1F66B

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66B00
4LD9A 4CAYB 3AZGA 3MNND 4LD9B 4YS3D 3UTAD 3AZGB 1TZYC 4YS3A 3RELD 3KXBC 1M1AD 5F99C 4YS3B 3LZ1D 1M1AA 3RELB 3MVDC 3B0DB 3LZ1A 1M1AB 3AZMD 5B1MD 3LZ1B 3AZMA 4Z5TC 5B1MA 3AZMB 5B1MB 1P3IA 3WA9D 4XZQC 1P3PD 1P3IB 4XUJA 4G91C 3WA9A 5DNNC 1S32C 4XUJB 1P3LC 2NZDC 3WA9B 3WAAC 4WV4B 2IO5C 1WWSA 3VH5T 3V9RA 4WZSB 3LELD 4EO5C 5B2IA 1TAFB 3AZKD 2HIOC 3B0CW 5B2IB 3LELA 3KUYC 3AZKA 1N1JA 4J8XC 3LELB 3AZKB 1N1JB 4H9PA 4J8VD 3MGPC 1P3OD 3R45A 4H9PB 5AV8A 2CWEA 3R45B 4J8VA 1P3OA 4J8VB 1P3OB 3W98C 1KX4D 3REIA 3REIB 4E44A 5CPIC 3WKJD 5CPJD 4J8WC 3UTBD 5CPJA 4Z2MH 3UTBA 5CPJB 3UTBB 5B1LC 3W97D 3WTPC 5B32D 3A6ND 5B32A 1HTAA 5AY8D 3C1BD 1EQZD 5B32B 5AY8A 5B31C 3A6NB 3C1BA 1EQZA 3KWQC 5AY8B 4YM6D 3C1BB 1EQZB 3W96D 4YM6A 4WU9C 5JRGD 3X1SD 3W96A 4YM6B 3UT9A 3AZFD 5G49A 4ZUXD 5JRGA 3W96B 3X1SA 3UT9B 3AZFA 3AN2C 5JRGB 3X1SB 3AZFB 2AROC 5BS7C 5BT1D 4ZUXB 3AV2C 5B31G 3KWQA 5JA4A 5JA4B 2FJ7C 4H9OA 2F8ND 4WU9A 1P3GD 1U35C 1P3GA 5DNMD 5AV5D 1P3GB 4WU8C 2AROA 5DNMA 3AV2A 3REJD 5DNMB 5AV5B 1KX5C 5CP6D 2NQBA 5B40D 2NQBB 5CP6A 3REJB 5CP6B 3X1VC 5BNVA 3MGRD 1M19C 5B40B 3REKD 5BNVB 3MGRA 1H3OA 5CPKD 1BFMA 1P3KA 3MGRB 1H3OB 4KGCC 5B0YD 5CPKA 1P3KB 3TU4C 3KSYA 5AV9C 5B0YA 5CPKB 4J8UC 5B0YB 3O62C 3X1VA 1P34D 1JFIA 5B33D 5AVBD 3AZID 5B33A 5AVBA 3AZIA 5B33B 5AVBB 3AZIB 3NQUA 3NQUB 5B2JD 4ZBJB 3MGQA 5GSUA 1AOIC 5B2JA 3MGQB 5GXQD 4CSRA 5GSUB 5B2JB 4AWLC 4CSRB 5GXQA 4LD9C 5GXQB 3AZGC 3AFAA 1WWIA 4X23D 4NE5A 3AYWD 3AFAB 3W99A 3B0CT 3W99B 4YS3C 4X23A 3AYWA 1AOIA 5CHLB 4X23B 3AYWB 3RELC 5AVCD 1P3MD 3B0DC 1M1AC 2YFVA 5AVCA 3LZ1C 1P3MA 2YFVB 2YFWA 1P3BD 5AVCB 1P3MB 2YFWB 4E45A 3AZMC 1P3AD 5B1MC 4Z2MG 3MNNA 1P3BA 3UTAA 1P3BB 3MNNB 4JJND 1P3IC 3UTAB 3RELA 3AV1D 3B6GD 4XUJC 3WA9C 3AV1A 3AV1B 3B6GB 5GT3D 5GT0D 5GT3A 5GT0A 1M18D 1P3PA 4H9NA 5GT0B 5GT3B 5B2IC 3B6FD 1P3PB 4H9NB 1M18A 3LELC 3AZKC 1M18B 5E5AD 5AV6D 5AV6B 5AV8C 4J8VC 1TAFA 1P3OC 1A7WA 4UUZA 3REIC 4UUZB 3MVDD 3LZ0D 5CPJC 3UTBC 3MGSD 3LJAD 3LZ0A 3MGSA 1P3FD 3LZ0B 3LJAA 3MGSB 3LJAB 1KX4A 1P3FA 1KX3D 1B6WA 5B32C 1P3FB 1KX4B 1KX3A 5DNND 1S32D 4H9RA 3AZED 1KX3B 3WKJA 5AY8C 3C1BC 3WAAD 1EQZC 4H9RB 1F66D 3WKJB 3AZEA 3AZHD 1F66A 3AZEB 4YM6C 3AZHA 1F66B 3W97A 3W96C 3C1CD 3UT9C 3AZHB 5JRGC 3W97B 3X1SC 3AZFC 3C1CA 4ZUXC 3A6NA 3C1CB 2HIOD 4J8XD 5BT1C 5KDMA 5KDMB 4NFTA 1P3GC 4ZUXA 5DNMC 1HQ3D 3VH6T 2NQBC 3REJC 1HQ3A 5CP6C 4Z66D 1ID3D 4J8WD 1HQ3B 5B40C 2F8NA 4Z66A 1ID3A 4DRBA 2F8NB 4Z66B 5C3IB 1ID3B 4J8WB 2PYOD 3MGRC 3VH5A 5AV5A 2LY8A 1P3KC 2PYOA 5CPKC 2CV5D 2PYOB 3REJA 2BYKA 5B0YC 2CV5A 2BYKB 2CV5B 5B40A 4NE3A 3VH5W 5B31D 3REKA 5B33C 5B31B 3REKB 5AVBC 3AZIC 4HGAB 3AN2D 4ZBJC 5FUGA 4QLCD 3MGQC 5FUGB 5GSUC 4QLCA 5B2JC 4KHAA 4R8PD 4QLCB 1P34A 4KHAB 5GXQC 4R8PA 1P34B 4R8PB 3AFAC 3W99C 3AZJD 4H9SA 4WU8D 4X23C 3AZJA 3AYWC 5B0ZD 3AZJB 2JSSA 5B0ZA 3WTPE 3REHD 5B0ZB 5AVCC 1P3MC 3REHA 3REHB 1P3BC 3X1TD 3MNNC 3UTAC 3X1TA 4G92B 3X1TB 2RVQD 3AV1C 3B6GC 4NE6A 5B24D 3O62D 3AZLD 3AZND 5B24A 3AZLA 1R4VA 3AZNA 5B24B 3AZLB 1P3AA 2F8NK 3AZNB 1P3AB 5GT3C 5GT0C 4JJNA 1P3PC 4JJNB 3B6GA 1M18C 1KU5A 4KUDD 4LD9D 3AZGD 4KUDA 4KUDB 3B6FA 3X1UD 1ZLAD 2HUEB 3B6FB 1F1EA 2BYMA 3X1UA 5E5AA 1ZLAA 5AV6A 2BYMB 3X1UB 5E5AB 1ZLAB 3LZ0C 3MGSC 1TZYD 3LJAC 3KXBD 1KX4C 1TZYA 5F99D 1P3ID 1P3FC 1TZYB 3KXBA 4XUJD 5F99A 1KX3C 3KXBB 5F99B 3WKJC 3MVDA 3AZEC 4Z5TD 3MVDB 1F66C 4Z5TA 3AZHC 3W97C 4Z5TB 4XZQD 3C1CC 3A6NC 4XZQA 5B2ID 1P3LD 2NZDD 4XZQB 5DNNA 1S32A 1P3LA 4G91B 3V9RB 5DNNB 1S32B 3WAAA 2NZDA 1P3LB 2NZDB 3WAAB 2IO5B 5B32G 5AV8D 4WNNA 4WNNB 1Q9CA 3REID 5AV8B 3KUYD 2HIOA 4DRAA 4EO5B 3KUYA 1HQ3C 2HIOB 4J8XA 3MGPD 3KUYB 4J8XB 4Z66C 5C3IC 1ID3C 3MGPA 3MGPB 3W98D 5AV5C 2PYOC 3W98A 5CPID 3W98B 2CV5C 5CPIA 2F8NG 5CPIB 4J8WA 5BNXA 5B1LD 5BNXB 3REKC 3WTPD 5B1LA 4HGAC 1BH9A 3WTPA 3UT9D 5B1LB 1BH9B 3WTPB 5G49B 3KWQD 4QLCC 1BH8A 5B31A 1P34C 1BH8B 4R8PC 4WU9D 1ULYA 3KWQB 4H9OB 4H9SC 4WU9B 2AROD 3AZJC 3AV2D 3AN2A 3AN2B 5BS7A 2NQBD 5B0ZC 2FJ7D 2AROB 3AV2B 1U35D 2FJ7A 3REHC 4M6BA 2FJ7B 1U35A 2L5AA 1U35B 4G92C 1P3KD 3X1TC 4WU8A 5BO0A 1KX5D 3NQJA 4WU8B 5BO0B 3NQJB 1KX5A 2RVQC 1KX5B 3X1VD 1M19D 5B24C 3AZLC 1M19A 3AZNC 3X1VB 1P3AC 1M19B 4KGCD 1JFIB 4JJNC 3TU4D 5AV9D 4KGCA 2F8NH 3VH6A 4KGCB 4J8UD 3TU4A 5AV9A 3TU4B 5AV9B 3MGQD 4J8UA 5GSUD 3O62A 4J8UB 4H9QA 3O62B 4H9QB 3VH6W 3B0BA 3AFAD 4KUDC 3W99D 2HUEC 3B6FC 1AOID 3X1UC 5E5AC 1ZLAC 1B67A 5AV6C 1AOIB 4CAYA 4AWLB
