 1KX4A 2F8NK 3WAAD 4G92B 5AV6D 3B0CT 1U35A 1P3BB 4G91B 5BNVA 2CWEA 1KX4D 3MGRC 4CAYB 5GT3B 4XUJB 3AZNB 3W97A 3REID 5B2JB 3H0MC 3LJAC 5B33A 1P3ID 1M18A 2AROA 3W97D 1M1AA 4H9QA 4J8WC 3X1TB 5CPIB 5B33D 5AVBA 5DNNA 1P34A 2AROD 5AV9B 5GSUB 1M19C 1M1AD 5AVCB 4WU9B 2Y2LA 5GT0C 3AV2C 5JA4A 3LZ1C 2Y2OA 3LZ0C 5B31A 1P3FC 2HIOC 1N1JA 3WTPE 4Z66A 5DNMB 4H9OB 1P3GA 5B31D 2BYKA 4Z66D 3MGPA 4KUDA 3AZMB 2PYOD 4YM6C 1P3PC 3AZIC 3MGPD 4KUDD 1P3BC 4KGCB 5GT3C 4XUJC 1HQ3B 2NZDA 5B2IB 3X1SA 1BH8A 5B2JC 1ID3B 2DQNC 1P3KA 3KUYB 1P3OB 2NZDD 5AY8B 3IP4C 5CPIC 3AZHB 1KU5A 4DRAA 1P3KD 5GXQA 2FJ7A 3REJB 5AVCC 2CV5A 1BH9B 5GXQD 2FJ7D 3NQUA 4AWLB 3UTBB 3B6FA 5AV5B 5B1LC 2CV5D 4Z5TD 3AN2A 3WA9B 3B6FD 2RIQA 5B0YB 2F8NG 1EQZC 2F2AC 5BS7A 4CSRB 4J8XB 3AN2D 3AZMC 4Z2MG 3RELB 3AZEA 3B0DB 1AOIA 3WAAB 3AZGA 3X1UA 5AV6B 3AZED 4KGCC 1KX4B 3AZGD 3X1UD 3UTAD 3REIB 3WKJA 2LY8A 2G5IC 1P3IB 2JSSA 3KUYC 1P3OC 3NQJA 4NE3A 1Z2CB 3AZJA 1S32A 2HUEC 5AY8C 5JRGD 3MNNA 3W97B 5B33B 5KDMA 3KWQA 2AROB 3REJC 3MNND 1M1AB 4H9QB 3A6NA 1B67A 4WV4B 3KWQD 4AWLC 3UTBC 2ZY2A 3AZLA 2F8NH 3A6ND 5F99A 4H9SC 4M6BA 5CPJA 3EPHA 4Z2MH 5JA4B 2IO5B 3AZLD 2NQBC 5B31B 4EO5B 3B6GC 4LD9A 4J8XC 5CPJD 3AFAC 4KHAA 4Z66B 3C1CA 2PYOB 3VH5T 3RELC 4WU8A 4LD9D 3C1CD 3MGPB 3WAAC 4KUDB 5B40A 1P3AA 5AV6C 3UT9D 4WU8D 4H9RA 1KX4C 1ZLAB 1BFMA 2XD1A 4YS3A 5G49A 2YFWA 5B40D 3REIC 1P3AD 1P3IC 3MGSC 2NZDB 3V9RB 4YS3D 4UPKA 5B33C 5CP6C 5B0ZA 3W98D 3WTPC 4WJ3C 5GXQB 5B0ZD 2FJ7B 4HGAC 3AZFC 4UUZA 5CPKC 4ZUXA 2ZY3A 2CV5B 4Z5TB 1P3LA 3B6FB 2IO5C 5B31C 4ZUXD 1U35D 4J8VC 1P3LD 3KXBA 3MVDC 2PYOC 3W96A 3MGQA 5AV8C 3KXBD 1M18D 3MGPC 5B32B 1WWSA 2JCHA 3W96D 3MGQD 4J8UA 3AZEB 5AVBD 1P34D 5DNND 1ZLAC 3AZGB 1TZYC 3VH6A 3X1UB 4J8UD 5B1MA 5BT1D 3UTAB 2NZDC 4JJNA 5JRGB 5B1MD 4WNNA 3KFUG 1F66C 3R45B 3W99C 1P3GD 3MNNB 4R8PA 2Y2QA 5GXQC 3O62C 3KWQB 3AZKA 1TAFA 4G92C 4WZSB 4R8PD 4Z5TC 3A6NB 4G91C 3AZNC 3AZKD 3B6FC 3AZLB 2F8NA 5CPJB 5FUGA 3LJAA 2RVQD 5CHLB 3X1SD 2F8ND 3X1TC 4NE6A 5C3IB 4LD9B 2FFFB 5AV9C 4KHAB 5B32C 3C1CB 5GSUC 4WU9C 3UT9B 4WU8B 3AZEC 3LELA 1B6WA 3AZGC 5BNXA 5B24B 5GT0A 3X1UC 3VH6T 5B40B 3UTAC 3AV2A 1H3OB 1P3AB 2YFVA 4H9RB 3LELD 1P3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM C;  5JRG C;  5GT0 D;  4YS3 B;  1KX3 A;  1JFI B;  5B31 G;  3REH A;  1KX3 D;  3W98 B;  3VH5 A;  4YM6 A;  3KWQ C;  5B0Z B;  3REH D;  1P3P A;  4DRB A;  3A6N C;  4YM6 D;  1HQ3 C;  5BO0 A;  5B2I C;  1AOI D;  4UUZ B;  1ID3 C;  1U35 B;  1P3L B;  5BNV B;  3C1B A;  3WKJ D;  3AZH C;  4LD9 C;  1ULY A;  3KXB B;  5CPI A;  1M18 B;  3C1C C;  4XZQ A;  3AZJ D;  1S32 D;  3C1B D;  3W96 B;  3MGQ B;  3REK A;  3UT9 C;  5AVB B;  1P34 B;  5DNN B;  4XZQ D;  5B24 C;  5AV5 C;  1R4V A;  5B40 C;  3REK D;  4J8U B;  5B1L A;  3WA9 C;  4QLC A;  4H9O A;  5B1M B;  5B1L D;  5F99 D;  5B0Y C;  1N1J B;  1EQZ A;  1P3G B;  3W98 C;  4QLC D;  5E5A A;  4WNN B;  4X23 