3KXBD

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
YVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 86
sequence length 86
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbD00
1N1JA 3TU4A 5GXQD 5B40C 5B1LC 5DNMC 4WZSB 4YS3C 3AV1D 3AZNC 3LJAC 4ZUXD 2JSSA 1M1AC 5B1MB 4Z5TB 3B6FD 4J8WD 3WKJD 3AV2D 4QLCA 3O62A 5B0YB 1KX4B 5BT1D 1HQ3D 3UTBC 3UTAB 5C3IB 3WAAC 1ZLAB 4J8XB 1U35B 5AVBA 4R8PD 3MGRA 4QLCC 3AZJA 4Z5TD 3AZGA 1P3FD 3C1CD 5CPKB 3NQUA 3REJB 4Z2MG 5JRGA 1EQZB 2AROD 5B33A 5AV5B 3MVDB 5B31G 3UTAD 4CAYB 3AYWC 3AZGC 1P3IA 4KGCB 1U35D 5B31D 1KX4C 1P3AD 4WNNB 2HIOB 5JRGC 3MGQA 2L5AA 5F99A 5B0ZB 1KX5B 5B2JB 3LZ0B 4JJNB 1P3IC 5AV5D 3MVDD 3B6GB 4H9NB 3REJC 4G91C 5DNND 3MGQC 3REHB 5F99C 3X1UD 3WTPA 2HIOD 2PYOA 4KUDA 3RELC 4E44A 4H9RA 5GSUD 3W98B 4EO5C 1P3KD 2HUEB 3AZIC 5B2JD 3KXBD 3LZ0D 3AN2D 4JJND 4UUZA 3KUYD 3REID 3WTPC 4H9OB 1ID3B 4KUDC 3LZ1A 3REHD 2CV5B 4XUJB 5BNVA 3AZHB 2F8NB 1B6WA 3REKA 3LZ1C 3R45B 4XZQA 1P3LB 3X1VB 1M19A 1S32C 3MGPB 4CSRB 2F8NG 1B67A 2YFVB 3AZKA 3B0BA 2F8ND 3REKC 2NZDD 1P3BB 3W99B 1P3MB 1M19C 5BNXA 3KWQA 5GT0D 3X1VD 5AV8D 5CP6A 4Z66A 3X1TB 3MGPD 3MGSA 3LELD 4YM6B 3W97B 5KDMA 4X23A 3KWQC 1KX3D 4H9QA 4H9SA 3A6NB 5CP6C 4Z66C 1P3GB 2RVQD 1M18A 5BO0A 3AZLA 4WU9B 2NQBC 3MNNB 3X1TD 4X23C 4YM6D 4ZBJC 4WU8A 5B1LB 4H9SC 5DNMB 4YS3B 1P3PA 2YFWA 3AZNB 2F8NK 3LJAB 1M18C 3WA9D 2BYMA 4J8UA 3A6ND 3AZLC 1M1AB 1AOID 1P34A 5B2IC 1BH8A 1P3GD 1N1JB 3TU4B 4WU8C 5AV6A 4J8VA 1P3PC 5B40D 5B1LD 5DNMD 4J8UC 3UTBB 1P34C 3WAAB 1M1AD 1WWIA 4J8VC 4QLCB 3W96A 5GT3A 3AZFD 3C1BA 5B32A 3TU4C 5AY8A 3UTBD 1P3OA 3AFAA 3AYWB 5CPID 3VH6W 5CPJA 3AZMA 3WAAD 5FUGA 3AZGB 5GXQA 1JFIA 3C1BC 3NQUB 5B32C 5JRGB 5AY8C 3UT9A 3AZMC 5B1MD 4WV4B 3VH5W 1P3IB 3O62C 1F66A 4DRAA 5GXQC 4LD9A 3AYWD 3B6FA 3B0CW 4J8WA 4G91B 3AZGD 3AV2A 3MGQB 3WKJA 5B0YD 5F99B 1H3OA 1KX4D 3UT9C 5AVBC 1HQ3A 3MGRC 3RELB 3AZJC 1ZLAD 1F66C 4J8XD 4EO5B 4LD9C 3AZIB 4NFTA 4J8WC 4R8PA 5BS7A 5B33C 1P3FA 5CPKD 3WTPB 5BT1C 3REJD 1HQ3C 3C1CA 1EQZD 4KUDB 3MGQD 4H9RB 5F99D 2AROA 3VH6A 3RELD 3UTAA 4KGCD 4R8PC 4UUZB 5BS7C 3X1SA 3AZID 1U35A 5G49A 5B31A 1P3FC 1P3AA 3C1CC 3LZ1B 5B0ZD 1KX5D 2AROC 1S32B 3VH5A 3B6GD 3X1SC 3MVDA 5B31C 3B0DC 2PYOC 1P3AC 3REKB 1M19B 5DNNA 3X1UA 3W98D 2HIOA 3AZKB 5GSUA 1S32D 1P3KA 4E45A 3KXBA 4NE3A 3AN2A 1TAFA 3NQJA 5DNNC 3KUYA 3REIA 1ID3D 3X1UC 3KWQB 3REKD 2CV5D 4XUJD 3REHA 5GSUC 5CP6B 4Z66B 1P3KC 3AZHD 3KXBC 4XZQC 3AN2C 3KSYA 5E5AA 3KUYC 2NQBB 3REIC 5KDMB 4X23B 1BH9A 1P3LD 4ZBJB 2BYKA 4H9QB 3AZKC 4NE6A 3KWQD 4KHAB 1M18B 3AZLB 5E5AC 4H9PA 5B2IB 1P3BD 3W99D 1P3MD 4WU8B 2NZDA 5JA4A 5AVCA 2NQBD 1P3PB 2YFWB 4X23D 3MGSC 1A7WA 2BYMB 4J8UB 5GT0A 3X1VA 1P34B 1BH8B 5AV8A 1M18D 2FJ7A 3W97D 3LELA 3AZLD 2NZDC 5AVCC 5B2ID 4J8VB 1KX3A 5GT0C 5AV8C 1TZYA 5B24A 4J8UD 4WU9D 2FJ7C 3LELC 3MNND 5CPIB 3X1TA 1KX3C 4YS3D 4YM6A 3C1BB 3AZND 3LJAD 1TZYC 4DRBA 5B32B 3AZEA 5AY8B 5B24C 2RVQC 5AV6C 1P3OB 3WA9A 1AOIA 3AZMB 3TU4D 5FUGB 1P3GA 3O62B 2IO5C 5GXQB 3AZEC 5B32G 3V9RA 3UT9B 5B40A 3WA9C 5AVBB 3C1BD 1AOIC 5B32D 3MGRB 3W96C 5AV9A 3AZJB 5AY8D 1F66B 5GT3C 4LD9B 3B6FB 4QLCD 4J8WB 3WKJB 3AV1A 3O62D 5B33B 4ZUXA 1H3OB 1P3OC 3AFAC 3AZFA 5CPJC 1HQ3B 5AV9C 3UT9D 4HGAC 5AVBD 3MGRD 3UTBA 3AZJD 5CPIA 4R8PB 3AV1C 1F66D 3WAAA 4ZUXC 1P3FB 4LD9D 4AWLC 3AZFC 5JRGD 3C1CB 5B33D 1HTAA 2AROB 3B6FC 5CPIC 3AV2C 1P3ID 3WKJC 5B1MA 4Z5TA 3X1SB 5G49B 5B31B 3B0DB 2PYOB 1P3AB 3AYWA 1BFMA 5B0YA 1KX4A 5B1MC 4Z5TC 1ZLAA 4J8XA 5BNVB 5DNNB 3X1SD 3WTPD 5B0YC 2PYOD 4KUDD 5CPKA 3X1UB 3UTAC 5C3IC 3REJA 1EQZA 1ZLAC 5AV5A 5GSUB 4J8XC 1U35C 1P3KB 4CAYA 1R4VA 3KXBB 4XZQB 3AN2B 3RELA 1TAFB 4KGCA 1WWSA 3NQJB 3KUYB 3REIB 4WNNA 3AZIA 3LZ1D 5CPKC 3VH6T 1EQZC 5AV5C 5B0ZA 3MVDC 1KX5A 5B2JA 3LZ0A 4JJNA 4KGCC 2LY8A 5E5AB 5BNXB 3B6GA 4H9NA 4XZQD 1BH9B 2HIOC 1M19D 2BYKB 3VH5T 5B0ZC 1KX5C 1KU5A 4Z2MH 5B2JC 3WTPE 3LZ0C 3MGSB 4M6BA 3AZKD 3B0CT 4JJNC 3W98A 4H9PB 3B6GC 1S32A 3REHC 2NZDB 5E5AD 5JA4B 2CWEA 5AVCB 4H9OA 1ID3A 2CV5A 3W98C 4XUJA 5BO0B 5GT0B 5CP6D 4Z66D 2HUEC 5AV8B 5CHLB 3MGSD 3AZHA 2F8NA 2FJ7B 3LELB 1F1EA 1ID3C 3R45A 1KX3B 4G92B 2CV5C 4XUJC 5AVCD 1P3LA 1TZYB 3MGPA 3AZHC 4CSRA 5B24B 1Q9CA 5AV6B 2YFVA 2IO5B 2FJ7D 4WU8D 1P3LC 1P3BA 3W99A 3X1VC 1P3MA 1P3PD 2NQBA 3AZEB 3MGPC 3WA9B 1P34D 1AOIB 1TZYD 3W96B 5B24D 4KHAA 4G92C 5GT3B 5AV6D 3W99C 1P3BC 4J8VD 4NE5A 3W97A 1P3MC 5B2IA 3V9RB 5B40B 3AFAB 1ULYA 3A6NA 5CPJB 3AZED 5AV9B 3X1TC 2F8NH 4HGAB 4YM6C 1JFIB 4WU9A 3W97C 3MNNA 3W96D 3AV1B 4ZUXB 5GT3D 5B1LA 5DNMA 4AWLB 3A6NC 3AZFB 4YS3A 3AZNA 1P3GC 3LJAA 1P3OD 3AFAD 4WU9C 5CPJD 3AZMD 1M1AA 3MNNC 5AV9D 3AV2B