chains in the Genus database with same CATH superfamily
4LD9A 2XD5A 4CAYB 3AZGA 3MNND 4LD9B 4YS3D 3UTAD 3AZGB 3P5JB 1TZYC 2ZM5A 4YS3A 3RELD 3KXBC 1M1AD 5F99C 4YS3B 3LZ1D 1M1AA 3RELB 3MVDC 3B0DB 3LZ1A 1M1AB 3AZMD 5B1MD 3LZ1B 1T3UA 3AZMA 4Z5TC 5B1MA 3AZMB 5B1MB 1P3IA 3WA9D 4XZQC 1P3PD 1P3IB 4XUJA 4G91C 2Y2QA 5DNNC 1S32C 3WA9A 4XUJB 1P3LC 2NZDC 3WA9B 3WAAC 4WV4B 2IO5C 1WWSA 2Y2HA 2J8PA 3VH5T 3V9RA 4WZSB 3LELD 4EO5C 5B2IA 2Y2KA 1TAFB 3AZKD 2HIOC 3B0CW 5B2IB 3LELA 3KUYC 3AZKA 1N1JA 4J8XC 3LELB 3AZKB 1N1JB 4H9PA 4J8VD 3MGPC 1P3OD 3R45A 4H9PB 5AV8A 2CWEA 3R45B 4J8VA 1P3OA 4J8VB 1P3OB 3W98C 1KX4D 3REIA 3REIB 4E44A 5CPIC 3WKJD 5CPJD 4J8WC 3UTBD 5CPJA 4Z2MH 3UTBA 5CPJB 3UTBB 5B1LC 3W97D 3WTPC 5B32D 3EPKA 3A6ND 5B32A 1HTAA 5AY8D 3C1BD 1EQZD 5B32B 5AY8A 5B31C 3A6NB 3C1BA 1EQZA 3KWQC 5AY8B 4YM6D 3C1BB 1EQZB 3W96D 4YM6A 2VQRA 4WU9C 5JRGD 3X1SD 3W96A 4YM6B 3UT9A 3AZFD 5G49A 4ZUXD 5JRGA 3W96B 3X1SA 3UT9B 3AZFA 3AN2C 5JRGB 3X1SB 3AZFB 2AROC 5BS7C 5BT1D 4ZUXB 3AV2C 5B31G 3KWQA 5JA4A 5JA4B 2FJ7C 3A1IA 4H9OA 2F8ND 4WU9A 1P3GD 1U35C 1P3GA 5DNMD 5AV5D 1P3GB 4WU8C 2AROA 5DNMA 3AV2A 3REJD 5DNMB 5AV5B 1KX5C 5CP6D 2NQBA 5B40D 2NQBB 5CP6A 3REJB 5CP6B 3X1VC 5BNVA 3MGRD 1M19C 5B40B 3REKD 5BNVB 3MGRA 1H3OA 5CPKD 1BFMA 1P3KA 3MGRB 1H3OB 4KGCC 5B0YD 5CPKA 1P3KB 3TU4C 3KSYA 5AV9C 5B0YA 5CPKB 4J8UC 5B0YB 3O62C 3X1VA 1P34D 1JFIA 5B33D 5AVBD 3AZID 5B33A 5AVBA 3AZIA 5B33B 5AVBB 3AZIB 3NQUA 3NQUB 5B2JD 4ZBJB 3MGQA 5GSUA 1AOIC 5B2JA 3MGQB 5GXQD 4CSRA 5GSUB 5B2JB 4AWLC 4CSRB 5GXQA 4LD9C 5GXQB 3AZGC 3AFAA 1WWIA 4X23D 4NE5A 3AYWD 3AFAB 3W99A 3B0CT 3W99B 4YS3C 4X23A 3AYWA 1AOIA 5CHLB 4X23B 3AYWB 3RELC 5AVCD 1P3MD 2G5IC 3B0DC 1M1AC 2YFVA 5AVCA 3LZ1C 1P3MA 2YFVB 2YFWA 1P3BD 5AVCB 1P3MB 2YFWB 4E45A 3EPLA 3AZMC 5B1MC 4Z2MG 3MNNA 1P3AD 1P3BA 2UWXA 3UTAA 1P3BB 3MNNB 4JJND 1P3IC 3UTAB 3RELA 3AV1D 3B6GD 4XUJC 3WA9C 3AV1A 3AV1B 3B6GB 5GT3D 5GT0D 5GT3A 5GT0A 1M18D 1P3PA 4H9NA 5GT0B 5GT3B 5B2IC 3B6FD 1P3PB 4H9NB 1M18A 3LELC 3AZKC 1M18B 5E5AD 5AV6D 2ZY5A 5AV6B 5AV8C 4J8VC 1TAFA 1P3OC 1A7WA 4UUZA 3REIC 4UUZB 3H0RC 3MVDD 3LZ0D 5CPJC 2FFFB 3MGSD 3UTBC 3LJAD 3LZ0A 3MGSA 3F6TA 1P3FD 3LZ0B 3LJAA 3MGSB 3LJAB 1KX4A 1P3FA 1KX3D 1B6WA 5B32C 1P3FB 1KX4B 1KX3A 5DNND 1S32D 4H9RA 3AZED 1KX3B 3WKJA 5AY8C 3C1BC 3WAAD 1EQZC 4H9RB 1F66D 3WKJB 3AZEA 3AZHD 2RIQA 1F66A 3AZEB 4YM6C 3AZHA 1F66B 3W97A 3W96C 3C1CD 3UT9C 3AZHB 5JRGC 3W97B 3X1SC 3AZFC 3C1CA 4ZUXC 3A6NA 3C1CB 2HIOD 4J8XD 5BT1C 5KDMA 3H0MC 5KDMB 4NFTA 1P3GC 4ZUXA 5DNMC 1HQ3D 3VH6T 2NQBC 3REJC 1HQ3A 5CP6C 4Z66D 1ID3D 4J8WD 1HQ3B 5B40C 2F8NA 4Z66A 3A1KA 1ID3A 4DRBA 2F8NB 4Z66B 5C3IB 1ID3B 4J8WB 2PYOD 3MGRC 3VH5A 5AV5A 2LY8A 1P3KC 2PYOA 5CPKC 2CV5D 2PYOB 3REJA 2BYKA 5B0YC 2CV5A 2BYKB 2CV5B 5B40A 1PZRA 4NE3A 3VH5W 5B31D 2F2AC 3REKA 5B33C 5B31B 3REKB 5AVBC 3AZIC 4HGAB 3AN2D 4ZBJC 5FUGA 3KFUG 4QLCD 3MGQC 5FUGB 5GSUC 4QLCA 5B2JC 4KHAA 4R8PD 4QLCB 1P34A 2Y2LA 4KHAB 5GXQC 4R8PA 1P34B 4R8PB 2XD1A 3AFAC 3W99C 3AZJD 4H9SA 4WU8D 4X23C 3AZJA 3AYWC 5B0ZD 3AZJB 2JSSA 5B0ZA 3WTPE 3REHD 5B0ZB 5AVCC 1Z2CB 1P3MC 3REHA 1W2EA 2DF4C 2JE5A 3REHB 1P3BC 3X1TD 3MNNC 3UTAC 3X1TA 4G92B 3X1TB 2RVQD 3AV1C 3B6GC 4NE6A 5B24D 2Y2MA 3EG5B 3O62D 3AZLD 3AZND 5B24A 3AZLA 2Y2GA 1R4VA 2ZY2A 5B24B 3AZLB 3AZNA 1P3AA 2F8NK 3AZNB 1P3AB 5GT3C 5GT0C 4JJNA 1P3PC 4JJNB 3B6GA 1M18C 1KU5A 4KUDD 4LD9D 3FDDA 3H0LC 3AZGD 2DQNC 4KUDA 3AL0C 4KUDB 3B6FA 3X1UD 1ZLAD 2HUEB 2Y2IA 3B6FB 1F1EA 2BYMA 3X1UA 5E5AA 3EPJA 1ZLAA 5AV6A 2BYMB 3X1UB 5E5AB 1ZLAB 3LZ0C 3MGSC 1TZYD 3LJAC 3KXBD 1KX4C 1TZYA 5F99D 1P3ID 1P3FC 3EPHA 1TZYB 3KXBA 4XUJD 5F99A 1KX3C 3KXBB 5F99B 3WKJC 3MVDA 3AZEC 4Z5TD 3MVDB 1F66C 4Z5TA 3AZHC 3W97C 4Z5TB 4XZQD 3C1CC 3A6NC 4XZQA 2Y2JA 5B2ID 1P3LD 2NZDD 4XZQB 5DNNA 2ZY3A 1S32A 1P3LA 4G91B 3V9RB 5DNNB 1S32B 3WAAA 2NZDA 1P3LB 2NZDB 3WAAB 2JCHA 2IO5B 2ZY4A 4UPKA 2BG1A 5B32G 4WNNA 5AV8D 4WNNB 1Q9CA 4WJ3C 3REID 5AV8B 3KUYD 2HIOA 4DRAA 4EO5B 3KUYA 1HQ3C 2HIOB 4J8XA 3MGPD 3KUYB 4DQYB 4J8XB 4Z66C 5C3IC 1ID3C 3MGPA 3IP4C 3MGPB 3W98D 5AV5C 2PYOC 3W98A 5CPID 3W98B 2CV5C 5CPIA 2F8NG 5CPIB 4J8WA 5BNXA 5B1LD 5BNXB 3REKC 3WTPD 2G5HC 5B1LA 4HGAC 1BH9A 3WTPA 3UT9D 5B1LB 1BH9B 3WTPB 5G49B 3KWQD 4QLCC 1BH8A 5B31A 1P34C 1BH8B 4R8PC 4WU9D 1ULYA 3KWQB 4H9OB 4H9SC 4WU9B 2AROD 3AZJC 3AV2D 3AN2A 3AN2B 5BS7A 2NQBD 5B0ZC 2FJ7D 2AROB 3AV2B 1U35D 2FJ7A 3REHC 2Y2NA 4M6BA 2FJ7B 1U35A 2L5AA 1U35B 4G92C 1P3KD 3X1TC 4WU8A 5BO0A 1KX5D 3NQJA 4WU8B 2W8SA 5BO0B 3NQJB 1KX5A 2RVQC 1KX5B 3X1VD 2Y2PA 1M19D 5B24C 3AZLC 1M19A 3AZNC 3X1VB 1P3AC 1M19B 4KGCD 1JFIB 4JJNC 3TU4D 5AV9D 4KGCA 2F8NH 3VH6A 4KGCB 4J8UD 3TU4A 5AV9A 3TU4B 5AV9B 3MGQD 4J8UA 5GSUD 3O62A 4J8UB 4H9QA 2Y2OA 3O62B 4H9QB 3VH6W 3B0BA 3AFAD 4KUDC 3W99D 2HUEC 3B6FC 1AOID 3X1UC 5E5AC 1ZLAC 1B67A 5AV6C 1AOIB 4CAYA 4AWLB