A;  2BYK B;  3B0D C;  1EQZ D;  3AV1 A;  5E5A D;  4R8P B;  4X23 D;  5B32 G;  3AV1 D;  1KX5 A;  3AZK B;  4KGC A;  3B0C W;  1U35 C;  3X1V A;  1KX5 D;  3X1S B;  3W97 C;  1BH8 B;  2F8N B;  5AY8 A;  2BYM A;  3KXB C;  1M18 C;  1P3K B;  3X1V D;  2ARO C;  5FUG B;  3W96 C;  1M1A C;  5AVB C;  1P34 C;  5DNN C;  4E45 A;  1BH9 A;  5BT1 C;  3LEL B;  3NQU B;  4H9S A;  5GT0 B;  5B1M C;  4EO5 C;  2YFV B;  2NQB A;  3AN2 B;  3B6G A;  4Z66 C;  1P3G C;  4CSR A;  3AFA A;  1KX3 B;  2L5A A;  2NQB D;  3B6G D;  3REH B;  1HTA A;  4KUD C;  3AFA D;  4R8P C;  4YM6 B;  3AYW A;  3AZK C;  1AOI B;  3REI A;  3AYW D;  5BO0 B;  1P3I A;  3TU4 A;  2RVQ C;  3X1S C;  3MGS A;  3WKJ B;  4H9P A;  1P3K C;  3NQJ B;  3TU4 D;  4JJN D;  5CP6 A;  3AZJ B;  3MGS D;  3C1B B;  1S32 B;  1P3M A;  3KSY A;  3WTP A;  2FJ7 C;  5KDM B;  4XZQ B;  5CP6 D;  1P3M D;  3REK B;  3WTP D;  3AZF A;  2CV5 C;  5CPK A;  3LEL C;  3VH6 W;  3MGR A;  3AZF D;  5CPK D;  5B1L B;  5F99 B;  3AN2 C;  4J8V A;  1KX3 C;  3MVD A;  3MGR D;  4QLC B;  2PYO A;  5BS7 C;  4J8W A;  5AV8 A;  4J8V D;  3LJA D;  3REH C;  1EQZ B;  3MVD D;  1WWI A;  5E5A B;  4NE5 A;  4X23 B;  1M19 A;  4J8W D;  5AV8 D;  1AOI C;  3AV1 B;  1ZLA A;  1TZY A;  1M19 D;  3LZ1 A;  3LZ0 A;  3B0B A;  1KX5 B;  1ZLA D;  2HIO A;  2YFW B;  5G49 B;  3V9R A;  1TZY D;  3AV2 D;  3WKJ C;  3LZ1 D;  3LZ0 D;  1P3F D;  3X1V B;  3AZJ C;  1S32 C;  3C1B C;  4H9N A;  2HIO D;  3MNN C;  1F66 A;  3W99 A;  2HUE B;  1F1E A;  2BYM B;  4XZQ C;  1Q9C A;  3O62 A;  3AZI A;  1F66 D;  3W99 D;  3REK C;  1P3P D;  4Z5T A;  3O62 D;  1P3B A;  3AZI D;  4CAY A;  5GT3 A;  4XUJ A;  3AZL C;  3AZN A;  4ZUX B;  5F99 C;  5B2J A;  5CPJ C;  1P3B D;  5GT3 D;  4QLC C;  4ZBJ B;  4XUJ D;  3AZN D;  5C3I C;  5B2J D;  2NQB B;  3X1T A;  3B6G B;  3AFA B;  5AV9 A;  5B32 A;  3VH5 W;  5E5A C;  4X23 C;  5GSU A;  4WU8 C;  5AVC A;  4WU9 A;  3X1T D;  5CPI D;  3AV1 C;  5AV9 D;  5B32 D;  5GSU D;  1P3A C;  5AVC D;  3UTA A;  4WU9 D;  3AYW B;  1KX5 C;  4YS3 C;  5DNM A;  5JRG A;  4E44 A;  3X1V C;  3TU4 B;  4JJN B;  3MGS B;  3R45 A;  5DNM D;  4H9P B;  3AZM A;  5B0Z C;  5CP6 B;  1P3M B;  3AZM D;  3WTP B;  4NFT A;  1TAF B;  4HGA B;  1HQ3 A;  5B2I A;  4ZUX C;  3AZF B;  5CPK B;  1ID3 A;  1P3L C;  4KGC D;  4ZBJ C;  1HQ3 D;  3MGR B;  5B2I D;  3KUY A;  1P3O A;  1A7W A;  1ID3 D;  3AZH A;  4J8V B;  3LJA B;  3KUY D;  3MVD B;  1P3O D;  3REJ A;  3MGQ C;  5AY8 D;  3AZH D;  3UT9 A;  4J8W B;  5AV8 B;  3REJ D;  5B24 A;  3UTB A;  4J8U C;  5AV5 A;  1M19 B;  1H3O A;  3AYW C;  5BNX B;  3WA9 A;  5B24 D;  3UTB D;  3AV2 B;  5AV5 D;  1TZY B;  3LZ1 B;  3LZ0 B;  1JFI A;  1P3F B;  5B0Y A;  3TU4 C;  4JJN C;  3WA9 D;  4J8X A;  2HIO B;  3W98 A;  5B0Y D;  3REL A;  4H9N B;  4J8X D;  1P3M C;  1F66 B;  3W99 B;  3WAA A;  5AV6 A;  3REL D;  1P3P B;  3O62 B;  3AZI B;  1KX4 A;  2F8N K;  3WAA D;  4G92 B;  5AV6 D;  3B0C T;  1U35 A;  1P3B