chains in the Genus database with same CATH superfamily
1N1JA 3TU4A 5GXQD 5B40C 5B1LC 5DNMC 4WZSB 4YS3C 3AV1D 3AZNC 3LJAC 4ZUXD 2JSSA 1M1AC 2VQRA 5B1MB 4Z5TB 2UWXA 3B6FD 4J8WD 2W8SA 3AV2D 3WKJD 4QLCA 3O62A 5B0YB 1KX4B 5BT1D 2G5IC 1HQ3D 3UTBC 3UTAB 5C3IB 3WAAC 2ZY5A 1ZLAB 4J8XB 1U35B 5AVBA 4R8PD 3MGRA 4QLCC 3AZJA 4Z5TD 3AZGA 1P3FD 3FDDA 3C1CD 5CPKB 3NQUA 3REJB 4Z2MG 5JRGA 1EQZB 2AROD 5B33A 5AV5B 3MVDB 5B31G 3UTAD 4CAYB 3AYWC 3AZGC 1P3IA 4KGCB 1U35D 5B31D 1KX4C 1P3AD 4WNNB 2HIOB 5JRGC 3MGQA 2L5AA 5F99A 5B0ZB 1KX5B 5B2JB 3LZ0B 4JJNB 1P3IC 5AV5D 3MVDD 2JE5A 3B6GB 4H9NB 3REJC 4G91C 5DNND 3MGQC 3REHB 5F99C 3X1UD 3WTPA 2HIOD 2PYOA 4KUDA 3RELC 4E44A 2XD5A 4H9RA 5GSUD 3W98B 4EO5C 1P3KD 2HUEB 3P5JB 5B2JD 3KXBD 3LZ0D 3AZIC 3AN2D 4JJND 4UUZA 3KUYD 3REID 3WTPC 4H9OB 2JCHA 1ID3B 4KUDC 1PZRA 3LZ1A 3REHD 2CV5B 4XUJB 5BNVA 2Y2LA 3AZHB 2F8NB 2Y2QA 1B6WA 3REKA 3LZ1C 3R45B 4XZQA 1P3LB 3X1VB 1M19A 1S32C 3MGPB 4CSRB 2F8NG 1B67A 2YFVB 3EPJA 3AZKA 3B0BA 1Z2CB 2F8ND 3REKC 2NZDD 1P3BB 3W99B 1P3MB 1M19C 5BNXA 3KWQA 2DF4C 5GT0D 3X1VD 2BG1A 5AV8D 5CP6A 4Z66A 3X1TB 3MGPD 3MGSA 3LELD 4YM6B 3W97B 2J8PA 5KDMA 4X23A 3KWQC 1KX3D 2Y2JA 4H9QA 4H9SA 3A6NB 5CP6C 4Z66C 1P3GB 2RVQD 1M18A 5BO0A 3AZLA 4WU9B 2NQBC 3MNNB 3X1TD 4X23C 2Y2IA 4YM6D 4ZBJC 4WU8A 5B1LB 4H9SC 5DNMB 4YS3B 1P3PA 2YFWA 3AZNB 2F8NK 3LJAB 3KFUG 1M18C 3WA9D 2BYMA 4J8UA 3A6ND 3AZLC 1M1AB 1AOID 1P34A 5B2IC 1BH8A 1P3GD 1N1JB 3TU4B 4WU8C 3AL0C 5AV6A 4J8VA 1P3PC 5B40D 5B1LD 5DNMD 4J8UC 3UTBB 1P34C 3WAAB 1M1AD 2RIQA 1WWIA 4J8VC 4QLCB 3W96A 5GT3A 3AZFD 3C1BA 3IP4C 5B32A 3TU4C 4DQYB 5AY8A 3UTBD 1P3OA 3AFAA 3AYWB 2Y2MA 3VH6W 5CPJA 3AZMA 5CPID 3WAAD 5FUGA 3AZGB 5GXQA 1JFIA 3C1BC 3NQUB 5B32C 5JRGB 2FFFB 5AY8C 3UT9A 4WJ3C 3AZMC 5B1MD 4WV4B 3VH5W 1P3IB 3O62C 1F66A 4DRAA 5GXQC 4LD9A 3AYWD 3B6FA 2Y2KA 3B0CW 4G91B 4J8WA 3AZGD 3MGQB 3AV2A 3WKJA 5B0YD 5F99B 1H3OA 1KX4D 3UT9C 5AVBC 1HQ3A 3MGRC 3H0RC 3RELB 3AZJC 1ZLAD 1F66C 4J8XD 3H0MC 4EO5B 4LD9C 3AZIB 4NFTA 4J8WC 4R8PA 2ZM5A 5BS7A 3EPKA 5B33C 1P3FA 5CPKD 3WTPB 5BT1C 3REJD 1HQ3C 3C1CA 1EQZD 4KUDB 2Y2HA 3MGQD 4H9RB 5F99D 2AROA 3VH6A 3RELD 3UTAA 4KGCD 4R8PC 4UUZB 5BS7C 3X1SA 3AZID 1U35A 5G49A 5B31A 3H0LC 1P3FC 1P3AA 3C1CC 3LZ1B 5B0ZD 1KX5D 2AROC 1S32B 3VH5A 3B6GD 3X1SC 3MVDA 5B31C 2ZY3A 3B0DC 2PYOC 1P3AC 3REKB 1M19B 5DNNA 2Y2PA 3X1UA 3W98D 2HIOA 3AZKB 5GSUA 1S32D 1P3KA 4E45A 3KXBA 4NE3A 3AN2A 1TAFA 3NQJA 5DNNC 3KUYA 3REIA 1ID3D 3X1UC 3KWQB 3REKD 2CV5D 4XUJD 3REHA 5GSUC 5CP6B 4Z66B 1P3KC 3AZHD 3KXBC 4XZQC 3AN2C 3KSYA 5E5AA 3KUYC 2NQBB 3REIC 5KDMB 4X23B 1BH9A 1P3LD 4ZBJB 2BYKA 4H9QB 3AZKC 4NE6A 3KWQD 4KHAB 1M18B 3AZLB 5E5AC 4H9PA 5B2IB 1P3BD 3W99D 1P3MD 3F6TA 4WU8B 2NZDA 5JA4A 5AVCA 2NQBD 1P3PB 2YFWB 4X23D 3MGSC 1A7WA 2BYMB 4J8UB 5GT0A 3X1VA 1P34B 1BH8B 5AV8A 1M18D 2FJ7A 3W97D 3LELA 3AZLD 2NZDC 5AVCC 1W2EA 5B2ID 4J8VB 3EG5B 1KX3A 5GT0C 5AV8C 1TZYA 5B24A 4J8UD 4WU9D 2FJ7C 3LELC 3MNND 5CPIB 3X1TA 1KX3C 3EPHA 4YS3D 4YM6A 3C1BB 3AZND 3LJAD 1TZYC 2Y2NA 4DRBA 5B32B 3AZEA 5AY8B 5B24C 2RVQC 5AV6C 1P3OB 3WA9A 1AOIA 3AZMB 3TU4D 5FUGB 1P3GA 3O62B 2IO5C 5GXQB 3AZEC 5B32G 3V9RA 3UT9B 5B40A 3WA9C 5AVBB 3C1BD 1AOIC 5B32D 3MGRB 3W96C 5AV9A 3AZJB 5AY8D 1F66B 2G5HC 5GT3C 4LD9B 3B6FB 4QLCD 4J8WB 3WKJB 3AV1A 3O62D 5B33B 4ZUXA 1H3OB 1P3OC 3AFAC 3AZFA 5CPJC 1HQ3B 5AV9C 3UT9D 4HGAC 5AVBD 3MGRD 3UTBA 3AZJD 5CPIA 4R8PB 3AV1C 1F66D 3WAAA 4ZUXC 1P3FB 4LD9D 4AWLC 3AZFC 5JRGD 3C1CB 5B33D 1HTAA 2AROB 3B6FC 5CPIC 3AV2C 1P3ID 3WKJC 5B1MA 4Z5TA 3X1SB 5G49B 5B31B 3B0DB 2PYOB 1P3AB 3AYWA 2Y2GA 1BFMA 5B0YA 1KX4A 5B1MC 4Z5TC 1ZLAA 4J8XA 3EPLA 3A1IA 5BNVB 5DNNB 3X1SD 5B0YC 3WTPD 2PYOD 4KUDD 5CPKA 3X1UB 3UTAC 5C3IC 3REJA 1EQZA 1ZLAC 2DQNC 5AV5A 5GSUB 4J8XC 1U35C 1P3KB 4CAYA 1R4VA 3KXBB 4XZQB 3AN2B 3RELA 1TAFB 4KGCA 1WWSA 3NQJB 3KUYB 3REIB 4WNNA 3AZIA 3LZ1D 5CPKC 2ZY4A 3VH6T 1EQZC 5AV5C 5B0ZA 3MVDC 1KX5A 5B2JA 3LZ0A 2XD1A 4JJNA 4KGCC 2LY8A 5E5AB 5BNXB 3B6GA 4H9NA 4XZQD 1BH9B 2HIOC 1M19D 2BYKB 3VH5T 5B0ZC 1KX5C 4UPKA 1KU5A 4Z2MH 5B2JC 3WTPE 3LZ0C 3MGSB 4M6BA 3AZKD 3B0CT 4JJNC 3W98A 4H9PB 3B6GC 1S32A 3REHC 2NZDB 5E5AD 5JA4B 2CWEA 5AVCB 4H9OA 1ID3A 2CV5A 3W98C 4XUJA 5BO0B 5GT0B 5CP6D 4Z66D 2HUEC 5AV8B 5CHLB 3MGSD 3AZHA 2F8NA 2FJ7B 3LELB 1F1EA 1ID3C 3R45A 1KX3B 4G92B 2CV5C 4XUJC 5AVCD 1P3LA 1TZYB 3MGPA 3AZHC 4CSRA 5B24B 1Q9CA 5AV6B 2YFVA 2F2AC 2IO5B 2FJ7D 4WU8D 1P3LC 1T3UA 1P3BA 3X1VC 1P3MA 1P3PD 3W99A 2NQBA 3AZEB 3MGPC 3WA9B 1P34D 1AOIB 1TZYD 3W96B 5B24D 4KHAA 4G92C 5GT3B 5AV6D 3W99C 2Y2OA 4J8VD 4NE5A 3W97A 1P3BC 1P3MC 5B2IA 3V9RB 5B40B 3AFAB 1ULYA 3A6NA 5CPJB 3AZED 5AV9B 3X1TC 2F8NH 4HGAB 4YM6C 1JFIB 4WU9A 3W97C 3MNNA 3W96D 3AV1B 4ZUXB 5GT3D 5B1LA 5DNMA 2ZY2A 3A6NC 4AWLB 3AZFB 4YS3A 3A1KA 3AZNA 1P3GC 3LJAA 1P3OD 3AFAD 4WU9C 5CPJD 3AZMD 1M1AA 3MNNC 5AV9D 3AV2B