chains in the Genus database with same CATH topology
4LD9A 2XD5A 4CAYB 3AZGA 3MNND 4LD9B 4YS3D 3UTAD 3AZGB 3P5JB 1TZYC 2ZM5A 4YS3A 3RELD 3KXBC 1M1AD 5F99C 4YS3B 3LZ1D 1M1AA 3RELB 3MVDC 3B0DB 3LZ1A 1M1AB 3AZMD 5B1MD 3LZ1B 1T3UA 3AZMA 4Z5TC 5B1MA 3AZMB 5B1MB 1P3IA 3WA9D 4XZQC 1P3PD 1P3IB 4XUJA 4G91C 2Y2QA 5DNNC 1S32C 3WA9A 4XUJB 1P3LC 2NZDC 3WA9B 3WAAC 4WV4B 2IO5C 1WWSA 2Y2HA 2J8PA 3VH5T 3V9RA 4WZSB 3LELD 4EO5C 5B2IA 2Y2KA 1TAFB 3AZKD 2HIOC 3B0CW 5B2IB 3LELA 3KUYC 3AZKA 1N1JA 4J8XC 3LELB 3AZKB 1N1JB 4H9PA 4J8VD 3MGPC 1P3OD 3R45A 4H9PB 5AV8A 2CWEA 3R45B 4J8VA 1P3OA 4J8VB 1P3OB 3W98C 1KX4D 3REIA 3REIB 4E44A 5CPIC 3WKJD 5CPJD 4J8WC 3UTBD 5CPJA 4Z2MH 3UTBA 5CPJB 3UTBB 5B1LC 3W97D 3WTPC 5B32D 3EPKA 3A6ND 5B32A 1HTAA 5AY8D 3C1BD 1EQZD 5B32B 5AY8A 5B31C 3A6NB 3C1BA 1EQZA 3KWQC 5AY8B 4YM6D 3C1BB 1EQZB 3W96D 4YM6A 2VQRA 4WU9C 5JRGD 3X1SD 3W96A 4YM6B 3UT9A 3AZFD 5G49A 4ZUXD 5JRGA 3W96B 3X1SA 3UT9B 3AZFA 3AN2C 5JRGB 3X1SB 3AZFB 2AROC 5BS7C 5BT1D 4ZUXB 3AV2C 5B31G 3KWQA 5JA4A 5JA4B 2FJ7C 3A1IA 4H9OA 2F8ND 4WU9A 1P3GD 1U35C 1P3GA 5DNMD 5AV5D 1P3GB 4WU8C 2AROA 5DNMA 3AV2A 3REJD 5DNMB 5AV5B 1KX5C 5CP6D 2NQBA 5B40D 2NQBB 5CP6A 3REJB 5CP6B 3X1VC 5BNVA 3MGRD 1M19C 5B40B 3REKD 5BNVB 3MGRA 1H3OA 5CPKD 1BFMA 1P3KA 3MGRB 1H3OB 4KGCC 5B0YD 5CPKA 1P3KB 3TU4C 3KSYA 5AV9C 5B0YA 5CPKB 4J8UC 5B0YB 3O62C 3X1VA 1P34D 1JFIA 5B33D 5AVBD 3AZID 5B33A 5AVBA 3AZIA 5B33B 5AVBB 3AZIB 3NQUA 3NQUB 5B2JD 4ZBJB 3MGQA 5GSUA 1AOIC 5B2JA 3MGQB 5GXQD 4CSRA 5GSUB 5B2JB 4AWLC 4CSRB 5GXQA 4LD9C 5GXQB 3AZGC 3AFAA 1WWIA 4X23D 4NE5A 3AYWD 3AFAB 3W99A 3B0CT 3W99B 4YS3C 4X23A 3AYWA 1AOIA 5CHLB 4X23B 3AYWB 3RELC 5AVCD 1P3MD 2G5IC 3B0DC 1M1AC 2YFVA 5AVCA 3LZ1C 1P3MA 2YFVB 2YFWA 1P3BD 5AVCB 1P3MB 2YFWB 4E45A 3EPLA 3AZMC 5B1MC 4Z2MG 3MNNA 1P3AD 1P3BA 2UWXA 3UTAA 1P3BB 3MNNB 4JJND 1P3IC 3UTAB 3RELA 3AV1D 3B6GD 4XUJC 3WA9C 3AV1A 3AV1B 3B6GB 5GT3D 5GT0D 5GT3A 5GT0A 1M18D 1P3PA 4H9NA 5GT0B 5GT3B 5B2IC 3B6FD 1P3PB 4H9NB 1M18A 3LELC 3AZKC 1M18B 5E5AD 5AV6D 2ZY5A 5AV6B 5AV8C 4J8VC 1TAFA 1P3OC 1A7WA 4UUZA 3REIC 4UUZB 3H0RC 3MVDD 3LZ0D 5CPJC 2FFFB 3MGSD 3UTBC 3LJAD 3LZ0A 3MGSA 3F6TA 1P3FD 3LZ0B 3LJAA 3MGSB 3LJAB 1KX4A 1P3FA 1KX3D 1B6WA 5B32C 1P3FB 1KX4B 1KX3A 5DNND 1S32D 4H9RA 3AZED 1KX3B 3WKJA 5AY8C 3C1BC 3WAAD 1EQZC 4H9RB 1F66D 3WKJB 3AZEA 3AZHD 2RIQA 1F66A 3AZEB 4YM6C 3AZHA 1F66B 3W97A 3W96C 3C1CD 3UT9C 3AZHB 5JRGC 3W97B 3X1SC 3AZFC 3C1CA 4ZUXC 3A6NA 3C1CB 2HIOD 4J8XD 5BT1C 5KDMA 3H0MC 5KDMB 4NFTA 1P3GC 4ZUXA 5DNMC 1HQ3D 3VH6T 2NQBC 3REJC 1HQ3A 5CP6C 4Z66D 1ID3D 4J8WD 1HQ3B 5B40C 2F8NA 4Z66A 3A1KA 1ID3A 4DRBA 2F8NB 4Z66B 5C3IB 1ID3B 4J8WB 2PYOD 3MGRC 3VH5A 5AV5A 2LY8A 1P3KC 2PYOA 5CPKC 2CV5D 2PYOB 3REJA 2BYKA 5B0YC 2CV5A 2BYKB 2CV5B 5B40A 1PZRA 4NE3A 3VH5W 5B31D 2F2AC 3REKA 5B33C 5B31B 3REKB 5AVBC 3AZIC 4HGAB 3AN2D 4ZBJC 5FUGA 3KFUG 4QLCD 3MGQC 5FUGB 5GSUC 4QLCA 5B2JC 4KHAA 4R8PD 4QLCB 1P34A 2Y2LA 4KHAB 5GXQC 4R8PA 1P34B 4R8PB 2XD1A 3AFAC 3W99C 3AZJD 4H9SA 4WU8D 4X23C 3AZJA 3AYWC 5B0ZD 3AZJB 2JSSA 5B0ZA 3WTPE 3REHD 5B0ZB 5AVCC 1Z2CB 1P3MC 3REHA 1W2EA 2DF4C 2JE5A 3REHB 1P3BC 3X1TD 3MNNC 3UTAC 3X1TA 4G92B 3X1TB 2RVQD 3AV1C 3B6GC 4NE6A 5B24D 2Y2MA 3EG5B 3O62D 3AZLD 3AZND 5B24A 3AZLA 2Y2GA 1R4VA 2ZY2A 5B24B 3AZLB 3AZNA 1P3AA 2F8NK 3AZNB 1P3AB 5GT3C 5GT0C 4JJNA 1P3PC 4JJNB 3B6GA 1M18C 1KU5A 4KUDD 4LD9D 3FDDA 3H0LC 3AZGD 2DQNC 4KUDA 3AL0C 4KUDB 3B6FA 3X1UD 1ZLAD 2HUEB 2Y2IA 3B6FB 1F1EA 2BYMA 3X1UA 5E5AA 3EPJA 1ZLAA 5AV6A 2BYMB 3X1UB 5E5AB 1ZLAB 3LZ0C 3MGSC 1TZYD 3LJAC 3KXBD 1KX4C 1TZYA 5F99D 1P3ID 1P3FC 3EPHA 1TZYB 3KXBA 4XUJD 5F99A 1KX3C 3KXBB 5F99B 3WKJC 3MVDA 3AZEC 4Z5TD 3MVDB 1F66C 4Z5TA 3AZHC 3W97C 4Z5TB 4XZQD 3C1CC 3A6NC 4XZQA 2Y2JA 5B2ID 1P3LD 2NZDD 4XZQB 5DNNA 2ZY3A 1S32A 1P3LA 4G91B 3V9RB 5DNNB 1S32B 3WAAA 2NZDA 1P3LB 2NZDB 3WAAB 2JCHA 2IO5B 2ZY4A 4UPKA 2BG1A 5B32G 4WNNA 5AV8D 4WNNB 1Q9CA 4WJ3C 