B;  4G91 B;  5BNV A;  2CWE A;  1KX4 D;  3MGR C;  4CAY B;  5GT3 B;  4XUJ B;  3AZN B;  3W97 A;  3REI D;  5B2J B;  3LJA C;  5B33 A;  1P3I D;  1M18 A;  2ARO A;  3W97 D;  1M1A A;  4H9Q A;  4J8W C;  3X1T B;  5CPI B;  5B33 D;  5AVB A;  5DNN A;  1P34 A;  2ARO D;  5AV9 B;  5GSU B;  1M19 C;  1M1A D;  5AVC B;  4WU9 B;  5GT0 C;  3AV2 C;  5JA4 A;  3LZ1 C;  3LZ0 C;  5B31 A;  1P3F C;  2HIO C;  1N1J A;  3WTP E;  4Z66 A;  5DNM B;  4H9O B;  1P3G A;  5B31 D;  2BYK A;  4Z66 D;  3MGP A;  4KUD A;  3AZM B;  2PYO D;  4YM6 C;  1P3P C;  3AZI C;  3MGP D;  4KUD D;  1P3B C;  4KGC B;  5GT3 C;  4XUJ C;  1HQ3 B;  2NZD A;  5B2I B;  3X1S A;  1BH8 A;  5B2J C;  1ID3 B;  1P3K A;  3KUY B;  1P3O B;  2NZD D;  5AY8 B;  5CPI C;  3AZH B;  1KU5 A;  4DRA A;  1P3K D;  5GXQ A;  2FJ7 A;  3REJ B;  5AVC C;  2CV5 A;  1BH9 B;  5GXQ D;  2FJ7 D;  3NQU A;  4AWL B;  3UTB B;  3B6F A;  5AV5 B;  5B1L C;  2CV5 D;  4Z5T D;  3AN2 A;  3WA9 B;  3B6F D;  5B0Y B;  2F8N G;  1EQZ C;  3AN2 D;  5BS7 A;  4CSR B;  4J8X B;  3AZM C;  4Z2M G;  3REL B;  3AZE A;  3B0D B;  1AOI A;  3WAA B;  3AZG A;  3X1U A;  5AV6 B;  3AZE D;  4KGC C;  1KX4 B;  3AZG D;  3X1U D;  3UTA D;  3REI B;  3WKJ A;  2LY8 A;  1P3I B;  2JSS A;  3KUY C;  1P3O C;  3NQJ A;  4NE3 A;  3AZJ A;  1S32 A;  2HUE C;  5AY8 C;  5JRG D;  3MNN A;  3W97 B;  5B33 B;  5KDM A;  3KWQ A;  2ARO B;  3REJ C;  3MNN D;  1M1A B;  4H9Q B;  3A6N A;  1B67 A;  4WV4 B;  3KWQ D;  4AWL C;  3UTB C;  2F8N H;  3AZL A;  3A6N D;  5F99 A;  4H9S C;  4M6B A;  5CPJ A;  4Z2M H;  5JA4 B;  2IO5 B;  3AZL D;  2NQB C;  5B31 B;  4EO5 B;  3B6G C;  4LD9 A;  4J8X C;  5CPJ D;  3AFA C;  4KHA A;  4Z66 B;  3C1C A;  2PYO B;  3VH5 T;  3REL C;  4WU8 A;  4LD9 D;  3C1C D;  3MGP B;  3WAA C;  4KUD B;  5B40 A;  1P3A A;  5AV6 C;  3UT9 D;  4WU8 D;  4H9R A;  1KX4 C;  1ZLA B;  1BFM A;  4YS3 A;  5G49 A;  2YFW A;  5B40 D;  3REI C;  1P3A D;  1P3I C;  3MGS C;  2NZD B;  3V9R B;  4YS3 D;  5B33 C;  5CP6 C;  5B0Z A;  3W98 D;  3WTP C;  5GXQ B;  5B0Z D;  2FJ7 B;  4HGA C;  3AZF C;  4UUZ A;  5CPK C;  4ZUX A;  2CV5 B;  4Z5T B;  1P3L A;  3B6F B;  2IO5 C;  5B31 C;  4ZUX D;  1U35 D;  4J8V C;  1P3L D;  3KXB A;  3MVD C;  2PYO C;  3W96 A;  3MGQ A;  5AV8 C;  3KXB D;  1M18 D;  3MGP C;  5B32 B;  1WWS A;  3W96 D;  3MGQ D;  4J8U A;  3AZE B;  5AVB D;  1P34 D;  5DNN D;  1ZLA C;  3AZG B;  1TZY C;  3VH6 A;  3X1U B;  4J8U D;  5B1M A;  5BT1 D;  3UTA B;  2NZD C;  4JJN A;  5JRG B;  5B1M D;  4WNN A;  1F66 C;  3R45 B;  3W99 C;  1P3G D;  3MNN B;  4R8P A;  5GXQ C;  3O62 C;  3KWQ B;  3AZK A;  1TAF A;  4G92 C;  4WZS B;  4R8P D;  4Z5T C;  3A6N B;  4G91 C;  3AZN C;  3AZK D;  3B6F C;  3AZL B;  2F8N A;  5CPJ B;  5FUG A;  3LJA A;  2RVQ D;  5CHL B;  3X1S D;  2F8N D;  3X1T C;  4NE6 A;  5C3I B;  4LD9 B;  5AV9 C;  4KHA B;  5B32 C;  3C1C B;  5GSU C;  4WU9 C;  3UT9 B;  4WU8 B;  3AZE C;  3LEL A;  1B6W A;  3AZG C;  5BNX A;  5B24 B;  5GT0 A;  3X1U C;  3VH6 T;  5B40 B;  3UTA C;  3AV2 A;  1H3O B;  1P3A B;  2YFV A;  4H9R B;  3LEL D;  1P3F A; 