chains in the Genus database with same CATH topology
1N1JA 3TU4A 5GXQD 5B40C 5B1LC 5DNMC 4WZSB 4YS3C 3AV1D 3AZNC 3LJAC 4ZUXD 2JSSA 1M1AC 2VQRA 5B1MB 4Z5TB 2UWXA 3B6FD 4J8WD 2W8SA 3AV2D 3WKJD 4QLCA 3O62A 5B0YB 1KX4B 5BT1D 2G5IC 1HQ3D 3UTBC 3UTAB 5C3IB 3WAAC 2ZY5A 1ZLAB 4J8XB 1U35B 5AVBA 4R8PD 3MGRA 4QLCC 3AZJA 4Z5TD 3AZGA 1P3FD 3FDDA 3C1CD 5CPKB 3NQUA 3REJB 4Z2MG 5JRGA 1EQZB 2AROD 5B33A 5AV5B 3MVDB 5B31G 3UTAD 4CAYB 3AYWC 3AZGC 1P3IA 4KGCB 1U35D 5B31D 1KX4C 1P3AD 4WNNB 2HIOB 5JRGC 3MGQA 2L5AA 5F99A 5B0ZB 1KX5B 5B2JB 3LZ0B 4JJNB 1P3IC 5AV5D 3MVDD 2JE5A 3B6GB 4H9NB 3REJC 4G91C 5DNND 3MGQC 3REHB 5F99C 3X1UD 3WTPA 2HIOD 2PYOA 4KUDA 3RELC 4E44A 2XD5A 4H9RA 5GSUD 3W98B 4EO5C 1P3KD 2HUEB 3P5JB 5B2JD 3KXBD 3LZ0D 3AZIC 3AN2D 4JJND 4UUZA 3KUYD 3REID 3WTPC 4H9OB 2JCHA 1ID3B 4KUDC 1PZRA 3LZ1A 3REHD 2CV5B 4XUJB 5BNVA 2Y2LA 3AZHB 2F8NB 2Y2QA 1B6WA 3REKA 3LZ1C 3R45B 4XZQA 1P3LB 3X1VB 1M19A 1S32C 3MGPB 4CSRB 2F8NG 1B67A 2YFVB 3EPJA 3AZKA 3B0BA 1Z2CB 2F8ND 3REKC 2NZDD 1P3BB 3W99B 1P3MB 1M19C 5BNXA 3KWQA 2DF4C 5GT0D 3X1VD 2BG1A 5AV8D 5CP6A 4Z66A 3X1TB 3MGPD 3MGSA 3LELD 4YM6B 3W97B 2J8PA 5KDMA 4X23A 3KWQC 1KX3D 2Y2JA 4H9QA 4H9SA 3A6NB 5CP6C 4Z66C 1P3GB 2RVQD 1M18A 5BO0A 3AZLA 4WU9B 2NQBC 3MNNB 3X1TD 4X23C 2Y2IA 4YM6D 4ZBJC 4WU8A 5B1LB 4H9SC 5DNMB 4YS3B 1P3PA 2YFWA 3AZNB 2F8NK 3LJAB 3KFUG 1M18C 3WA9D 2BYMA 4J8UA 3A6ND 3AZLC 1M1AB 1AOID 1P34A 5B2IC 1BH8A 1P3GD 1N1JB 3TU4B 4WU8C 3AL0C 5AV6A 4J8VA 1P3PC 5B40D 5B1LD 5DNMD 4J8UC 3UTBB 1P34C 3WAAB 1M1AD 2RIQA 1WWIA 4J8VC 4QLCB 3W96A 5GT3A 3AZFD 3C1BA 3IP4C 5B32A 3TU4C 4DQYB 5AY8A 3UTBD 1P3OA 3AFAA 3AYWB 2Y2MA 3VH6W 5CPJA 3AZMA 5CPID 3WAAD 5FUGA 3AZGB 5GXQA 1JFIA 3C1BC 3NQUB 5B32C 5JRGB 2FFFB 5AY8C 3UT9A 4WJ3C 3AZMC 5B1MD 4WV4B 3VH5W 1P3IB 3O62C 1F66A 4DRAA 5GXQC 4LD9A 3AYWD 3B6FA 2Y2KA 3B0CW 4G91B 4J8WA 3AZGD 3MGQB 3AV2A 3WKJA 5B0YD 5F99B 1H3OA 1KX4D 3UT9C 5AVBC 1HQ3A 3MGRC 3H0RC 3RELB 3AZJC 1ZLAD 1F66C 4J8XD 3H0MC 4EO5B 4LD9C 3AZIB 4NFTA 4J8WC 4R8PA 2ZM5A 5BS7A 3EPKA 5B33C 1P3FA 5CPKD 3WTPB 5BT1C 3REJD 1HQ3C 3C1CA 1EQZD 4KUDB 2Y2HA 3MGQD 4H9RB 5F99D 2AROA 3VH6A 3RELD 3UTAA 4KGCD 4R8PC 4UUZB 5BS7C 3X1SA 3AZID 1U35A 5G49A 5B31A 3H0LC 1P3FC 1P3AA 3C1CC 3LZ1B 5B0ZD 1KX5D 2AROC 1S32B 3VH5A 3B6GD 3X1SC 3MVDA 5B31C 2ZY3A 3B0DC 2PYOC 1P3AC 3REKB 1M19B 5DNNA 2Y2PA 3X1UA 3W98D 2HIOA 3AZKB 5GSUA 1S32D 1P3KA 4E45A 3KXBA 4NE3A 3AN2A 1TAFA 3NQJA 5DNNC 3KUYA 3REIA 1ID3D 3X1UC 3KWQB 3REKD 2CV5D 4XUJD 3REHA 5GSUC 5CP6B 4Z66B 1P3KC 3AZHD 3KXBC 4XZQC 3AN2C 3KSYA 5E5AA 3KUYC 2NQBB 3REIC 5KDMB 4X23B 1BH9A 1P3LD 4ZBJB 2BYKA 4H9QB 3AZKC 4NE6A 3KWQD 4KHAB 1M18B 3AZLB 5E5AC 4H9PA 5B2IB 1P3BD 3W99D 1P3MD 3F6TA 4WU8B 2NZDA 5JA4A 5AVCA 2NQBD 1P3PB 2YFWB 4X23D 3MGSC 1A7WA 2BYMB 4J8UB 5GT0A 3X1VA 1P34B 1BH8B 5AV8A 1M18D 2FJ7A 3W97D 3LELA 3AZLD 2NZDC 5AVCC 1W2EA 5B2ID 4J8VB 3EG5B 1KX3A 5GT0C 5AV8C 1TZYA 5B24A 4J8UD 4WU9D 2FJ7C 3LELC 3MNND 5CPIB 3X1TA 1KX3C 3EPHA 4YS3D 4YM6A 3C1BB 3AZND 3LJAD 1TZYC 2Y2NA 4DRBA 5B32B 3AZEA 5AY8B 5B24C 2RVQC 5AV6C 1P3OB 3WA9A 1AOIA 3AZMB 3TU4D 5FUGB 1P3GA 3O62B 2IO5C 5GXQB 3AZEC 5B32G 3V9RA 3UT9B 5B40A 3WA9C 5AVBB 3C1BD 1AOIC 5B32D 3MGRB 3W96C 5AV9A 3AZJB 5AY8D 1F66B 2G5HC 5GT3C 4LD9B 3B6FB 4QLCD 4J8WB 3WKJB 3AV1A 3O62D 5B33B 4ZUXA 1H3OB 1P3OC 3AFAC 3AZFA 5CPJC 1HQ3B 5AV9C 3UT9D 4HGAC 5AVBD 3MGRD 3UTBA 3AZJD 5CPIA 4R8PB 3AV1C 1F66D 3WAAA 4ZUXC 1P3FB 4LD9D 4AWLC 3AZFC 5JRGD 3C1CB 5B33D 1HTAA 2AROB 3B6FC 5CPIC 3AV2C 1P3ID 3WKJC 5B1MA 4Z5TA 3X1SB 5G49B 5B31B 3B0DB 2PYOB 1P3AB 3AYWA 2Y2GA 1BFMA 5B0YA 1KX4A 5B1MC 4Z5TC 1ZLAA 4J8XA 3EPLA 3A1IA 5BNVB 5DNNB 3X1SD 5B0YC 3WTPD 2PYOD 4KUDD 5CPKA 3X1UB 3UTAC 5C3IC 3REJA 1EQZA 1ZLAC 2DQNC 5AV5A 5GSUB 4J8XC 1U35C 1P3KB 4CAYA 1R4VA 3KXBB 4XZQB 3AN2B 3RELA 1TAFB 4KGCA 1WWSA 3NQJB 3KUYB 3REIB 