3REID 5AV8B 3KUYD 2HIOA 4DRAA 4EO5B 3KUYA 1HQ3C 2HIOB 4J8XA 3MGPD 3KUYB 4DQYB 4J8XB 4Z66C 5C3IC 1ID3C 3MGPA 3IP4C 3MGPB 3W98D 5AV5C 2PYOC 3W98A 5CPID 3W98B 2CV5C 5CPIA 2F8NG 5CPIB 4J8WA 5BNXA 5B1LD 5BNXB 3REKC 3WTPD 2G5HC 5B1LA 4HGAC 1BH9A 3WTPA 3UT9D 5B1LB 1BH9B 3WTPB 5G49B 3KWQD 4QLCC 1BH8A 5B31A 1P34C 1BH8B 4R8PC 4WU9D 1ULYA 3KWQB 4H9OB 4H9SC 4WU9B 2AROD 3AZJC 3AV2D 3AN2A 3AN2B 5BS7A 2NQBD 5B0ZC 2FJ7D 2AROB 3AV2B 1U35D 2FJ7A 3REHC 2Y2NA 4M6BA 2FJ7B 1U35A 2L5AA 1U35B 4G92C 1P3KD 3X1TC 4WU8A 5BO0A 1KX5D 3NQJA 4WU8B 2W8SA 5BO0B 3NQJB 1KX5A 2RVQC 1KX5B 3X1VD 2Y2PA 1M19D 5B24C 3AZLC 1M19A 3AZNC 3X1VB 1P3AC 1M19B 4KGCD 1JFIB 4JJNC 3TU4D 5AV9D 4KGCA 2F8NH 3VH6A 4KGCB 4J8UD 3TU4A 5AV9A 3TU4B 5AV9B 3MGQD 4J8UA 5GSUD 3O62A 4J8UB 4H9QA 2Y2OA 3O62B 4H9QB 3VH6W 3B0BA 3AFAD 4KUDC 3W99D 2HUEC 3B6FC 1AOID 3X1UC 5E5AC 1ZLAC 1B67A 5AV6C 1AOIB 4CAYA 4AWLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 A;  4CAY B;  3AZG A;  3MNN D;  4LD9 B;  4YS3 D;  3UTA D;  3AZG B;  1TZY C;  4YS3 A;  3REL D;  3KXB C;  1M1A D;  5F99 C;  4YS3 B;  3LZ1 D;  1M1A A;  3REL B;  3MVD C;  3B0D B;  3LZ1 A;  1M1A B;  3AZM D;  5B1M D;  3LZ1 B;  3AZM A;  4Z5T C;  5B1M A;  3AZM B;  5B1M B;  1P3I A;  3WA9 D;  4XZQ C;  1P3P D;  1P3I B;  4XUJ A;  4G91 C;  3WA9 A;  5DNN C;  1S32 C;  4XUJ B;  1P3L C;  2NZD C;  3WA9 B;  3WAA C;  4WV4 B;  2IO5 C;  1WWS A;  3VH5 T;  3V9R A;  4WZS B;  3LEL D;  4EO5 C;  5B2I A;  1TAF B;  3AZK D;  2HIO C;  3B0C W;  5B2I B;  3LEL A;  3KUY C;  3AZK A;  1N1J A;  4J8X C;  3LEL B;  3AZK B;  1N1J B;  4H9P A;  4J8V D;  3MGP C;  1P3O D;  3R45 A;  4H9P B;  5AV8 A;  2CWE A;  3R45 B;  4J8V A;  1P3O A;  4J8V B;  1P3O B;  3W98 C;  1KX4 D;  3REI A;  3REI B;  4E44 A;  5CPI C;  3WKJ D;  5CPJ D;  4J8W C;  3UTB D;  5CPJ A;  4Z2M H;  3UTB A;  5CPJ B;  3UTB B;  5B1L C;  3W97 D;  3WTP C;  5B32 D;  3A6N D;  5B32 A;  1HTA A;  5AY8 D;  3C1B D;  1EQZ D;  5B32 B;  5AY8 A;  5B31 C;  3A6N B;  3C1B A;  1EQZ A;  3KWQ C;  5AY8 B;  4YM6 D;  3C1B B;  1EQZ B;  3W96 D;  4YM6 A;  4WU9 C;  5JRG D;  3X1S D;  3W96 A;  4YM6 B;  3UT9 A;  3AZF D;  5G49 A;  4ZUX D;  5JRG A;  3W96 B;  3X1S A;  3UT9 B;  3AZF A;  3AN2 C;  5JRG B;  3X1S B;  3AZF B;  2ARO C;  5BS7 C;  5BT1 D;  4ZUX B;  3AV2 C;  5B31 G;  3KWQ A;  5JA4 A;  5JA4 B;  2FJ7 C;  4H9O A;  2F8N D;  4WU9 A;  1P3G D;  1U35 C;  1P3G A;  5DNM D;  5AV5 D;  1P3G B;  4WU8 C;  2ARO A;  5DNM A;  3AV2 A;  3REJ D;  5DNM B;  5AV5 B;  1KX5 C;  5CP6 D;  2NQB A;  5B40 D;  2NQB B;  5CP6 A;  3REJ B;  5CP6 B;  3X1V C;  5BNV A;  3MGR D;  1M19 C;  5B40 B;  3REK D;  5BNV B;  3MGR A;  1H3O A;  5CPK D;  1BFM A;  1P3K A;  3MGR B;  1H3O B;  4KGC C;  5B0Y D;  5CPK A;  1P3K B;  3TU4 C;  3KSY A;  5AV9 C;  5B0Y A;  5CPK B;  4J8U C;  5B0Y B;  3O62 C;  3X1V A;  1P34 D;  1JFI A;  5B33 D;  5AVB D;  3AZI D;  5B33 A;  5AVB A;  3AZI A;  5B33 B;  5AVB B;  3AZI B;  3NQU A;  3NQU B;  5B2J D;  4ZBJ B;  3MGQ A;  5GSU A;  1AOI C;  5B2J A;  3MGQ B;  5GXQ D;  4CSR A;  5GSU B;  5B2J B;  4AWL C;  4CSR B;  5GXQ A;  4LD9 C;  5GXQ B;  3AZG C;  3AFA A;  1WWI A;  4X23 D;  4NE5 A;  3AYW D;  3AFA B;  3W99 A;  3B0C T;  3W99 B;  4YS3 C;  4X23 A;  3AYW A;  1AOI A;  5CHL B;  4X23 B;  3AYW B;  3REL C;  5AVC D;  1P3M D;  3B0D C;  1M1A C;  2YFV A;  5AVC A;  3LZ1 C;  1P3M A;  2YFV B;  2YFW A;  1P3B D;  5AVC B;  1P3M B;  2YFW B;  4E45 A;  3AZM C;  1P3A D;  5B1M C;  4Z2M G;  3MNN A;  1P3B A;  3UTA A;  1P3B B;  3MNN B;  4JJN D;  1P3I C;  3UTA B;  3REL A;  3AV1 D;  3B6G D;  4XUJ C;  3WA9 C;  3AV1 A;  3AV1 B;  3B6G B;  5GT3 D;  5GT0 D;  5GT3 A;  5GT0 A;  1M18 D;  1P3P A;  4H9N A;  5GT0 B;  5GT3 B;  5B2I C;  3B6F D;  1P3P B;  4H9N B;  1M18 A;  3LEL C;  3AZK C;  1M18 B;  5E5A D;  5AV6 D;  5AV6 B;  5AV8 C;  4J8V C;  1TAF A;  1P3O C;  1A7W A;  4UUZ A;  3REI C;  4UUZ B;  3MVD D;  3LZ0 D;  5CPJ C;  3UTB C;  3MGS D;  3LJA D;  3LZ0 A;  3MGS A;  1P3F D;  3LZ0 B;  3LJA A;  3MGS B;  3LJA B;  1KX4 A;  1P3F A;  1KX3 D;  1B6W A;  5B32 C;  1P3F B;  1KX4 B;  1KX3 A;  5DNN D;  1S32 D;  4H9R A;  3AZE D;  1KX3 B;  3WKJ A;  5AY8 C;  3C1B C;  3WAA D;  1EQZ C;  4H9R B;  1F66 D;  3WKJ B;  3AZE A;  3AZH D;  1F66 A;  3AZE B;  4YM6 C;  3AZH A;  1F66 B;  3W97 A;  3W96 C;  3C1C D;  3UT9 C;  3AZH B;  5JRG C;  3W97 B;  3X1S C;  3AZF C;  3C1C A;  4ZUX C;  3A6N A;  3C1C B;  2HIO D;  4J8X