3KXBD

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
YVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
molecule keywords Histone H3.2
total genus 33
structure length 86
sequence length 86
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbD00
1ID3C 5AV5A 3MNND 1F66C 3AZHB 2PYOB 4LD9B 3REHC 3W98B 3MGSB 3AV2D 5BT1C 3AZJA 4UUZA 4XZQB 5GXQC 4Z2MG 5GSUB 5B31B 3KWQC 3WKJB 3NQJB 5CPIC 3AZEB 1EQZC 2PYOD 1TAFB 4ZBJC 2YFWB 5FUGA 3AFAB 5CPIA 3LZ0D 3V9RA 1TZYB 3B6GD 1ID3B 5GT3A 1F66B 4Z5TB 2YFVA 3REKC 5BNVA 4JJNA 4WNNA 1P34B 3RELB 5B33D 3MGPC 1P3IC 2IO5C 4CSRA 3AZHD 4LD9D 5DNNA 3W96D 5CPJB 3LZ1C 4HGAB 3WA9D 4YS3A 2L5AA 4XUJA 3LZ0A 4WU8D 2BYMA 4YS3C 3O62C 4Z5TC 4KUDD 2HIOD 1P3GC 3REID 4H9NA 5AVCC 1M18B 1M1AA 2FJ7D 3W97A 2NQBD 5B0YB 3B6FC 3X1UB 4ZUXC 4QLCD 1HTAA 3TU4A 3AZLD 3REKA 5CP6C 5B2IB 3WAAA 2BYKA 4J8WC 5B24D 2NQBB 5CPKD 3AZNC 1Q9CA 3VH6T 3LELC 4J8VD 1S32C 3KUYA 1P3KA 1BH8B 5BO0B 1M1AD 3MGRB 1U35D 1AOIA 4ZBJB 3AZJD 3AV1A 1P3AA 4YM6B 3A6ND 2NZDB 3AZGC 3X1TC 2F8NH 1WWSA 1P3BD 3WAAD 2HUEB 5AY8A 3B0DB 2LY8A 3AZGD 3RELC 3C1BC 1P3LB 5E5AD 3LJAA 5DNMB 4J8XA 4JJND 4WU9A 2NZDC 4XZQA 5GXQA 5JA4B 1KX3C 4NFTA 3KWQA 3AZKA 3C1BD 1KU5A 3O62B 1N1JB 4Z66C 1H3OA 4WU8B 3KXBC 2HUEC 3AZMA 2CV5D 5AV5C 1KX3A 3UTAA 3AZGA 1KX4B 1ZLAD 4QLCC 3VH6A 3W98D 3C1CC 3REJA 3W99C 3C1CD 3AYWA 3REIC 2FJ7C 5B0ZC 1KX5B 1ZLAC 3W99A 3UTAC 3LZ1A 3AZKD 4H9SC 1B67A 4WU8C 3LELD 1P3MA 4QLCA 3X1SB 1S32B 4Z66D 5C3IB 5B2JD 4G91B 5B32C 3WA9C 5JRGB 3AFAD 1M19C 3C1CB 3AZKC 3UTAD 3MVDD 5B32A 4JJNC 5B33C 3WKJD 3B6FD 5B1MC 3REHB 3W98C 3REKD 4DRBA 3AZID 1ULYA 5B24B 1U35A 4YS3D 3X1VB 3X1TD 4G92C 1BH9B 1HQ3B 4H9PA 1EQZD 3WA9B 4R8PC 5AV8A 3KWQD 3KUYB 3W97C 2HIOB 5B33B 5AVCA 1P3FA 1M1AC 5BO0A 3B6FA 4H9QB 4CAYB 5B0YD 3AV2C 3A6NA 5CPKC 3MGPB 1P3IB 2IO5B 4H9OB 3MNNC 5GT0D 5AV5B 4X23C 5CPKA 3WAAC 2AROA 5CP6D 2PYOC 2F8NK 3A6NC 3B0CW 5AV6D 3UTBD 1P3GB 5BNXA 1P3AD 4Z5TD 4XZQD 5GXQD 3O62D 1AOIC 4Z2MH 3WTPB 4J8VC 1S32D 3MGQB 3MGSA 3AN2B 2F8NG 5GSUC 5B31C 3KWQB 3MNNB 3LZ1D 2F8NB 5B40D 3LELA 1N1JA 3W96C 2CV5A 