#chains in the Genus database with same CATH topology
 5DNM C;  5JRG C;  5GT0 D;  4YS3 B;  1KX3 A;  2DF4 C;  1JFI B;  5B31 G;  3REH A;  1KX3 D;  3W98 B;  3VH5 A;  4YM6 A;  3EG5 B;  3H0R C;  5B0Z B;  3KWQ C;  3REH D;  1P3P A;  4DRB A;  3A6N C;  4YM6 D;  2Y2J A;  3F6T A;  1HQ3 C;  5BO0 A;  5B2I C;  1AOI D;  4UUZ B;  1ID3 C;  2BG1 A;  1U35 B;  1P3L B;  5BNV B;  3C1B A;  3WKJ D;  3AZH C;  4LD9 C;  1ULY A;  3KXB B;  5CPI A;  1M18 B;  3C1C C;  4XZQ A;  3AZJ D;  1S32 D;  3C1B D;  3W96 B;  3MGQ B;  3REK A;  3UT9 C;  5AVB B;  1P34 B;  5DNN B;  4XZQ D;  5B24 C;  5AV5 C;  1R4V A;  5B40 C;  3REK D;  4J8U B;  5B1L A;  3EPK A;  3WA9 C;  4QLC A;  4H9O A;  5B1M B;  5B1L D;  5F99 D;  5B0Y C;  2W8S A;  1N1J B;  1EQZ A;  1P3G B;  3W98 C;  4QLC D;  1PZR A;  5E5A A;  4WNN B;  4X23 A;  2BYK B;  3B0D C;  1EQZ D;  3AV1 A;  5E5A D;  4R8P B;  2Y2K A;  3H0L C;  5B32 G;  4X23 D;  3AV1 D;  1KX5 A;  3AZK B;  4KGC A;  2UWX A;  2VQR A;  3B0C W;  1U35 C;  2Y2H A;  3X1V A;  1KX5 D;  3X1S B;  3W97 C;  1BH8 B;  2F8N B;  5AY8 A;  2BYM A;  3KXB C;  1M18 C;  1P3K B;  3X1V D;  2ARO C;  5FUG B;  3W96 C;  1M1A C;  5AVB C;  1P34 C;  5DNN C;  2J8P A;  4E45 A;  1BH9 A;  5BT1 C;  3LEL B;  3NQU B;  4H9S A;  5GT0 B;  5B1M C;  4EO5 C;  2YFV B;  2NQB A;  3AN2 B;  3B6G A;  4Z66 C;  1P3G C;  4CSR A;  3AFA A;  1KX3 B;  2L5A A;  2NQB D;  3B6G D;  3REH B;  1HTA A;  4KUD C;  3AFA D;  4R8P C;  4YM6 B;  3EPL A;  3AYW A;  3AZK C;  1AOI B;  1W2E A;  2Y2G A;  3REI A;  3AYW D;  5BO0 B;  1P3I A;  3TU4 A;  3EPJ A;  2RVQ C;  3X1S C;  3MGS A;  3WKJ B;  4H9P A;  1P3K C;  3NQJ B;  3TU4 D;  4JJN D;  3A1I A;  5CP6 A;  3MGS D;  3C1B B;  3AZJ B;  1S32 B;  3KSY A;  1P3M A;  3WTP A;  2Y2M A;  5KDM B;  2FJ7 C;  3A1K A;  4XZQ B;  5CP6 D;  1P3M D;  3REK B;  3WTP D;  3AZF A;  2CV5 C;  5CPK A;  3LEL C;  2JE5 A;  3VH6 W;  3MGR A;  3AZF D;  5CPK D;  5B1L B;  5F99 B;  3AN2 C;  2Y2N A;  4J8V A;  1KX3 C;  3MVD A;  3MGR D;  4QLC B;  2PYO A;  5BS7 C;  4J8W A;  5AV8 A;  4J8V D;  3LJA D;  3REH C;  1EQZ B;  3MVD D;  1WWI A;  5E5A B;  4NE5 A;  4X23 B;  1M19 A;  4J8W D;  5AV8 D;  1AOI C;  2ZM5 A;  3AV1 B;  1ZLA A;  1TZY A;  1M19 D;  3LZ1 A;  3LZ0 A;  2ZY4 A;  3B0B A;  1KX5 B;  1ZLA D;  2HIO A;  2YFW B;  5G49 B;  3V9R A;  1TZY D;  3AV2 D;  3WKJ C;  2ZY5 A;  3FDD A;  3LZ0 D;  3LZ1 D;  1P3F D;  3X1V B;  3AZJ C;  1S32 C;  3C1B C;  4H9N A;  2HIO D;  3MNN C;  1F66 A;  3W99 A;  2HUE B;  1F1E A;  2BYM B;  4XZQ C;  1Q9C A;  3O62 A;  3AZI A;  1F66 D;  3W99 D;  3REK C;  2G5H C;  1P3P D;  4Z5T A;  3O62 D;  1P3B A;  3AZI D;  4CAY A;  5GT3 A;  4XUJ A;  3AZL C;  3AZN A;  4ZUX B;  5F99 C;  5B2J A;  5CPJ C;  1P3B D;  5GT3 D;  4QLC C;  4ZBJ B;  4XUJ D;  3AZN D;  5C3I C;  5B2J D;  2NQB B;  3X1T A;  2Y2P