4WNNA 3AZIA 3LZ1D 5CPKC 2ZY4A 3VH6T 1EQZC 5AV5C 5B0ZA 3MVDC 1KX5A 5B2JA 3LZ0A 2XD1A 4JJNA 4KGCC 2LY8A 5E5AB 5BNXB 3B6GA 4H9NA 4XZQD 1BH9B 2HIOC 1M19D 2BYKB 3VH5T 5B0ZC 1KX5C 4UPKA 1KU5A 4Z2MH 5B2JC 3WTPE 3LZ0C 3MGSB 4M6BA 3AZKD 3B0CT 4JJNC 3W98A 4H9PB 3B6GC 1S32A 3REHC 2NZDB 5E5AD 5JA4B 2CWEA 5AVCB 4H9OA 1ID3A 2CV5A 3W98C 4XUJA 5BO0B 5GT0B 5CP6D 4Z66D 2HUEC 5AV8B 5CHLB 3MGSD 3AZHA 2F8NA 2FJ7B 3LELB 1F1EA 1ID3C 3R45A 1KX3B 4G92B 2CV5C 4XUJC 5AVCD 1P3LA 1TZYB 3MGPA 3AZHC 4CSRA 5B24B 1Q9CA 5AV6B 2YFVA 2F2AC 2IO5B 2FJ7D 4WU8D 1P3LC 1T3UA 1P3BA 3X1VC 1P3MA 1P3PD 3W99A 2NQBA 3AZEB 3MGPC 3WA9B 1P34D 1AOIB 1TZYD 3W96B 5B24D 4KHAA 4G92C 5GT3B 5AV6D 3W99C 2Y2OA 4J8VD 4NE5A 3W97A 1P3BC 1P3MC 5B2IA 3V9RB 5B40B 3AFAB 1ULYA 3A6NA 5CPJB 3AZED 5AV9B 3X1TC 2F8NH 4HGAB 4YM6C 1JFIB 4WU9A 3W97C 3MNNA 3W96D 3AV1B 4ZUXB 5GT3D 5B1LA 5DNMA 2ZY2A 3A6NC 4AWLB 3AZFB 4YS3A 3A1KA 3AZNA 1P3GC 3LJAA 1P3OD 3AFAD 4WU9C 5CPJD 3AZMD 1M1AA 3MNNC 5AV9D 3AV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J A;  3TU4 A;  5GXQ D;  5B40 C;  5B1L C;  5DNM C;  4WZS B;  4YS3 C;  3AV1 D;  3AZN C;  3LJA C;  4ZUX D;  2JSS A;  1M1A C;  5B1M B;  4Z5T B;  3B6F D;  4J8W D;  3WKJ D;  3AV2 D;  4QLC A;  3O62 A;  5B0Y B;  1KX4 B;  5BT1 D;  1HQ3 D;  3UTB C;  3UTA B;  5C3I B;  3WAA C;  1ZLA B;  4J8X B;  1U35 B;  5AVB A;  4R8P D;  3MGR A;  4QLC C;  3AZJ A;  4Z5T D;  3AZG A;  1P3F D;  3C1C D;  5CPK B;  3NQU A;  3REJ B;  4Z2M G;  5JRG A;  1EQZ B;  2ARO D;  5B33 A;  5AV5 B;  3MVD B;  5B31 G;  3UTA D;  4CAY B;  3AYW C;  3AZG C;  1P3I A;  4KGC B;  1U35 D;  5B31 D;  1KX4 C;  1P3A D;  4WNN B;  2HIO B;  5JRG C;  3MGQ A;  2L5A A;  5F99 A;  5B0Z B;  1KX5 B;  5B2J B;  3LZ0 B;  4JJN B;  1P3I C;  5AV5 D;  3MVD D;  3B6G B;  4H9N B;  3REJ C;  4G91 C;  5DNN D;  3MGQ C;  3REH B;  5F99 C;  3X1U D;  3WTP A;  2HIO D;  2PYO A;  4KUD A;  3REL C;  4E44 A;  4H9R A;  5GSU D;  3W98 B;  4EO5 C;  1P3K D;  2HUE B;  3AZI C;  5B2J D;  3KXB D;  3LZ0 D;  3AN2 D;  4JJN D;  4UUZ A;  3KUY D;  3REI D;  3WTP C;  4H9O B;  1ID3 B;  4KUD C;  3LZ1 A;  3REH D;  2CV5 B;  4XUJ B;  5BNV A;  3AZH B;  2F8N B;  1B6W A;  3REK A;  3LZ1 C;  3R45 B;  4XZQ A;  1P3L B;  3X1V B;  1M19 A;  1S32 C;  3MGP B;  4CSR B;  2F8N G;  1B67 A;  2YFV B;  3AZK A;  3B0B A;  2F8N D;  3REK C;  2NZD D;  1P3B B;  3W99 B;  1P3M B;  1M19 C;  5BNX A;  3KWQ A;  5GT0 D;  3X1V D;  5AV8 D;  5CP6 A;  4Z66 A;  3X1T B;  3MGP D;  3MGS A;  3LEL D;  4YM6 B;  3W97 B;  5KDM A;  4X23 A;  3KWQ C;  1KX3 D;  4H9Q A;  4H9S A;  3A6N B;  5CP6 C;  4Z66 C;  1P3G B;  2RVQ D;  1M18 A;  5BO0 A;  3AZL A;  4WU9 B;  2NQB C;  3MNN B;  3X1T D;  4X23 C;  4YM6 D;  4ZBJ C;  4WU8 A;  5B1L B;  4H9S C;  5DNM B;  4YS3 B;  1P3P A;  2YFW A;  3AZN B;  2F8N K;  3LJA B;  1M18 C;  3WA9 D;  2BYM A;  4J8U A;  3A6N D;  3AZL C;  1M1A B;  1AOI D;  1P34 A;  5B2I C;  1BH8 A;  1P3G D;  1N1J B;  3TU4 B;  4WU8 C;  5AV6 A;  4J8V A;  1P3P C;  5B40 D;  5B1L D;  5DNM D;  4J8U C;  3UTB B;  1P34 C;  3WAA B;  1M1A D;  1WWI A;  4J8V C;  4QLC B;  3W96 A;  5GT3 A;  3AZF D;  3C1B A;  5B32 A;  3TU4 C;  5AY8 A;  3UTB D;  1P3O A;  3AFA A;  3AYW B;  5CPI D;  3VH6 W;  5CPJ A;  3AZM A;  3WAA D;  5FUG A;  3AZG B;  5GXQ A;  1JFI A;  3C1B C;  3NQU B;  5B32 C;  5JRG B;  5AY8 C;  3UT9 A;  3AZM C;  5B1M D;  4WV4 B;  3VH5 W;  1P3I B;  3O62 C;  1F66 A;  4DRA A;  5GXQ C;  4LD9 A;  3AYW D;  3B6F A;  3B0C W;  4J8W A;  4G91 B;  3AZG D;  3AV2 A;  3MGQ B;  3WKJ A;  5B0Y D;  5F99 B;  1H3O A;  1KX4 D;  3UT9 C;  5AVB C;  1HQ3 A;  3MGR C;  3REL B;  3AZJ C;  1ZLA D;  1F66 C;  4J8X D;  4EO5 B;  4LD9 C;  3AZI B;  4NFT A;  4J8W C;  4R8P A;  5BS7 A;  5B33 C;  1P3F A;  5CPK D;  3WTP B;  5BT1 C;  3REJ D;  1HQ3 C;  3C1C A;  1EQZ D;  4KUD B;  3MGQ D;  4H9R B;  5F99 D;  2ARO A;  3VH6 A;  3REL D;  3UTA A;  4KGC D;  4R8P C;  4UUZ B;  5BS7 C;  3X1S A;  3AZI D;  1U35 A;  5G49 A;  5B31 A;  1P3F C;  1P3A A;  3C1C C;  3LZ1 B;  5B0Z D;  1KX5 D;  2ARO C;  1S32 B;  3VH5 A;  3B6G D;  3X1S C;  3MVD A;  5B31 C;  3B0D C;  2PYO C;  1P3A C;  3REK B;  1M19 B;  5DNN A;  3X1U A;  3W98 D;  2HIO A;  3AZK B;  5GSU A;  1S32 D;  1P3K A;  4E45 A;  3KXB A;  4NE3 A;  3AN2 A;  1TAF A;  3NQJ A;  5DNN C;  3KUY A;  3REI A;  1ID3 D;  3X1U C;  3KWQ B;  3REK D;  2CV5 D;  4XUJ D;  3REH A;  5GSU C;  5CP6 B;  4Z66 B;  1P3K C;  3AZH D;  3KXB C;  4XZQ C;  3AN2 C;  