D;  5BT1 C;  5KDM A;  5KDM B;  4NFT A;  1P3G C;  4ZUX A;  5DNM C;  1HQ3 D;  3VH6 T;  2NQB C;  3REJ C;  1HQ3 A;  5CP6 C;  4Z66 D;  1ID3 D;  4J8W D;  1HQ3 B;  5B40 C;  2F8N A;  4Z66 A;  1ID3 A;  4DRB A;  2F8N B;  4Z66 B;  5C3I B;  1ID3 B;  4J8W B;  2PYO D;  3MGR C;  3VH5 A;  5AV5 A;  2LY8 A;  1P3K C;  2PYO A;  5CPK C;  2CV5 D;  2PYO B;  3REJ A;  2BYK A;  5B0Y C;  2CV5 A;  2BYK B;  2CV5 B;  5B40 A;  4NE3 A;  3VH5 W;  5B31 D;  3REK A;  5B33 C;  5B31 B;  3REK B;  5AVB C;  3AZI C;  4HGA B;  3AN2 D;  4ZBJ C;  5FUG A;  4QLC D;  3MGQ C;  5FUG B;  5GSU C;  4QLC A;  5B2J C;  4KHA A;  4R8P D;  4QLC B;  1P34 A;  4KHA B;  5GXQ C;  4R8P A;  1P34 B;  4R8P B;  3AFA C;  3W99 C;  3AZJ D;  4H9S A;  4WU8 D;  4X23 C;  3AZJ A;  3AYW C;  5B0Z D;  3AZJ B;  2JSS A;  5B0Z A;  3WTP E;  3REH D;  5B0Z B;  5AVC C;  1P3M C;  3REH A;  3REH B;  1P3B C;  3X1T D;  3MNN C;  3UTA C;  3X1T A;  4G92 B;  3X1T B;  2RVQ D;  3AV1 C;  3B6G C;  4NE6 A;  5B24 D;  3O62 D;  3AZL D;  3AZN D;  5B24 A;  3AZL A;  1R4V A;  3AZN A;  5B24 B;  3AZL B;  1P3A A;  2F8N K;  3AZN B;  1P3A B;  5GT3 C;  5GT0 C;  4JJN A;  1P3P C;  4JJN B;  3B6G A;  1M18 C;  1KU5 A;  4KUD D;  4LD9 D;  3AZG D;  4KUD A;  4KUD B;  3B6F A;  3X1U D;  1ZLA D;  2HUE B;  3B6F B;  1F1E A;  2BYM A;  3X1U A;  5E5A A;  1ZLA A;  5AV6 A;  2BYM B;  3X1U B;  5E5A B;  1ZLA B;  3LZ0 C;  3MGS C;  1TZY D;  3LJA C;  3KXB D;  1KX4 C;  1TZY A;  5F99 D;  1P3I D;  1P3F C;  1TZY B;  3KXB A;  4XUJ D;  5F99 A;  1KX3 C;  3KXB B;  5F99 B;  3WKJ C;  3MVD A;  3AZE C;  4Z5T D;  3MVD B;  1F66 C;  4Z5T A;  3AZH C;  3W97 C;  4Z5T B;  4XZQ D;  3C1C C;  3A6N C;  4XZQ A;  5B2I D;  1P3L D;  2NZD D;  4XZQ B;  5DNN A;  1S32 A;  1P3L A;  4G91 B;  3V9R B;  5DNN B;  1S32 B;  3WAA A;  2NZD A;  1P3L B;  2NZD B;  3WAA B;  2IO5 B;  5B32 G;  5AV8 D;  4WNN A;  4WNN B;  1Q9C A;  3REI D;  5AV8 B;  3KUY D;  2HIO A;  4DRA A;  4EO5 B;  3KUY A;  1HQ3 C;  2HIO B;  4J8X A;  3MGP D;  3KUY B;  4J8X B;  4Z66 C;  5C3I C;  1ID3 C;  3MGP A;  3MGP B;  3W98 D;  5AV5 C;  2PYO C;  3W98 A;  5CPI D;  3W98 B;  2CV5 C;  5CPI A;  2F8N G;  5CPI B;  4J8W A;  5BNX A;  5B1L D;  5BNX B;  3REK C;  3WTP D;  5B1L A;  4HGA C;  1BH9 A;  3WTP A;  3UT9 D;  5B1L B;  1BH9 B;  3WTP B;  5G49 B;  3KWQ D;  4QLC C;  1BH8 A;  5B31 A;  1P34 C;  1BH8 B;  4R8P C;  4WU9 D;  1ULY A;  3KWQ B;  4H9O B;  4H9S C;  4WU9 B;  2ARO D;  3AZJ C;  3AV2 D;  3AN2 A;  3AN2 B;  5BS7 A;  2NQB D;  5B0Z C;  2FJ7 D;  2ARO B;  3AV2 B;  1U35 D;  2FJ7 A;  3REH C;  4M6B A;  2FJ7 B;  1U35 A;  2L5A A;  1U35 B;  4G92 C;  1P3K D;  3X1T C;  4WU8 A;  5BO0 A;  1KX5 D;  3NQJ A;  4WU8 B;  5BO0 B;  3NQJ B;  1KX5 A;  2RVQ C;  1KX5 B;  3X1V D;  1M19 D;  5B24 C;  3AZL C;  1M19 A;  3AZN C;  3X1V B;  1P3A C;  1M19 B;  4KGC D;  1JFI B;  4JJN C;  3TU4 D;  5AV9 D;  4KGC A;  2F8N H;  3VH6 A;  4KGC B;  4J8U D;  3TU4 A;  5AV9 A;  3TU4 B;  5AV9 B;  3MGQ D;  4J8U A;  5GSU D;  3O62 A;  4J8U B;  4H9Q A;  3O62 B;  4H9Q B;  3VH6 W;  3B0B A;  3AFA D;  4KUD C;  3W99 D;  2HUE C;  3B6F C;  1AOI D;  3X1U C;  5E5A C;  1ZLA C;  1B67 A;  5AV6 C;  1AOI B;  4CAY A;  4AWL B; 
#chains in the Genus database with same CATH topology
 4LD9 A;  2XD5 A;  4CAY B;  3AZG A;  3MNN D;  4LD9 B;  4YS3 D;  3UTA D;  3AZG B;  3P5J B;  1TZY C;  2ZM5 A;  4YS3 A;  3REL D;  3KXB C;  1M1A D;  5F99 C;  4YS3 B;  3LZ1 D;  1M1A A;  3REL B;  3MVD C;  3B0D B;  3LZ1 A;  1M1A B;  3AZM D;  5B1M D;  3LZ1 B;  1T3U A;  3AZM A;  4Z5T C;  5B1M A;  3AZM B;  5B1M B;  1P3I A;  3WA9 D;  4XZQ C;  1P3P D;  1P3I B;  4XUJ A;  4G91 C;  2Y2Q A;  5DNN C;  1S32 C;  3WA9 A;  4XUJ B;  1P3L C;  2NZD C;  3WA9 B;  3WAA C;  4WV4 B;  2IO5 C;  1WWS A;  2Y2H A;  2J8P A;  3VH5 T;  3V9R A;  4WZS B;  3LEL D;  4EO5 C;  5B2I A;  2Y2K A;  1TAF B;  3AZK D;  2HIO C;  3B0C W;  5B2I B;  3LEL A;  3KUY C;  3AZK A;  1N1J A;  4J8X C;  3LEL B;  3AZK B;  1N1J B;  4H9P A;  4J8V D;  3MGP C;  1P3O D;  3R45 A;  4H9P B;  5AV8 A;  2CWE A;  3R45 B;  4J8V A;  1P3O A;  4J8V B;  1P3O B;  3W98 C;  1KX4 D;  3REI A;  3REI B;  4E44 A;  5CPI C;  3WKJ D;  5CPJ D;  4J8W C;  3UTB D;  5CPJ A;  4Z2M H;  3UTB A;  5CPJ B;  3UTB B;  5B1L C;  3W97 D;  3WTP C;  5B32 D;  3EPK A;  3A6N D;  5B32 A;  1HTA A;  5AY8 D;  3C1B D;  1EQZ D;  5B32 B;  5AY8 A;  5B31 C;  3A6N B;  3C1B A;  1EQZ A;  3KWQ C;  5AY8 B;  4YM6 D;  3C1B B;  