A;  3B6G B;  3AFA B;  5AV9 A;  5B32 A;  3VH5 W;  5E5A C;  4X23 C;  5GSU A;  4WU8 C;  5AVC A;  4WU9 A;  3X1T D;  5CPI D;  3AV1 C;  5AV9 D;  5B32 D;  5GSU D;  1P3A C;  5AVC D;  3UTA A;  4WU9 D;  3AYW B;  1KX5 C;  4YS3 C;  5DNM A;  5JRG A;  4E44 A;  3X1V C;  3TU4 B;  4JJN B;  3MGS B;  3R45 A;  5DNM D;  4H9P B;  3AZM A;  5B0Z C;  5CP6 B;  1P3M B;  3AZM D;  3WTP B;  4NFT A;  1TAF B;  4HGA B;  1HQ3 A;  5B2I A;  4ZUX C;  3AZF B;  5CPK B;  1ID3 A;  1P3L C;  4KGC D;  2Y2I A;  1HQ3 D;  4ZBJ C;  5B2I D;  3MGR B;  3KUY A;  1P3O A;  1A7W A;  1ID3 D;  3AZH A;  4J8V B;  3LJA B;  3KUY D;  3MVD B;  1P3O D;  3REJ A;  3MGQ C;  5AY8 D;  1T3U A;  3UT9 A;  3AZH D;  4J8W B;  5AV8 B;  3REJ D;  5B24 A;  3P5J B;  4J8U C;  3UTB A;  5AV5 A;  1M19 B;  1H3O A;  3AYW C;  3AL0 C;  5BNX B;  3WA9 A;  5B24 D;  3UTB D;  3AV2 B;  5AV5 D;  1TZY B;  3LZ1 B;  3LZ0 B;  1JFI A;  1P3F B;  5B0Y A;  3TU4 C;  4JJN C;  3WA9 D;  4J8X A;  2HIO B;  2XD5 A;  3W98 A;  5B0Y D;  3REL A;  4H9N B;  4J8X D;  1P3M C;  1F66 B;  3W99 B;  3WAA A;  4DQY B;  5AV6 A;  3REL D;  1P3P B;  3O62 B;  3AZI B;  1KX4 A;  2F8N K;  3WAA D;  4G92 B;  5AV6 D;  3B0C T;  1U35 A;  1P3B B;  4G91 B;  5BNV A;  2CWE A;  1KX4 D;  3MGR C;  4CAY B;  5GT3 B;  4XUJ B;  3AZN B;  3W97 A;  3REI D;  5B2J B;  3H0M C;  3LJA C;  5B33 A;  1P3I D;  1M18 A;  2ARO A;  3W97 D;  1M1A A;  4H9Q A;  4J8W C;  3X1T B;  5CPI B;  5B33 D;  5AVB A;  5DNN A;  1P34 A;  2ARO D;  5AV9 B;  5GSU B;  1M19 C;  1M1A D;  5AVC B;  4WU9 B;  2Y2L A;  5GT0 C;  3AV2 C;  5JA4 A;  3LZ1 C;  2Y2O A;  3LZ0 C;  5B31 A;  1P3F C;  2HIO C;  1N1J A;  3WTP E;  4Z66 A;  5DNM B;  4H9O B;  1P3G A;  5B31 D;  2BYK A;  4Z66 D;  3MGP A;  4KUD A;  3AZM B;  2PYO D;  4YM6 C;  1P3P C;  3AZI C;  3MGP D;  4KUD D;  1P3B C;  4KGC B;  5GT3 C;  4XUJ C;  1HQ3 B;  2NZD A;  5B2I B;  3X1S A;  1BH8 A;  5B2J C;  1ID3 B;  2DQN C;  1P3K A;  3KUY B;  1P3O B;  2NZD D;  5AY8 B;  3IP4 C;  5CPI C;  3AZH B;  1KU5 A;  4DRA A;  1P3K D;  5GXQ A;  2FJ7 A;  3REJ B;  5AVC C;  2CV5 A;  1BH9 B;  5GXQ D;  2FJ7 D;  3NQU A;  4AWL B;  3UTB B;  3B6F A;  5AV5 B;  5B1L C;  2CV5 D;  4Z5T D;  3AN2 A;  3WA9 B;  3B6F D;  2RIQ A;  5B0Y B;  2F8N G;  1EQZ C;  2F2A C;  5BS7 A;  4CSR B;  4J8X B;  3AN2 D;  3AZM C;  4Z2M G;  3REL B;  3AZE A;  3B0D B;  1AOI A;  3WAA B;  3AZG A;  3X1U A;  5AV6 B;  3AZE D;  4KGC C;  1KX4 B;  3AZG D;  3X1U D;  3UTA D;  3REI B;  3WKJ A;  2LY8 A;  2G5I C;  1P3I B;  2JSS A;  3KUY C;  1P3O C;  3NQJ A;  4NE3 A;  1Z2C B;  3AZJ A;  1S32 A;  2HUE C;  5AY8 C;  5JRG D;  3MNN A;  3W97 B;  5B33 B;  5KDM A;  3KWQ A;  2ARO B;  3REJ C;  3MNN D;  1M1A B;  4H9Q B;  3A6N A;  1B67 A;  4WV4 B;  3KWQ D;  4AWL C;  3UTB C;  2ZY2 A;  3AZL A;  2F8N H;  3A6N D;  5F99 A;  4H9S C;  4M6B A;  5CPJ A;  3EPH A;  4Z2M H;  5JA4 B;  2IO5 B;  3AZL D;  2NQB C;  5B31 B;  4EO5 B;  3B6G C;  4LD9 A;  4J8X