3KSY A;  5E5A A;  3KUY C;  2NQB B;  3REI C;  5KDM B;  4X23 B;  1BH9 A;  1P3L D;  4ZBJ B;  2BYK A;  4H9Q B;  3AZK C;  4NE6 A;  3KWQ D;  4KHA B;  1M18 B;  3AZL B;  5E5A C;  4H9P A;  5B2I B;  1P3B D;  3W99 D;  1P3M D;  4WU8 B;  2NZD A;  5JA4 A;  5AVC A;  2NQB D;  1P3P B;  2YFW B;  4X23 D;  3MGS C;  1A7W A;  2BYM B;  4J8U B;  5GT0 A;  3X1V A;  1P34 B;  1BH8 B;  5AV8 A;  1M18 D;  2FJ7 A;  3W97 D;  3LEL A;  3AZL D;  2NZD C;  5AVC C;  5B2I D;  4J8V B;  1KX3 A;  5GT0 C;  5AV8 C;  1TZY A;  5B24 A;  4J8U D;  4WU9 D;  2FJ7 C;  3LEL C;  3MNN D;  5CPI B;  3X1T A;  1KX3 C;  4YS3 D;  4YM6 A;  3C1B B;  3AZN D;  3LJA D;  1TZY C;  4DRB A;  5B32 B;  3AZE A;  5AY8 B;  5B24 C;  2RVQ C;  5AV6 C;  1P3O B;  3WA9 A;  1AOI A;  3AZM B;  3TU4 D;  5FUG B;  1P3G A;  3O62 B;  2IO5 C;  5GXQ B;  3AZE C;  5B32 G;  3V9R A;  3UT9 B;  5B40 A;  3WA9 C;  5AVB B;  3C1B D;  1AOI C;  5B32 D;  3MGR B;  3W96 C;  5AV9 A;  3AZJ B;  5AY8 D;  1F66 B;  5GT3 C;  4LD9 B;  3B6F B;  4QLC D;  4J8W B;  3WKJ B;  3AV1 A;  3O62 D;  5B33 B;  4ZUX A;  1H3O B;  1P3O C;  3AFA C;  3AZF A;  5CPJ C;  1HQ3 B;  5AV9 C;  3UT9 D;  4HGA C;  5AVB D;  3MGR D;  3UTB A;  3AZJ D;  5CPI A;  4R8P B;  3AV1 C;  1F66 D;  3WAA A;  4ZUX C;  1P3F B;  4LD9 D;  4AWL C;  3AZF C;  5JRG D;  3C1C B;  5B33 D;  1HTA A;  2ARO B;  3B6F C;  5CPI C;  3AV2 C;  1P3I D;  3WKJ C;  5B1M A;  4Z5T A;  3X1S B;  5G49 B;  5B31 B;  3B0D B;  2PYO B;  1P3A B;  3AYW A;  1BFM A;  5B0Y A;  1KX4 A;  5B1M C;  4Z5T C;  1ZLA A;  4J8X A;  5BNV B;  5DNN B;  3X1S D;  3WTP D;  5B0Y C;  2PYO D;  4KUD D;  5CPK A;  3X1U B;  3UTA C;  5C3I C;  3REJ A;  1EQZ A;  1ZLA C;  5AV5 A;  5GSU B;  4J8X C;  1U35 C;  1P3K B;  4CAY A;  1R4V A;  3KXB B;  4XZQ B;  3AN2 B;  3REL A;  1TAF B;  4KGC A;  1WWS A;  3NQJ B;  3KUY B;  3REI B;  4WNN A;  3AZI A;  3LZ1 D;  5CPK C;  3VH6 T;  1EQZ C;  5AV5 C;  5B0Z A;  3MVD C;  1KX5 A;  5B2J A;  3LZ0 A;  4JJN A;  4KGC C;  2LY8 A;  5E5A B;  5BNX B;  3B6G A;  4H9N A;  4XZQ D;  1BH9 B;  2HIO C;  1M19 D;  2BYK B;  3VH5 T;  5B0Z C;  1KX5 C;  1KU5 A;  4Z2M H;  5B2J C;  3WTP E;  3LZ0 C;  3MGS B;  4M6B A;  3AZK D;  3B0C T;  4JJN C;  3W98 A;  4H9P B;  3B6G C;  1S32 A;  3REH C;  2NZD B;  5E5A D;  5JA4 B;  2CWE A;  5AVC B;  4H9O A;  1ID3 A;  2CV5 A;  3W98 C;  4XUJ A;  5BO0 B;  5GT0 B;  5CP6 D;  4Z66 D;  2HUE C;  5AV8 B;  5CHL B;  3MGS D;  3AZH A;  2F8N A;  2FJ7 B;  3LEL B;  1F1E A;  1ID3 C;  3R45 A;  1KX3 B;  4G92 B;  2CV5 C;  4XUJ C;  5AVC D;  1P3L A;  1TZY B;  3MGP A;  3AZH C;  4CSR A;  5B24 B;  1Q9C A;  5AV6 B;  2YFV A;  2IO5 B;  2FJ7 D;  4WU8 D;  1P3L C;  1P3B A;  3W99 A;  3X1V C;  1P3M A;  1P3P D;  2NQB A;  3AZE B;  3MGP C;  3WA9 B;  1P34 D;  1AOI B;  1TZY D;  3W96 B;  5B24 D;  4KHA A;  4G92 C;  5GT3 B;  5AV6 D;  3W99 C;  1P3B C;  4J8V D;  4NE5 A;  3W97 A;  1P3M C;  5B2I A;  3V9R B;  5B40 B;  3AFA B;  1ULY A;  3A6N A;  5CPJ B;  3AZE D;  5AV9 B;  3X1T C;  2F8N H;  4HGA B;  4YM6 C;  1JFI B;  4WU9 A;  3W97 C;  3MNN A;  3W96 D;  3AV1 B;  4ZUX B;  5GT3 D;  5B1L A;  5DNM A;  4AWL B;  3A6N C;  3AZF B;  4YS3 A;  3AZN A;  1P3G C;  3LJA A;  1P3O D;  3AFA D;  4WU9 C;  5CPJ D;  3AZM D;  1M1A A;  3MNN C;  5AV9 D;  3AV2 B; 
#chains in the Genus database with same CATH topology
 1N1J A;  3TU4 A;  5GXQ D;  5B40 C;  5B1L C;  5DNM C;  4WZS B;  4YS3 C;  3AV1 D;  3AZN C;  3LJA C;  4ZUX D;  2JSS A;  1M1A C;  2VQR A;  5B1M B;  4Z5T B;  2UWX A;  3B6F D;  4J8W D;  2W8S A;  3AV2 D;  3WKJ D;  4QLC A;  3O62 A;  5B0Y B;  1KX4 B;  5BT1 D;  2G5I C;  1HQ3 D;  3UTB C;  3UTA B;  5C3I B;  3WAA C;  2ZY5 A;  1ZLA B;  4J8X B;  1U35 B;  5AVB A;  4R8P D;  3MGR A;  4QLC C;  3AZJ A;  4Z5T D;  3AZG A;  1P3F D;  3FDD A;  3C1C D;  5CPK B;  3NQU A;  3REJ B;  4Z2M G;  5JRG A;  1EQZ B;  2ARO D;  5B33 A;  5AV5 B;  3MVD B;  5B31 G;  3UTA D;  4CAY B;  3AYW C;  3AZG C;  1P3I A;  4KGC B;  1U35 D;  5B31 D;  1KX4 C;  1P3A D;  4WNN B;  2HIO B;  5JRG C;  3MGQ A;  2L5A A;  5F99 A;  5B0Z B;  1KX5 B;  5B2J B;  3LZ0 B;  4JJN B;  1P3I C;  5AV5 D;  3MVD D;  2JE5 A;  3B6G B;  4H9N B;  3REJ C;  4G91 C;  5DNN D;  3MGQ C;  3REH B;  5F99 C;  3X1U D;  3WTP A;  2HIO D;  2PYO A;  4KUD A;  3REL C;  4E44 A;  2XD5 A;  4H9R A;  5GSU D;  3W98 B;  4EO5 C;  1P3K D;  2HUE B;  3P5J B;  5B2J D;  3KXB D;  3LZ0 D;  3AZI C;  3AN2 D;  4JJN D;  4UUZ A;  3KUY D;  3REI D;  3WTP C;  4H9O B;  2JCH