1EQZ B;  3W96 D;  4YM6 A;  2VQR A;  4WU9 C;  5JRG D;  3X1S D;  3W96 A;  4YM6 B;  3UT9 A;  3AZF D;  5G49 A;  4ZUX D;  5JRG A;  3W96 B;  3X1S A;  3UT9 B;  3AZF A;  3AN2 C;  5JRG B;  3X1S B;  3AZF B;  2ARO C;  5BS7 C;  5BT1 D;  4ZUX B;  3AV2 C;  5B31 G;  3KWQ A;  5JA4 A;  5JA4 B;  2FJ7 C;  3A1I A;  4H9O A;  2F8N D;  4WU9 A;  1P3G D;  1U35 C;  1P3G A;  5DNM D;  5AV5 D;  1P3G B;  4WU8 C;  2ARO A;  5DNM A;  3AV2 A;  3REJ D;  5DNM B;  5AV5 B;  1KX5 C;  5CP6 D;  2NQB A;  5B40 D;  2NQB B;  5CP6 A;  3REJ B;  5CP6 B;  3X1V C;  5BNV A;  3MGR D;  1M19 C;  5B40 B;  3REK D;  5BNV B;  3MGR A;  1H3O A;  5CPK D;  1BFM A;  1P3K A;  3MGR B;  1H3O B;  4KGC C;  5B0Y D;  5CPK A;  1P3K B;  3TU4 C;  3KSY A;  5AV9 C;  5B0Y A;  5CPK B;  4J8U C;  5B0Y B;  3O62 C;  3X1V A;  1P34 D;  1JFI A;  5B33 D;  5AVB D;  3AZI D;  5B33 A;  5AVB A;  3AZI A;  5B33 B;  5AVB B;  3AZI B;  3NQU A;  3NQU B;  5B2J D;  4ZBJ B;  3MGQ A;  5GSU A;  1AOI C;  5B2J A;  3MGQ B;  5GXQ D;  4CSR A;  5GSU B;  5B2J B;  4AWL C;  4CSR B;  5GXQ A;  4LD9 C;  5GXQ B;  3AZG C;  3AFA A;  1WWI A;  4X23 D;  4NE5 A;  3AYW D;  3AFA B;  3W99 A;  3B0C T;  3W99 B;  4YS3 C;  4X23 A;  3AYW A;  1AOI A;  5CHL B;  4X23 B;  3AYW B;  3REL C;  5AVC D;  1P3M D;  2G5I C;  3B0D C;  1M1A C;  2YFV A;  5AVC A;  3LZ1 C;  1P3M A;  2YFV B;  2YFW A;  1P3B D;  5AVC B;  1P3M B;  2YFW B;  4E45 A;  3EPL A;  3AZM C;  5B1M C;  4Z2M G;  3MNN A;  1P3A D;  1P3B A;  2UWX A;  3UTA A;  1P3B B;  3MNN B;  4JJN D;  1P3I C;  3UTA B;  3REL A;  3AV1 D;  3B6G D;  4XUJ C;  3WA9 C;  3AV1 A;  3AV1 B;  3B6G B;  5GT3 D;  5GT0 D;  5GT3 A;  5GT0 A;  1M18 D;  1P3P A;  4H9N A;  5GT0 B;  5GT3 B;  5B2I C;  3B6F D;  1P3P B;  4H9N B;  1M18 A;  3LEL C;  3AZK C;  1M18 B;  5E5A D;  5AV6 D;  2ZY5 A;  5AV6 B;  5AV8 C;  4J8V C;  1TAF A;  1P3O C;  1A7W A;  4UUZ A;  3REI C;  4UUZ B;  3H0R C;  3MVD D;  3LZ0 D;  5CPJ C;  2FFF B;  3MGS D;  3UTB C;  3LJA D;  3LZ0 A;  3MGS A;  3F6T A;  1P3F D;  3LZ0 B;  3LJA A;  3MGS B;  3LJA B;  1KX4 A;  1P3F A;  1KX3 D;  1B6W A;  5B32 C;  1P3F B;  1KX4 B;  1KX3 A;  5DNN D;  1S32 D;  4H9R A;  3AZE D;  1KX3 B;  3WKJ A;  5AY8 C;  3C1B C;  3WAA D;  1EQZ C;  4H9R B;  1F66 D;  3WKJ B;  3AZE A;  3AZH D;  2RIQ A;  1F66 A;  3AZE B;  4YM6 C;  3AZH A;  1F66 B;  3W97 A;  3W96 C;  3C1C D;  3UT9 C;  3AZH B;  5JRG C;  3W97 B;  3X1S C;  3AZF C;  3C1C A;  4ZUX C;  3A6N A;  3C1C B;  2HIO D;  4J8X D;  5BT1 C;  5KDM A;  3H0M C;  5KDM B;  4NFT A;  1P3G C;  4ZUX A;  5DNM C;  1HQ3 D;  3VH6 T;  2NQB C;  3REJ C;  1HQ3 A;  5CP6 C;  4Z66 D;  1ID3 D;  4J8W D;  1HQ3 B;  5B40 C;  2F8N A;  4Z66 A;  3A1K A;  1ID3 A;  4DRB A;  2F8N B;  4Z66 B;  5C3I B;  1ID3 B;  4J8W B;  2PYO D;  3MGR C;  3VH5 A;  5AV5 A;  2LY8 A;  1P3K C;  2PYO A;  5CPK C;  2CV5 D;  2PYO B;  3REJ A;  2BYK A;  5B0Y C;  2CV5 A;  2BYK B;  2CV5 B;  5B40 A;  1PZR A;  4NE3 A;  3VH5 W;  5B31 D;  2F2A C;  3REK A;  5B33 C;  5B31 B;  3REK B;  5AVB C;  3AZI C;  4HGA B;  3AN2 D;  4ZBJ C;  5FUG A;  3KFU G;  4QLC D;  3MGQ C;  5FUG B;  5GSU C;  4QLC A;  5B2J C;  4KHA A;  4R8P D;  4QLC B;  1P34 A;  2Y2L A;  4KHA B;  5GXQ C;  4R8P A;  1P34 B;  4R8P B;  2XD1 A;  3AFA C;  3W99 C;  3AZJ D;  4H9S A;  4WU8 D;  4X23 C;  3AZJ A;  3AYW C;  5B0Z D;  3AZJ B;  2JSS A;  5B0Z A;  3WTP E;  3REH D;  5B0Z B;  5AVC C;  1Z2C B;  1P3M C;  3REH A;  1W2E A;  2DF4 C;  2JE5 A;  3REH B;  1P3B C;  3X1T D;  3MNN C;  3UTA C;  3X1T A;  4G92 B;  3X1T B;  2RVQ D;  3AV1 C;  3B6G C;  4NE6 A;  5B24 D;  2Y2M A;  3EG5 B;  3O62 D;  3AZL D;  3AZN D;  5B24 A;  3AZL A;  2Y2G A;  1R4V A;  2ZY2 A;  5B24 B;  3AZL B;  3AZN A;  1P3A A;  2F8N K;  3AZN B;  1P3A B;  5GT3 C;  5GT0 C;  4JJN A;  1P3P C;  4JJN B;  3B6G A;  1M18 C;  1KU5 A;  4KUD D;  4LD9 D;  3FDD A;  3H0L C;  3AZG D;  2DQN C;  4KUD A;  3AL0 C;  4KUD B;  3B6F A;  3X1U D;  1ZLA D;  2HUE B;  2Y2I A;  3B6F B;  1F1E A;  2BYM A;  3X1U A;  5E5A A;  3EPJ A;  1ZLA A;  5AV6 A;  2BYM B;  3X1U B;  5E5A B;  1ZLA B;  3LZ0 C;  3MGS C;  1TZY D;  3LJA C;  3KXB D;  1KX4 C;  1TZY A;  5F99 D;  1P3I D;  1P3F C;  3EPH A;  1TZY B;  3KXB A;  4XUJ D;  5F99 A;  1KX3 C;  3KXB B;  5F99 B;  3WKJ C;  3MVD A;  3AZE C;  4Z5T D;  3MVD B;  1F66 C;  4Z5T A;  3AZH C;  3W97 C;  4Z5T B;  4XZQ D;  3C1C C;  3A6N C;  4XZQ A;  2Y2J A;  5B2I D;  1P3L D;  2NZD D;  4XZQ B;  5DNN A;  2ZY3 A;  1S32 