C;  5CPJ D;  3AFA C;  4KHA A;  4Z66 B;  3C1C A;  2PYO B;  3VH5 T;  3REL C;  4WU8 A;  4LD9 D;  3C1C D;  3MGP B;  3WAA C;  4KUD B;  5B40 A;  1P3A A;  5AV6 C;  3UT9 D;  4WU8 D;  4H9R A;  1KX4 C;  1ZLA B;  1BFM A;  2XD1 A;  4YS3 A;  5G49 A;  2YFW A;  5B40 D;  3REI C;  1P3A D;  1P3I C;  3MGS C;  2NZD B;  3V9R B;  4YS3 D;  4UPK A;  5B33 C;  5CP6 C;  5B0Z A;  3W98 D;  3WTP C;  4WJ3 C;  5GXQ B;  5B0Z D;  2FJ7 B;  4HGA C;  3AZF C;  4UUZ A;  5CPK C;  4ZUX A;  2ZY3 A;  2CV5 B;  4Z5T B;  1P3L A;  3B6F B;  2IO5 C;  5B31 C;  4ZUX D;  1U35 D;  4J8V C;  1P3L D;  3KXB A;  3MVD C;  2PYO C;  3W96 A;  3MGQ A;  5AV8 C;  3KXB D;  1M18 D;  3MGP C;  5B32 B;  1WWS A;  2JCH A;  3W96 D;  3MGQ D;  4J8U A;  3AZE B;  5AVB D;  1P34 D;  5DNN D;  1ZLA C;  3AZG B;  1TZY C;  3VH6 A;  3X1U B;  4J8U D;  5B1M A;  5BT1 D;  3UTA B;  2NZD C;  4JJN A;  5JRG B;  5B1M D;  4WNN A;  3KFU G;  1F66 C;  3R45 B;  3W99 C;  1P3G D;  3MNN B;  4R8P A;  2Y2Q A;  5GXQ C;  3O62 C;  3KWQ B;  3AZK A;  1TAF A;  4G92 C;  4WZS B;  4R8P D;  4Z5T C;  3A6N B;  4G91 C;  3AZN C;  3AZK D;  3B6F C;  3AZL B;  2F8N A;  5CPJ B;  5FUG A;  3LJA A;  2RVQ D;  5CHL B;  3X1S D;  2F8N D;  3X1T C;  4NE6 A;  5C3I B;  4LD9 B;  2FFF B;  5AV9 C;  4KHA B;  5B32 C;  3C1C B;  5GSU C;  4WU9 C;  3UT9 B;  4WU8 B;  3AZE C;  3LEL A;  1B6W A;  3AZG C;  5BNX A;  5B24 B;  5GT0 A;  3X1U C;  3VH6 T;  5B40 B;  3UTA C;  3AV2 A;  1H3O B;  1P3A B;  2YFV A;  4H9R B;  3LEL D;  1P3F A; 
#chains in the Genus database with same CATH homology
 5DNM C;  5JRG C;  5GT0 D;  4YS3 B;  1KX3 A;  2DF4 C;  1JFI B;  5B31 G;  3REH A;  1KX3 D;  3W98 B;  3VH5 A;  4YM6 A;  3EG5 B;  3H0R C;  5B0Z B;  3KWQ C;  3REH D;  1P3P A;  4DRB A;  3A6N C;  4YM6 D;  2Y2J A;  3F6T A;  1HQ3 C;  5BO0 A;  5B2I C;  1AOI D;  4UUZ B;  1ID3 C;  2BG1 A;  1U35 B;  1P3L B;  5BNV B;  3C1B A;  3WKJ D;  3AZH C;  4LD9 C;  1ULY A;  3KXB B;  5CPI A;  1M18 B;  3C1C C;  4XZQ A;  3AZJ D;  1S32 D;  3C1B D;  3W96 B;  3MGQ B;  3REK A;  3UT9 C;  5AVB B;  1P34 B;  5DNN B;  4XZQ D;  5B24 C;  5AV5 C;  1R4V A;  5B40 C;  3REK D;  4J8U B;  5B1L A;  3EPK A;  3WA9 C;  4QLC A;  4H9O A;  5B1M B;  5B1L D;  5F99 D;  5B0Y C;  2W8S A;  1N1J B;  1EQZ A;  1P3G B;  3W98 C;  4QLC D;  1PZR A;  5E5A A;  4WNN B;  4X23 A;  2BYK B;  3B0D C;  1EQZ D;  3AV1 A;  5E5A D;  4R8P B;  2Y2K A;  3H0L C;  5B32 G;  4X23 D;  3AV1 D;  1KX5 A;  3AZK B;  4KGC A;  2UWX A;  2VQR A;  3B0C W;  1U35 C;  2Y2H A;  3X1V A;  1KX5 D;  3X1S B;  3W97 C;  1BH8 B;  2F8N B;  5AY8 A;  2BYM A;  3KXB C;  1M18 C;  1P3K B;  3X1V D;  2ARO C;  5FUG B;  3W96 C;  1M1A C;  5AVB C;  1P34 C;  5DNN C;  2J8P A;  4E45 A;  1BH9 A;  5BT1 C;  3LEL B;  3NQU B;  4H9S A;  5GT0 B;  5B1M C;  4EO5 C;  2YFV B;  2NQB A;  3AN2 B;  3B6G A;  4Z66 C;  1P3G C;  4CSR A;  3AFA A;  1KX3 B;  2L5A A;  2NQB D;  3B6G D;  3REH B;  1HTA A;  4KUD C;  3AFA