A;  1ID3 B;  4KUD C;  1PZR A;  3LZ1 A;  3REH D;  2CV5 B;  4XUJ B;  5BNV A;  2Y2L A;  3AZH B;  2F8N B;  2Y2Q A;  1B6W A;  3REK A;  3LZ1 C;  3R45 B;  4XZQ A;  1P3L B;  3X1V B;  1M19 A;  1S32 C;  3MGP B;  4CSR B;  2F8N G;  1B67 A;  2YFV B;  3EPJ A;  3AZK A;  3B0B A;  1Z2C B;  2F8N D;  3REK C;  2NZD D;  1P3B B;  3W99 B;  1P3M B;  1M19 C;  5BNX A;  3KWQ A;  2DF4 C;  5GT0 D;  3X1V D;  2BG1 A;  5AV8 D;  5CP6 A;  4Z66 A;  3X1T B;  3MGP D;  3MGS A;  3LEL D;  4YM6 B;  3W97 B;  2J8P A;  5KDM A;  4X23 A;  3KWQ C;  1KX3 D;  2Y2J A;  4H9Q A;  4H9S A;  3A6N B;  5CP6 C;  4Z66 C;  1P3G B;  2RVQ D;  1M18 A;  5BO0 A;  3AZL A;  4WU9 B;  2NQB C;  3MNN B;  3X1T D;  4X23 C;  2Y2I A;  4YM6 D;  4ZBJ C;  4WU8 A;  5B1L B;  4H9S C;  5DNM B;  4YS3 B;  1P3P A;  2YFW A;  3AZN B;  2F8N K;  3LJA B;  3KFU G;  1M18 C;  3WA9 D;  2BYM A;  4J8U A;  3A6N D;  3AZL C;  1M1A B;  1AOI D;  1P34 A;  5B2I C;  1BH8 A;  1P3G D;  1N1J B;  3TU4 B;  4WU8 C;  3AL0 C;  5AV6 A;  4J8V A;  1P3P C;  5B40 D;  5B1L D;  5DNM D;  4J8U C;  3UTB B;  1P34 C;  3WAA B;  1M1A D;  2RIQ A;  1WWI A;  4J8V C;  4QLC B;  3W96 A;  5GT3 A;  3AZF D;  3C1B A;  3IP4 C;  5B32 A;  3TU4 C;  4DQY B;  5AY8 A;  3UTB D;  1P3O A;  3AFA A;  3AYW B;  2Y2M A;  3VH6 W;  5CPJ A;  3AZM A;  5CPI D;  3WAA D;  5FUG A;  3AZG B;  5GXQ A;  1JFI A;  3C1B C;  3NQU B;  5B32 C;  5JRG B;  2FFF B;  5AY8 C;  3UT9 A;  4WJ3 C;  3AZM C;  5B1M D;  4WV4 B;  3VH5 W;  1P3I B;  3O62 C;  1F66 A;  4DRA A;  5GXQ C;  4LD9 A;  3AYW D;  3B6F A;  2Y2K A;  3B0C W;  4G91 B;  4J8W A;  3AZG D;  3MGQ B;  3AV2 A;  3WKJ A;  5B0Y D;  5F99 B;  1H3O A;  1KX4 D;  3UT9 C;  5AVB C;  1HQ3 A;  3MGR C;  3H0R C;  3REL B;  3AZJ C;  1ZLA D;  1F66 C;  4J8X D;  3H0M C;  4EO5 B;  4LD9 C;  3AZI B;  4NFT A;  4J8W C;  4R8P A;  2ZM5 A;  5BS7 A;  3EPK A;  5B33 C;  1P3F A;  5CPK D;  3WTP B;  5BT1 C;  3REJ D;  1HQ3 C;  3C1C A;  1EQZ D;  4KUD B;  2Y2H A;  3MGQ D;  4H9R B;  5F99 D;  2ARO A;  3VH6 A;  3REL D;  3UTA A;  4KGC D;  4R8P C;  4UUZ B;  5BS7 C;  3X1S A;  3AZI D;  1U35 A;  5G49 A;  5B31 A;  3H0L C;  1P3F C;  1P3A A;  3C1C C;  3LZ1 B;  5B0Z D;  1KX5 D;  2ARO C;  1S32 B;  3VH5 A;  3B6G D;  3X1S C;  3MVD A;  5B31 C;  2ZY3 A;  3B0D C;  2PYO C;  1P3A C;  3REK B;  1M19 B;  5DNN A;  2Y2P A;  3X1U A;  3W98 D;  2HIO A;  3AZK B;  5GSU A;  1S32 D;  1P3K A;  4E45 A;  3KXB A;  4NE3 A;  3AN2 A;  1TAF A;  3NQJ A;  5DNN C;  3KUY A;  3REI A;  1ID3 D;  3X1U C;  3KWQ B;  3REK D;  2CV5 D;  4XUJ D;  3REH A;  5GSU C;  5CP6 B;  4Z66 B;  1P3K C;  3AZH D;  3KXB C;  4XZQ C;  3AN2 C;  3KSY A;  5E5A A;  3KUY C;  2NQB B;  3REI C;  5KDM B;  4X23 B;  1BH9 A;  1P3L D;  4ZBJ B;  2BYK A;  4H9Q B;  3AZK C;  4NE6 A;  3KWQ D;  4KHA B;  1M18 B;  3AZL B;  5E5A C;  4H9P A;  5B2I B;  1P3B D;  3W99 D;  1P3M D;  3F6T A;  4WU8 B;  2NZD A;  5JA4 A;  5AVC A;  2NQB D;  1P3P B;  2YFW B;  4X23 D;  3MGS C;  1A7W A;  2BYM B;  4J8U B;  5GT0 A;  3X1V A;  1P34 B;  1BH8 B;  5AV8 A;  1M18 D;  2FJ7 A;  3W97 D;  3LEL A;  3AZL D;  2NZD C;  5AVC C;  1W2E A;  5B2I D;  4J8V B;  3EG5 B;  1KX3 A;  5GT0 C;  5AV8 C;  1TZY A;  5B24 A;  4J8U D;  4WU9 D;  2FJ7 C;  3LEL C;  3MNN D;  5CPI B;  3X1T A;  1KX3 C;  3EPH A;  4YS3 D;  4YM6 A;  3C1B B;  3AZN D;  3LJA D;  1TZY C;  2Y2N A;  4DRB A;  5B32 B;  3AZE A;  5AY8 B;  5B24 C;  2RVQ C;  5AV6 C;  1P3O B;  3WA9 A;  1AOI A;  3AZM B;  3TU4 D;  5FUG B;  1P3G A;  3O62 B;  2IO5 C;  5GXQ B;  3AZE C;  5B32 G;  3V9R A;  3UT9 B;  5B40 A;  3WA9 C;  5AVB B;  3C1B D;  1AOI C;  5B32 D;  3MGR B;  3W96 C;  5AV9 A;  3AZJ B;  5AY8 D;  1F66 B;  2G5H C;  5GT3 C;  4LD9 B;  3B6F B;  4QLC D;  4J8W B;  3WKJ B;  3AV1 A;  3O62 D;  5B33 B;  4ZUX A;  1H3O B;  1P3O C;  3AFA C;  3AZF A;  5CPJ C;  1HQ3 B;  5AV9 C;  3UT9 D;  4HGA C;  5AVB D;  3MGR D;  3UTB A;  3AZJ D;  5CPI A;  4R8P B;  3AV1 C;  1F66 D;  3WAA A;  4ZUX C;  1P3F B;  4LD9 D;  4AWL C;  3AZF C;  5JRG D;  3C1C B;  5B33 D;  1HTA A;  2ARO B;  3B6F C;  5CPI C;  3AV2 C;  1P3I D;  3WKJ C;  5B1M A;  4Z5T A;  3X1S B;  5G49 B;  5B31 B;  3B0D B;  2PYO B;  1P3A B;  3AYW A;  2Y2G A;  1BFM A;  5B0Y A;  1KX4 A;  5B1M C;  4Z5T C;  1ZLA A;  4J8X A;  3EPL A;  3A1I A;  5BNV B;  5DNN B;  3X1S D;  5B0Y C;  3WTP D;  2PYO D;  4KUD D;  5CPK A;  3X1U B;  3UTA C;  5C3I C;  3REJ A;  1EQZ A;  1ZLA C;  2DQN C;  5AV5 A;  5GSU B;  4J8X C;  1U35 C;  1P3K B;  4CAY A;  