A;  1P3L A;  4G91 B;  3V9R B;  5DNN B;  1S32 B;  3WAA A;  2NZD A;  1P3L B;  2NZD B;  3WAA B;  2JCH A;  2IO5 B;  2ZY4 A;  4UPK A;  2BG1 A;  5B32 G;  4WNN A;  5AV8 D;  4WNN B;  1Q9C A;  4WJ3 C;  3REI D;  5AV8 B;  3KUY D;  2HIO A;  4DRA A;  4EO5 B;  3KUY A;  1HQ3 C;  2HIO B;  4J8X A;  3MGP D;  3KUY B;  4DQY B;  4J8X B;  4Z66 C;  5C3I C;  1ID3 C;  3MGP A;  3IP4 C;  3MGP B;  3W98 D;  5AV5 C;  2PYO C;  3W98 A;  5CPI D;  3W98 B;  2CV5 C;  5CPI A;  2F8N G;  5CPI B;  4J8W A;  5BNX A;  5B1L D;  5BNX B;  3REK C;  3WTP D;  2G5H C;  5B1L A;  4HGA C;  1BH9 A;  3WTP A;  3UT9 D;  5B1L B;  1BH9 B;  3WTP B;  5G49 B;  3KWQ D;  4QLC C;  1BH8 A;  5B31 A;  1P34 C;  1BH8 B;  4R8P C;  4WU9 D;  1ULY A;  3KWQ B;  4H9O B;  4H9S C;  4WU9 B;  2ARO D;  3AZJ C;  3AV2 D;  3AN2 A;  3AN2 B;  5BS7 A;  2NQB D;  5B0Z C;  2FJ7 D;  2ARO B;  3AV2 B;  1U35 D;  2FJ7 A;  3REH C;  2Y2N A;  4M6B A;  2FJ7 B;  1U35 A;  2L5A A;  1U35 B;  4G92 C;  1P3K D;  3X1T C;  4WU8 A;  5BO0 A;  1KX5 D;  3NQJ A;  4WU8 B;  2W8S A;  5BO0 B;  3NQJ B;  1KX5 A;  2RVQ C;  1KX5 B;  3X1V D;  2Y2P A;  1M19 D;  5B24 C;  3AZL C;  1M19 A;  3AZN C;  3X1V B;  1P3A C;  1M19 B;  4KGC D;  1JFI B;  4JJN C;  3TU4 D;  5AV9 D;  4KGC A;  2F8N H;  3VH6 A;  4KGC B;  4J8U D;  3TU4 A;  5AV9 A;  3TU4 B;  5AV9 B;  3MGQ D;  4J8U A;  5GSU D;  3O62 A;  4J8U B;  4H9Q A;  2Y2O A;  3O62 B;  4H9Q B;  3VH6 W;  3B0B A;  3AFA D;  4KUD C;  3W99 D;  2HUE C;  3B6F C;  1AOI D;  3X1U C;  5E5A C;  1ZLA C;  1B67 A;  5AV6 C;  1AOI B;  4CAY A;  4AWL B; 
#chains in the Genus database with same CATH homology
 4LD9 A;  2XD5 A;  4CAY B;  3AZG A;  3MNN D;  4LD9 B;  4YS3 D;  3UTA D;  3AZG B;  3P5J B;  1TZY C;  2ZM5 A;  4YS3 A;  3REL D;  3KXB C;  1M1A D;  5F99 C;  4YS3 B;  3LZ1 D;  1M1A A;  3REL B;  3MVD C;  3B0D B;  3LZ1 A;  1M1A B;  3AZM D;  5B1M D;  3LZ1 B;  1T3U A;  3AZM A;  4Z5T C;  5B1M A;  3AZM B;  5B1M B;  1P3I A;  3WA9 D;  4XZQ C;  1P3P D;  1P3I B;  4XUJ A;  4G91 C;  2Y2Q A;  5DNN C;  1S32 C;  3WA9 A;  4XUJ B;  1P3L C;  2NZD C;  3WA9 B;  3WAA C;  4WV4 B;  2IO5 C;  1WWS A;  2Y2H A;  2J8P A;  3VH5 T;  3V9R A;  4WZS B;  3LEL D;  4EO5 C;  5B2I A;  2Y2K A;  1TAF B;  3AZK D;  2HIO C;  3B0C W;  5B2I B;  3LEL A;  3KUY C;  3AZK A;  1N1J A;  4J8X C;  3LEL B;  3AZK B;  1N1J B;  4H9P A;  4J8V D;  3MGP C;  1P3O D;  3R45 A;  4H9P B;  5AV8 A;  2CWE A;  3R45 B;  4J8V A;  1P3O A;  4J8V B;  1P3O B;  3W98 C;  1KX4 D;  3REI A;  3REI B;  4E44 A;  5CPI C;  3WKJ D;  5CPJ D;  4J8W C;  3UTB D;  5CPJ A;  4Z2M H;  3UTB A;  5CPJ B;  3UTB B;  5B1L C;  3W97 D;  3WTP C;  5B32 D;  3EPK A;  3A6N D;  5B32 A;  1HTA A;  5AY8 D;  3C1B D;  1EQZ D;  5B32 B;  5AY8 A;  5B31 C;  3A6N B;  3C1B A;  1EQZ A;  3KWQ C;  5AY8 B;  4YM6 D;  3C1B B;  1EQZ B;  3W96 D;  4YM6 A;  2VQR A;  4WU9 C;  5JRG D;  3X1S D;  3W96 A;  4YM6 B;  3UT9 A;  3AZF D;  5G49 A;  4ZUX D;  5JRG A;  3W96 B;  3X1S A;  3UT9 B;  3AZF A;  3AN2 C;  5JRG B;  3X1S B;  3AZF B;  2ARO C;  5BS7 C;  5BT1 D;  4ZUX B;  3AV2 C;  5B31 G;  3KWQ A;  5JA4 A;  5JA4 B;  2FJ7 C;  3A1I A;  4H9O A;  2F8N D;  4WU9 A;  1P3G D;  1U35 C;  1P3G A;  5DNM D;  5AV5 D;  1P3G B;  4WU8 C;  2ARO A;  5DNM A;  3AV2 A;  3REJ D;  5DNM B;  5AV5 B;  1KX5 C;  5CP6 D;  2NQB A;  5B40 D;  2NQB B;  5CP6 A;  3REJ B;  5CP6 B;  3X1V C;  5BNV A;  3MGR D;  1M19 C;  5B40 B;  3REK D;  5BNV B;  3MGR A;  1H3O A;  5CPK D;  1BFM A;  1P3K A;  3MGR B;  1H3O B;  4KGC C;  5B0Y D;  5CPK A;  1P3K B;  3TU4 C;  3KSY A;  5AV9 C;  5B0Y A;  5CPK B;  4J8U C;  5B0Y B;  3O62 C;  3X1V A;  1P34 D;  1JFI A;  5B33 D;  5AVB D;  3AZI D;  5B33 A;  5AVB A;  3AZI A;  5B33 B;  5AVB B;  3AZI B;  3NQU A;  3NQU B;  5B2J D;  4ZBJ B;  3MGQ A;  5GSU A;  1AOI C;  5B2J A;  3MGQ B;  5GXQ D;  4CSR A;  5GSU B;  5B2J B;  4AWL C;  4CSR B;  5GXQ A;  4LD9 C;  5GXQ B;  3AZG C;  3AFA A;  1WWI A;  4X23 D;  4NE5 A;  3AYW D;  3AFA B;  3W99 A;  3B0C T;  3W99 B;  4YS3 C;  4X23 A;  3AYW A;  1AOI A;  5CHL B;  4X23 B;  3AYW B;  3REL C;  5AVC D;  1P3M D;  2G5I C;  3B0D C;  1M1A C;  2YFV A;  5AVC A;  3LZ1 C;  1P3M A;  2YFV B;  2YFW A;  1P3B D;  5AVC B;  1P3M B;  2YFW B;  4E45 A;  3EPL A;  3AZM C;  5B1M C;  4Z2M G;  3MNN A;  1P3A D;  1P3B A;  2UWX A;  3UTA A;  1P3B B;  3MNN B;  4JJN D;  1P3I C;  3UTA B;  3REL A;  3AV1 D;  3B6G D;  4XUJ C;  3WA9 C;  3AV1 A;  3AV1 B;  3B6G B;  