D;  4R8P C;  4YM6 B;  3EPL A;  3AYW A;  3AZK C;  1AOI B;  1W2E A;  2Y2G A;  3REI A;  3AYW D;  5BO0 B;  1P3I A;  3TU4 A;  3EPJ A;  2RVQ C;  3X1S C;  3MGS A;  3WKJ B;  4H9P A;  1P3K C;  3NQJ B;  3TU4 D;  4JJN D;  3A1I A;  5CP6 A;  3MGS D;  3C1B B;  3AZJ B;  1S32 B;  3KSY A;  1P3M A;  3WTP A;  2Y2M A;  5KDM B;  2FJ7 C;  3A1K A;  4XZQ B;  5CP6 D;  1P3M D;  3REK B;  3WTP D;  3AZF A;  2CV5 C;  5CPK A;  3LEL C;  2JE5 A;  3VH6 W;  3MGR A;  3AZF D;  5CPK D;  5B1L B;  5F99 B;  3AN2 C;  2Y2N A;  4J8V A;  1KX3 C;  3MVD A;  3MGR D;  4QLC B;  2PYO A;  5BS7 C;  4J8W A;  5AV8 A;  4J8V D;  3LJA D;  3REH C;  1EQZ B;  3MVD D;  1WWI A;  5E5A B;  4NE5 A;  4X23 B;  1M19 A;  4J8W D;  5AV8 D;  1AOI C;  2ZM5 A;  3AV1 B;  1ZLA A;  1TZY A;  1M19 D;  3LZ1 A;  3LZ0 A;  2ZY4 A;  3B0B A;  1KX5 B;  1ZLA D;  2HIO A;  2YFW B;  5G49 B;  3V9R A;  1TZY D;  3AV2 D;  3WKJ C;  2ZY5 A;  3FDD A;  3LZ0 D;  3LZ1 D;  1P3F D;  3X1V B;  3AZJ C;  1S32 C;  3C1B C;  4H9N A;  2HIO D;  3MNN C;  1F66 A;  3W99 A;  2HUE B;  1F1E A;  2BYM B;  4XZQ C;  1Q9C A;  3O62 A;  3AZI A;  1F66 D;  3W99 D;  3REK C;  2G5H C;  1P3P D;  4Z5T A;  3O62 D;  1P3B A;  3AZI D;  4CAY A;  5GT3 A;  4XUJ A;  3AZL C;  3AZN A;  4ZUX B;  5F99 C;  5B2J A;  5CPJ C;  1P3B D;  5GT3 D;  4QLC C;  4ZBJ B;  4XUJ D;  3AZN D;  5C3I C;  5B2J D;  2NQB B;  3X1T A;  2Y2P A;  3B6G B;  3AFA B;  5AV9 A;  5B32 A;  3VH5 W;  5E5A C;  4X23 C;  5GSU A;  4WU8 C;  5AVC A;  4WU9 A;  3X1T D;  5CPI D;  3AV1 C;  5AV9 D;  5B32 D;  5GSU D;  1P3A C;  5AVC D;  3UTA A;  4WU9 D;  3AYW B;  1KX5 C;  4YS3 C;  5DNM A;  5JRG A;  4E44 A;  3X1V C;  3TU4 B;  4JJN B;  3MGS B;  3R45 A;  5DNM D;  4H9P B;  3AZM A;  5B0Z C;  5CP6 B;  1P3M B;  3AZM D;  3WTP B;  4NFT A;  1TAF B;  4HGA B;  1HQ3 A;  5B2I A;  4ZUX C;  3AZF B;  5CPK B;  1ID3 A;  1P3L C;  4KGC D;  2Y2I A;  1HQ3 D;  4ZBJ C;  5B2I D;  3MGR B;  3KUY A;  1P3O A;  1A7W A;  1ID3 D;  3AZH A;  4J8V B;  3LJA B;  3KUY D;  3MVD B;  1P3O D;  3REJ A;  3MGQ C;  5AY8 D;  1T3U A;  3UT9 A;  3AZH D;  4J8W B;  5AV8 B;  3REJ D;  5B24 A;  3P5J B;  4J8U C;  3UTB A;  5AV5 A;  1M19 B;  1H3O A;  3AYW C;  3AL0 C;  5BNX B;  3WA9 A;  5B24 D;  3UTB D;  3AV2 B;  5AV5 D;  1TZY B;  3LZ1 B;  3LZ0 B;  1JFI A;  1P3F B;  5B0Y A;  3TU4 C;  4JJN C;  3WA9 D;  4J8X A;  2HIO B;  2XD5 A;  3W98 A;  5B0Y D;  3REL A;  4H9N B;  4J8X D;  1P3M C;  1F66 B;  3W99 B;  3WAA A;  4DQY B;  5AV6 A;  3REL D;  1P3P B;  3O62 B;  3AZI B;  1KX4 A;  2F8N K;  3WAA D;  4G92 B;  5AV6 D;  3B0C T;  1U35 A;  1P3B B;  4G91 B;  5BNV A;  2CWE A;  1KX4 D;  3MGR C;  4CAY B;  5GT3 B;  4XUJ B;  3AZN B;  3W97 A;  3REI D;  5B2J B;  3H0M C;  3LJA C;  5B33 A;  1P3I D;  1M18 A;  2ARO A;  3W97 D;  1M1A A;  4H9Q A;  4J8W C;  3X1T B;  5CPI B;  5B33 D;  5AVB A;  5DNN A;  1P34 A;  2ARO D;  5AV9 B;  5GSU B;  1M19 C;  1M1A D;  5AVC B;  4WU9 B;  2Y2L A;  5GT0 