1R4V A;  3KXB B;  4XZQ B;  3AN2 B;  3REL A;  1TAF B;  4KGC A;  1WWS A;  3NQJ B;  3KUY B;  3REI B;  4WNN A;  3AZI A;  3LZ1 D;  5CPK C;  2ZY4 A;  3VH6 T;  1EQZ C;  5AV5 C;  5B0Z A;  3MVD C;  1KX5 A;  5B2J A;  3LZ0 A;  2XD1 A;  4JJN A;  4KGC C;  2LY8 A;  5E5A B;  5BNX B;  3B6G A;  4H9N A;  4XZQ D;  1BH9 B;  2HIO C;  1M19 D;  2BYK B;  3VH5 T;  5B0Z C;  1KX5 C;  4UPK A;  1KU5 A;  4Z2M H;  5B2J C;  3WTP E;  3LZ0 C;  3MGS B;  4M6B A;  3AZK D;  3B0C T;  4JJN C;  3W98 A;  4H9P B;  3B6G C;  1S32 A;  3REH C;  2NZD B;  5E5A D;  5JA4 B;  2CWE A;  5AVC B;  4H9O A;  1ID3 A;  2CV5 A;  3W98 C;  4XUJ A;  5BO0 B;  5GT0 B;  5CP6 D;  4Z66 D;  2HUE C;  5AV8 B;  5CHL B;  3MGS D;  3AZH A;  2F8N A;  2FJ7 B;  3LEL B;  1F1E A;  1ID3 C;  3R45 A;  1KX3 B;  4G92 B;  2CV5 C;  4XUJ C;  5AVC D;  1P3L A;  1TZY B;  3MGP A;  3AZH C;  4CSR A;  5B24 B;  1Q9C A;  5AV6 B;  2YFV A;  2F2A C;  2IO5 B;  2FJ7 D;  4WU8 D;  1P3L C;  1T3U A;  1P3B A;  3X1V C;  1P3M A;  1P3P D;  3W99 A;  2NQB A;  3AZE B;  3MGP C;  3WA9 B;  1P34 D;  1AOI B;  1TZY D;  3W96 B;  5B24 D;  4KHA A;  4G92 C;  5GT3 B;  5AV6 D;  3W99 C;  2Y2O A;  4J8V D;  4NE5 A;  3W97 A;  1P3B C;  1P3M C;  5B2I A;  3V9R B;  5B40 B;  3AFA B;  1ULY A;  3A6N A;  5CPJ B;  3AZE D;  5AV9 B;  3X1T C;  2F8N H;  4HGA B;  4YM6 C;  1JFI B;  4WU9 A;  3W97 C;  3MNN A;  3W96 D;  3AV1 B;  4ZUX B;  5GT3 D;  5B1L A;  5DNM A;  2ZY2 A;  3A6N C;  4AWL B;  3AZF B;  4YS3 A;  3A1K A;  3AZN A;  1P3G C;  3LJA A;  1P3O D;  3AFA D;  4WU9 C;  5CPJ D;  3AZM D;  1M1A A;  3MNN C;  5AV9 D;  3AV2 B; 
#chains in the Genus database with same CATH homology
 1N1J A;  3TU4 A;  5GXQ D;  5B40 C;  5B1L C;  5DNM C;  4WZS B;  4YS3 C;  3AV1 D;  3AZN C;  3LJA C;  4ZUX D;  2JSS A;  1M1A C;  2VQR A;  5B1M B;  4Z5T B;  2UWX A;  3B6F D;  4J8W D;  2W8S A;  3AV2 D;  3WKJ D;  4QLC A;  3O62 A;  5B0Y B;  1KX4 B;  5BT1 D;  2G5I C;  1HQ3 D;  3UTB C;  3UTA B;  5C3I B;  3WAA C;  2ZY5 A;  1ZLA B;  4J8X B;  1U35 B;  5AVB A;  4R8P D;  3MGR A;  4QLC C;  3AZJ A;  4Z5T D;  3AZG A;  1P3F D;  3FDD A;  3C1C D;  5CPK B;  3NQU A;  3REJ B;  4Z2M G;  5JRG A;  1EQZ B;  2ARO D;  5B33 A;  5AV5 B;  3MVD B;  5B31 G;  3UTA D;  4CAY B;  3AYW C;  3AZG C;  1P3I A;  4KGC B;  1U35 D;  5B31 D;  1KX4 C;  1P3A D;  4WNN B;  2HIO B;  5JRG C;  3MGQ A;  2L5A A;  5F99 A;  5B0Z B;  1KX5 B;  5B2J B;  3LZ0 B;  4JJN B;  1P3I C;  5AV5 D;  3MVD D;  2JE5 A;  3B6G B;  4H9N B;  3REJ C;  4G91 C;  5DNN D;  3MGQ C;  3REH B;  5F99 C;  3X1U D;  3WTP A;  2HIO D;  2PYO A;  4KUD A;  3REL C;  4E44 A;  2XD5 A;  4H9R A;  5GSU D;  3W98 B;  4EO5 C;  1P3K D;  2HUE B;  3P5J B;  5B2J D;  3KXB D;  3LZ0 D;  3AZI C;  3AN2 D;  4JJN D;  4UUZ A;  3KUY D;  3REI D;  3WTP C;  4H9O B;  2JCH A;  1ID3 B;  4KUD C;  1PZR A;  3LZ1 A;  3REH D;  2CV5 B;  4XUJ B;  5BNV A;  2Y2L A;  3AZH B;  2F8N B;  2Y2Q A;  1B6W A;  3REK A;  3LZ1 C;  3R45 B;  4XZQ A;  1P3L B;  3X1V B;  1M19 A;  1S32 C;  3MGP B;  4CSR B;  2F8N G;  1B67 A;  2YFV B;  3EPJ A;  3AZK A;  3B0B A;  1Z2C B;  2F8N D;  3REK C;  2NZD D;  1P3B B;  3W99 B;  1P3M B;  1M19 C;  5BNX A;  3KWQ A;  2DF4 C;  5GT0 D;  3X1V D;  2BG1 A;  5AV8 D;  5CP6 A;  4Z66 A;  3X1T B;  3MGP D;  3MGS A;  3LEL D;  4YM6 B;  3W97 B;  2J8P A;  5KDM A;  4X23 A;  3KWQ C;  1KX3 D;  2Y2J A;  4H9Q A;  4H9S A;  3A6N B;  5CP6 C;  4Z66 C;  1P3G B;  2RVQ D;  1M18 A;  5BO0 A;  3AZL A;  4WU9 B;  2NQB C;  3MNN B;  3X1T D;  4X23 C;  2Y2I A;  4YM6 D;  4ZBJ C;  4WU8 A;  5B1L B;  4H9S C;  5DNM B;  4YS3 B;  1P3P A;  2YFW A;  3AZN B;  2F8N K;  3LJA B;  3KFU G;  1M18 C;  3WA9 D;  2BYM A;  4J8U A;  3A6N D;  3AZL C;  1M1A B;  1AOI D;  1P34 A;  5B2I C;  1BH8 A;  1P3G D;  1N1J B;  3TU4 B;  4WU8 C;  3AL0 C;  5AV6 A;  4J8V A;  1P3P C;  5B40 D;  5B1L D;  5DNM D;  4J8U C;  3UTB B;  1P34 C;  3WAA B;  1M1A D;  2RIQ A;  1WWI A;  4J8V C;  4QLC B;  3W96 A;  5GT3 A;  3AZF D;  3C1B A;  3IP4 C;  5B32 A;  3TU4 C;  4DQY B;  5AY8 A;  3UTB D;  1P3O A;  3AFA A;  3AYW B;  2Y2M A;  3VH6 W;  5CPJ A;  3AZM A;  5CPI D;  3WAA D;  5FUG A;  3AZG B;  5GXQ A;  1JFI A;  3C1B C;  3NQU B;  5B32 C;  5JRG B;  2FFF B;  5AY8 C;  3UT9 A;  4WJ3 C;  3AZM C;  5B1M D;  4WV4 B;  3VH5 W;  1P3I B;  3O62 C;  1F66 A;  4DRA A;  5GXQ C;  4LD9 A;  3AYW D;  3B6F A;  2Y2K A;  3B0C W;  4G91 B;  4J8W A;  3AZG D;  3MGQ B;  3AV2 A;  3WKJ A;  5B0Y D;  5F99 B;  1H3O A;  