5GT3 D;  5GT0 D;  5GT3 A;  5GT0 A;  1M18 D;  1P3P A;  4H9N A;  5GT0 B;  5GT3 B;  5B2I C;  3B6F D;  1P3P B;  4H9N B;  1M18 A;  3LEL C;  3AZK C;  1M18 B;  5E5A D;  5AV6 D;  2ZY5 A;  5AV6 B;  5AV8 C;  4J8V C;  1TAF A;  1P3O C;  1A7W A;  4UUZ A;  3REI C;  4UUZ B;  3H0R C;  3MVD D;  3LZ0 D;  5CPJ C;  2FFF B;  3MGS D;  3UTB C;  3LJA D;  3LZ0 A;  3MGS A;  3F6T A;  1P3F D;  3LZ0 B;  3LJA A;  3MGS B;  3LJA B;  1KX4 A;  1P3F A;  1KX3 D;  1B6W A;  5B32 C;  1P3F B;  1KX4 B;  1KX3 A;  5DNN D;  1S32 D;  4H9R A;  3AZE D;  1KX3 B;  3WKJ A;  5AY8 C;  3C1B C;  3WAA D;  1EQZ C;  4H9R B;  1F66 D;  3WKJ B;  3AZE A;  3AZH D;  2RIQ A;  1F66 A;  3AZE B;  4YM6 C;  3AZH A;  1F66 B;  3W97 A;  3W96 C;  3C1C D;  3UT9 C;  3AZH B;  5JRG C;  3W97 B;  3X1S C;  3AZF C;  3C1C A;  4ZUX C;  3A6N A;  3C1C B;  2HIO D;  4J8X D;  5BT1 C;  5KDM A;  3H0M C;  5KDM B;  4NFT A;  1P3G C;  4ZUX A;  5DNM C;  1HQ3 D;  3VH6 T;  2NQB C;  3REJ C;  1HQ3 A;  5CP6 C;  4Z66 D;  1ID3 D;  4J8W D;  1HQ3 B;  5B40 C;  2F8N A;  4Z66 A;  3A1K A;  1ID3 A;  4DRB A;  2F8N B;  4Z66 B;  5C3I B;  1ID3 B;  4J8W B;  2PYO D;  3MGR C;  3VH5 A;  5AV5 A;  2LY8 A;  1P3K C;  2PYO A;  5CPK C;  2CV5 D;  2PYO B;  3REJ A;  2BYK A;  5B0Y C;  2CV5 A;  2BYK B;  2CV5 B;  5B40 A;  1PZR A;  4NE3 A;  3VH5 W;  5B31 D;  2F2A C;  3REK A;  5B33 C;  5B31 B;  3REK B;  5AVB C;  3AZI C;  4HGA B;  3AN2 D;  4ZBJ C;  5FUG A;  3KFU G;  4QLC D;  3MGQ C;  5FUG B;  5GSU C;  4QLC A;  5B2J C;  4KHA A;  4R8P D;  4QLC B;  1P34 A;  2Y2L A;  4KHA B;  5GXQ C;  4R8P A;  1P34 B;  4R8P B;  2XD1 A;  3AFA C;  3W99 C;  3AZJ D;  4H9S A;  4WU8 D;  4X23 C;  3AZJ A;  3AYW C;  5B0Z D;  3AZJ B;  2JSS A;  5B0Z A;  3WTP E;  3REH D;  5B0Z B;  5AVC C;  1Z2C B;  1P3M C;  3REH A;  1W2E A;  2DF4 C;  2JE5 A;  3REH B;  1P3B C;  3X1T D;  3MNN C;  3UTA C;  3X1T A;  4G92 B;  3X1T B;  2RVQ D;  3AV1 C;  3B6G C;  4NE6 A;  5B24 D;  2Y2M A;  3EG5 B;  3O62 D;  3AZL D;  3AZN D;  5B24 A;  3AZL A;  2Y2G A;  1R4V A;  2ZY2 A;  5B24 B;  3AZL B;  3AZN A;  1P3A A;  2F8N K;  3AZN B;  1P3A B;  5GT3 C;  5GT0 C;  4JJN A;  1P3P C;  4JJN B;  3B6G A;  1M18 C;  1KU5 A;  4KUD D;  4LD9 D;  3FDD A;  3H0L C;  3AZG D;  2DQN C;  4KUD A;  3AL0 C;  4KUD B;  3B6F A;  3X1U D;  1ZLA D;  2HUE B;  2Y2I A;  3B6F B;  1F1E A;  2BYM A;  3X1U A;  5E5A A;  3EPJ A;  1ZLA A;  5AV6 A;  2BYM B;  3X1U B;  5E5A B;  1ZLA B;  3LZ0 C;  3MGS C;  1TZY D;  3LJA C;  3KXB D;  1KX4 C;  1TZY A;  5F99 D;  1P3I D;  1P3F C;  3EPH A;  1TZY B;  3KXB A;  4XUJ D;  5F99 A;  1KX3 C;  3KXB B;  5F99 B;  3WKJ C;  3MVD A;  3AZE C;  4Z5T D;  3MVD B;  1F66 C;  4Z5T A;  3AZH C;  3W97 C;  4Z5T B;  4XZQ D;  3C1C C;  3A6N C;  4XZQ A;  2Y2J A;  5B2I D;  1P3L D;  2NZD D;  4XZQ B;  5DNN A;  2ZY3 A;  1S32 A;  1P3L A;  4G91 B;  3V9R B;  5DNN B;  1S32 B;  3WAA A;  2NZD A;  1P3L B;  2NZD B;  3WAA B;  2JCH A;  2IO5 B;  2ZY4 A;  4UPK A;  2BG1 A;  5B32 G;  4WNN A;  5AV8 D;  4WNN B;  1Q9C A;  4WJ3 C;  3REI D;  5AV8 B;  3KUY D;  2HIO A;  4DRA A;  4EO5 B;  3KUY A;  1HQ3 C;  2HIO B;  4J8X A;  3MGP D;  3KUY B;  4DQY B;  4J8X B;  4Z66 C;  5C3I C;  1ID3 C;  3MGP A;  3IP4 C;  3MGP B;  3W98 D;  5AV5 C;  2PYO C;  3W98 A;  5CPI D;  3W98 B;  2CV5 C;  5CPI A;  2F8N G;  5CPI B;  4J8W A;  5BNX A;  5B1L D;  5BNX B;  3REK C;  3WTP D;  2G5H C;  5B1L A;  4HGA C;  1BH9 A;  3WTP A;  3UT9 D;  5B1L B;  1BH9 B;  3WTP B;  5G49 B;  3KWQ D;  4QLC C;  1BH8 A;  5B31 A;  1P34 C;  1BH8 B;  4R8P C;  4WU9 D;  1ULY A;  3KWQ B;  4H9O B;  4H9S C;  4WU9 B;  2ARO D;  3AZJ C;  3AV2 D;  3AN2 A;  3AN2 B;  5BS7 A;  2NQB D;  5B0Z C;  2FJ7 D;  2ARO B;  3AV2 B;  1U35 D;  2FJ7 A;  3REH C;  2Y2N A;  4M6B A;  2FJ7 B;  1U35 A;  2L5A A;  1U35 B;  4G92 C;  1P3K D;  3X1T C;  4WU8 A;  5BO0 A;  1KX5 D;  3NQJ A;  4WU8 B;  2W8S A;  5BO0 B;  3NQJ B;  1KX5 A;  2RVQ C;  1KX5 B;  3X1V D;  2Y2P A;  1M19 D;  5B24 C;  3AZL C;  1M19 A;  3AZN C;  3X1V B;  1P3A C;  1M19 B;  4KGC D;  1JFI B;  4JJN C;  3TU4 D;  5AV9 D;  4KGC A;  2F8N H;  3VH6 A;  4KGC B;  4J8U D;  3TU4 A;  5AV9 A;  3TU4 B;  5AV9 B;  3MGQ D;  4J8U A;  5GSU D;  3O62 A;  4J8U B;  4H9Q A;  2Y2O A;  3O62 B;  4H9Q B;  3VH6 W;  3B0B A;  3AFA D;  4KUD C;  3W99 D;  2HUE C;  3B6F C;  1AOI D;  3X1U C;  5E5A C;  1ZLA C;  1B67 A;  5AV6 C;  1AOI B;  4CAY A;  4AWL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...