C;  3AV2 C;  5JA4 A;  3LZ1 C;  2Y2O A;  3LZ0 C;  5B31 A;  1P3F C;  2HIO C;  1N1J A;  3WTP E;  4Z66 A;  5DNM B;  4H9O B;  1P3G A;  5B31 D;  2BYK A;  4Z66 D;  3MGP A;  4KUD A;  3AZM B;  2PYO D;  4YM6 C;  1P3P C;  3AZI C;  3MGP D;  4KUD D;  1P3B C;  4KGC B;  5GT3 C;  4XUJ C;  1HQ3 B;  2NZD A;  5B2I B;  3X1S A;  1BH8 A;  5B2J C;  1ID3 B;  2DQN C;  1P3K A;  3KUY B;  1P3O B;  2NZD D;  5AY8 B;  3IP4 C;  5CPI C;  3AZH B;  1KU5 A;  4DRA A;  1P3K D;  5GXQ A;  2FJ7 A;  3REJ B;  5AVC C;  2CV5 A;  1BH9 B;  5GXQ D;  2FJ7 D;  3NQU A;  4AWL B;  3UTB B;  3B6F A;  5AV5 B;  5B1L C;  2CV5 D;  4Z5T D;  3AN2 A;  3WA9 B;  3B6F D;  2RIQ A;  5B0Y B;  2F8N G;  1EQZ C;  2F2A C;  5BS7 A;  4CSR B;  4J8X B;  3AN2 D;  3AZM C;  4Z2M G;  3REL B;  3AZE A;  3B0D B;  1AOI A;  3WAA B;  3AZG A;  3X1U A;  5AV6 B;  3AZE D;  4KGC C;  1KX4 B;  3AZG D;  3X1U D;  3UTA D;  3REI B;  3WKJ A;  2LY8 A;  2G5I C;  1P3I B;  2JSS A;  3KUY C;  1P3O C;  3NQJ A;  4NE3 A;  1Z2C B;  3AZJ A;  1S32 A;  2HUE C;  5AY8 C;  5JRG D;  3MNN A;  3W97 B;  5B33 B;  5KDM A;  3KWQ A;  2ARO B;  3REJ C;  3MNN D;  1M1A B;  4H9Q B;  3A6N A;  1B67 A;  4WV4 B;  3KWQ D;  4AWL C;  3UTB C;  2ZY2 A;  3AZL A;  2F8N H;  3A6N D;  5F99 A;  4H9S C;  4M6B A;  5CPJ A;  3EPH A;  4Z2M H;  5JA4 B;  2IO5 B;  3AZL D;  2NQB C;  5B31 B;  4EO5 B;  3B6G C;  4LD9 A;  4J8X C;  5CPJ D;  3AFA C;  4KHA A;  4Z66 B;  3C1C A;  2PYO B;  3VH5 T;  3REL C;  4WU8 A;  4LD9 D;  3C1C D;  3MGP B;  3WAA C;  4KUD B;  5B40 A;  1P3A A;  5AV6 C;  3UT9 D;  4WU8 D;  4H9R A;  1KX4 C;  1ZLA B;  1BFM A;  2XD1 A;  4YS3 A;  5G49 A;  2YFW A;  5B40 D;  3REI C;  1P3A D;  1P3I C;  3MGS C;  2NZD B;  3V9R B;  4YS3 D;  4UPK A;  5B33 C;  5CP6 C;  5B0Z A;  3W98 D;  3WTP C;  4WJ3 C;  5GXQ B;  5B0Z D;  2FJ7 B;  4HGA C;  3AZF C;  4UUZ A;  5CPK C;  4ZUX A;  2ZY3 A;  2CV5 B;  4Z5T B;  1P3L A;  3B6F B;  2IO5 C;  5B31 C;  4ZUX D;  1U35 D;  4J8V C;  1P3L D;  3KXB A;  3MVD C;  2PYO C;  3W96 A;  3MGQ A;  5AV8 C;  3KXB D;  1M18 D;  3MGP C;  5B32 B;  1WWS A;  2JCH A;  3W96 D;  3MGQ D;  4J8U A;  3AZE B;  5AVB D;  1P34 D;  5DNN D;  1ZLA C;  3AZG B;  1TZY C;  3VH6 A;  3X1U B;  4J8U D;  5B1M A;  5BT1 D;  3UTA B;  2NZD C;  4JJN A;  5JRG B;  5B1M D;  4WNN A;  3KFU G;  1F66 C;  3R45 B;  3W99 C;  1P3G D;  3MNN B;  4R8P A;  2Y2Q A;  5GXQ C;  3O62 C;  3KWQ B;  3AZK A;  1TAF A;  4G92 C;  4WZS B;  4R8P D;  4Z5T C;  3A6N B;  4G91 C;  3AZN C;  3AZK D;  3B6F C;  3AZL B;  2F8N A;  5CPJ B;  5FUG A;  3LJA A;  2RVQ D;  5CHL B;  3X1S D;  2F8N D;  3X1T C;  4NE6 A;  5C3I B;  4LD9 B;  2FFF B;  5AV9 C;  4KHA B;  5B32 C;  3C1C B;  5GSU C;  4WU9 C;  3UT9 B;  4WU8 B;  3AZE C;  3LEL A;  1B6W A;  3AZG C;  5BNX A;  5B24 B;  5GT0 A;  3X1U C;  3VH6 T;  5B40 B;  3UTA C;  3AV2 A;  1H3O B;  1P3A B;  2YFV A;  4H9R B;  3LEL D;  1P3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...