1KX4 D;  3UT9 C;  5AVB C;  1HQ3 A;  3MGR C;  3H0R C;  3REL B;  3AZJ C;  1ZLA D;  1F66 C;  4J8X D;  3H0M C;  4EO5 B;  4LD9 C;  3AZI B;  4NFT A;  4J8W C;  4R8P A;  2ZM5 A;  5BS7 A;  3EPK A;  5B33 C;  1P3F A;  5CPK D;  3WTP B;  5BT1 C;  3REJ D;  1HQ3 C;  3C1C A;  1EQZ D;  4KUD B;  2Y2H A;  3MGQ D;  4H9R B;  5F99 D;  2ARO A;  3VH6 A;  3REL D;  3UTA A;  4KGC D;  4R8P C;  4UUZ B;  5BS7 C;  3X1S A;  3AZI D;  1U35 A;  5G49 A;  5B31 A;  3H0L C;  1P3F C;  1P3A A;  3C1C C;  3LZ1 B;  5B0Z D;  1KX5 D;  2ARO C;  1S32 B;  3VH5 A;  3B6G D;  3X1S C;  3MVD A;  5B31 C;  2ZY3 A;  3B0D C;  2PYO C;  1P3A C;  3REK B;  1M19 B;  5DNN A;  2Y2P A;  3X1U A;  3W98 D;  2HIO A;  3AZK B;  5GSU A;  1S32 D;  1P3K A;  4E45 A;  3KXB A;  4NE3 A;  3AN2 A;  1TAF A;  3NQJ A;  5DNN C;  3KUY A;  3REI A;  1ID3 D;  3X1U C;  3KWQ B;  3REK D;  2CV5 D;  4XUJ D;  3REH A;  5GSU C;  5CP6 B;  4Z66 B;  1P3K C;  3AZH D;  3KXB C;  4XZQ C;  3AN2 C;  3KSY A;  5E5A A;  3KUY C;  2NQB B;  3REI C;  5KDM B;  4X23 B;  1BH9 A;  1P3L D;  4ZBJ B;  2BYK A;  4H9Q B;  3AZK C;  4NE6 A;  3KWQ D;  4KHA B;  1M18 B;  3AZL B;  5E5A C;  4H9P A;  5B2I B;  1P3B D;  3W99 D;  1P3M D;  3F6T A;  4WU8 B;  2NZD A;  5JA4 A;  5AVC A;  2NQB D;  1P3P B;  2YFW B;  4X23 D;  3MGS C;  1A7W A;  2BYM B;  4J8U B;  5GT0 A;  3X1V A;  1P34 B;  1BH8 B;  5AV8 A;  1M18 D;  2FJ7 A;  3W97 D;  3LEL A;  3AZL D;  2NZD C;  5AVC C;  1W2E A;  5B2I D;  4J8V B;  3EG5 B;  1KX3 A;  5GT0 C;  5AV8 C;  1TZY A;  5B24 A;  4J8U D;  4WU9 D;  2FJ7 C;  3LEL C;  3MNN D;  5CPI B;  3X1T A;  1KX3 C;  3EPH A;  4YS3 D;  4YM6 A;  3C1B B;  3AZN D;  3LJA D;  1TZY C;  2Y2N A;  4DRB A;  5B32 B;  3AZE A;  5AY8 B;  5B24 C;  2RVQ C;  5AV6 C;  1P3O B;  3WA9 A;  1AOI A;  3AZM B;  3TU4 D;  5FUG B;  1P3G A;  3O62 B;  2IO5 C;  5GXQ B;  3AZE C;  5B32 G;  3V9R A;  3UT9 B;  5B40 A;  3WA9 C;  5AVB B;  3C1B D;  1AOI C;  5B32 D;  3MGR B;  3W96 C;  5AV9 A;  3AZJ B;  5AY8 D;  1F66 B;  2G5H C;  5GT3 C;  4LD9 B;  3B6F B;  4QLC D;  4J8W B;  3WKJ B;  3AV1 A;  3O62 D;  5B33 B;  4ZUX A;  1H3O B;  1P3O C;  3AFA C;  3AZF A;  5CPJ C;  1HQ3 B;  5AV9 C;  3UT9 D;  4HGA C;  5AVB D;  3MGR D;  3UTB A;  3AZJ D;  5CPI A;  4R8P B;  3AV1 C;  1F66 D;  3WAA A;  4ZUX C;  1P3F B;  4LD9 D;  4AWL C;  3AZF C;  5JRG D;  3C1C B;  5B33 D;  1HTA A;  2ARO B;  3B6F C;  5CPI C;  3AV2 C;  1P3I D;  3WKJ C;  5B1M A;  4Z5T A;  3X1S B;  5G49 B;  5B31 B;  3B0D B;  2PYO B;  1P3A B;  3AYW A;  2Y2G A;  1BFM A;  5B0Y A;  1KX4 A;  5B1M C;  4Z5T C;  1ZLA A;  4J8X A;  3EPL A;  3A1I A;  5BNV B;  5DNN B;  3X1S D;  5B0Y C;  3WTP D;  2PYO D;  4KUD D;  5CPK A;  3X1U B;  3UTA C;  5C3I C;  3REJ A;  1EQZ A;  1ZLA C;  2DQN C;  5AV5 A;  5GSU B;  4J8X C;  1U35 C;  1P3K B;  4CAY A;  1R4V A;  3KXB B;  4XZQ B;  3AN2 B;  3REL A;  1TAF B;  4KGC A;  1WWS A;  3NQJ B;  3KUY B;  3REI B;  4WNN A;  3AZI A;  3LZ1 D;  5CPK C;  2ZY4 A;  3VH6 T;  1EQZ C;  5AV5 C;  5B0Z A;  3MVD C;  1KX5 A;  5B2J A;  3LZ0 A;  2XD1 A;  4JJN A;  4KGC C;  2LY8 A;  5E5A B;  5BNX B;  3B6G A;  4H9N A;  4XZQ D;  1BH9 B;  2HIO C;  1M19 D;  2BYK B;  3VH5 T;  5B0Z C;  1KX5 C;  4UPK A;  1KU5 A;  4Z2M H;  5B2J C;  3WTP E;  3LZ0 C;  3MGS B;  4M6B A;  3AZK D;  3B0C T;  4JJN C;  3W98 A;  4H9P B;  3B6G C;  1S32 A;  3REH C;  2NZD B;  5E5A D;  5JA4 B;  2CWE A;  5AVC B;  4H9O A;  1ID3 A;  2CV5 A;  3W98 C;  4XUJ A;  5BO0 B;  5GT0 B;  5CP6 D;  4Z66 D;  2HUE C;  5AV8 B;  5CHL B;  3MGS D;  3AZH A;  2F8N A;  2FJ7 B;  3LEL B;  1F1E A;  1ID3 C;  3R45 A;  1KX3 B;  4G92 B;  2CV5 C;  4XUJ C;  5AVC D;  1P3L A;  1TZY B;  3MGP A;  3AZH C;  4CSR A;  5B24 B;  1Q9C A;  5AV6 B;  2YFV A;  2F2A C;  2IO5 B;  2FJ7 D;  4WU8 D;  1P3L C;  1T3U A;  1P3B A;  3X1V C;  1P3M A;  1P3P D;  3W99 A;  2NQB A;  3AZE B;  3MGP C;  3WA9 B;  1P34 D;  1AOI B;  1TZY D;  3W96 B;  5B24 D;  4KHA A;  4G92 C;  5GT3 B;  5AV6 D;  3W99 C;  2Y2O A;  4J8V D;  4NE5 A;  3W97 A;  1P3B C;  1P3M C;  5B2I A;  3V9R B;  5B40 B;  3AFA B;  1ULY A;  3A6N A;  5CPJ B;  3AZE D;  5AV9 B;  3X1T C;  2F8N H;  4HGA B;  4YM6 C;  1JFI B;  4WU9 A;  3W97 C;  3MNN A;  3W96 D;  3AV1 B;  4ZUX B;  5GT3 D;  5B1L A;  5DNM A;  2ZY2 A;  3A6N C;  4AWL B;  3AZF B;  4YS3 A;  3A1K A;  3AZN A;  1P3G C;  3LJA A;  1P3O D;  3AFA D;  4WU9 C;  5CPJ D;  3AZM D;  1M1A A;  3MNN C;  5AV9 D;  3AV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...