3AZMB 4KHAA 5F99D 3MGPD 3RELA 1P3ID 4J8XD 3WTPD 1TZYC 1P34C 4KGCC 5DNNB 2RVQC 2NQBC 5CPJA 1R4VA 3X1SD 4J8UD 3AYWB 4KUDC 1ID3A 5GT3C 1F66A 5CPJC 3LZ0B 3MGSD 3W96B 4H9SA 1P34A 3VH5T 1P3FD 1P3BA 3B0DC 5B0YA 4KGCB 1EQZA 3C1CA 3AYWD 3AYWC 4KUDB 4YS3B 5BS7A 1A7WA 5DNNC 5AV8D 4X23B 3C1BB 3AZIA 1P3LC 3REHA 3KXBA 4AWLB 3B6GA 1P3OA 5GT3D 5B2JB 5BS7C 3AZFB 1M18D 3R45A 5JRGD 5AVBB 1P3PD 5B1LA 1AOIB 1P3PC 1JFIA 3WTPC 1P3AB 3AZHA 4LD9A 3W98A 5B1MA 4NE5A 5KDMA 5B40C 3AV2A 3AZJB 4J8WA 5GT0C 3WTPE 3MGPA 5F99A 1P3IA 4H9OA 3REIB 2FJ7B 1P3MD 3NQJA 5AVBC 5CP6A 3X1UD 1BFMA 4J8XB 4ZUXA 1P3AC 4YM6A 5B40A 3W97D 2PYOA 3AFAA 3MVDA 3V9RB 5JRGC 5CHLB 4XUJC 4UUZB 2YFVB 1P3KC 5GSUA 5B1LC 5B31A 3AZNA 5GT0B 1HQ3D 4CSRB 1P3LD 3X1VC 4WU9B 1TAFA 5FUGB 3AV1C 4KGCD 5DNND 5AV8C 5B31G 1TZYA 4YM6D 5F99C 4XUJB 3W99B 4WNNB 4J8UA 4AWLC 4QLCB 5G49A 4WV4B 3NQUB 5B2JC 5GSUD 5B31D 3KUYC 3W97B 3MGRD 3MGSC 4G91C 5B32B 3TU4B 5B0ZD 4J8UC 3X1SC 4E45A 2AROD 5B1MD 3LJAD 3UTBC 5AV6C 1TZYD 2BYKB 3X1SA 1EQZB 3UT9D 2NQBA 5B2ID 3UTBA 1M19D 3TU4D 1KX4D 4H9PB 3AZIB 3MGRA 4J8VB 1KX3D 1ZLAA 1AOID 5B0ZA 3B6GB 5B32G 1KX5D 5B33A 1P3FB 1P3PA 1U35B 1P3KB 5B1LB 3RELD 3AZED 4HGAC 3AZMC 1M19A 1WWIA 4EO5B 3KXBD 4X23D 3AZIC 5GXQB 3AZEC 5CPIB 4WU9D 5AV9C 2CWEA 3AZKB 3WKJC 5B0YC 3B6FB 1U35C 5GT3B 4H9QA 4CAYA 5AY8B 4M6BA 3AZFD 5BNVB 3A6NB 4JJNB 2NZDD 3WKJA 5E5AC 4R8PD 4DRAA 3AFAC 3AZEA 5DNMA 5B24C 4J8WD 3TU4C 3LELB 4EO5C 5AV9B 2JSSA 3REJD 3X1TA 3VH6W 3AZLC 1P3GA 5BNXB 4ZUXD 3LZ1B 3MGQC 3AN2C 4R8PB 3W99D 5AVCD 2HIOC 4H9NB 3MGQA 3AZGB 3AN2A 1M18A 1M1AB 5JRGA 5AV5D 3MNNA 3MVDC 5E5AB 3REJB 2F8NA 4E44A 3AZND 5B32D 5B2IA 5G49B 1KX5A 3WAAB 1B6WA 4Z66A 2BYMB 4KGCA 5B2IC 4H9RB 3AZLB 3B0CT 5AV6A 1BH8A 3LJAC 3X1UA 2AROC 5AV9D 3MGQD 3AN2D 3C1BA 3VH5W 3UT9A 2CV5C 3REJC 3KXBB 1P3BB 3MGRC 3AZMD 3AZFA 1P3LA 5B0ZB 1KX5C 3WA9A 3B0BA 3AZFC 3LJAB 5AVBD 1P3PB 2AROB 3X1VD 4WU9C 2NZDA 1ID3D 1F66D 5B2JA 3REIA 2FJ7A 3LZ0C 1P3BC 1M19B 5CP6B 3UT9C 4ZUXB 5B40B 1F1EA 3AZJC 1KX3B 5B1MB 3MVDB 1P3GD 5KDMB 2YFWA 4J8WB 5BT1D 5JA4A 1P3MC 3AZNB 3KUYD 3REHD 4Z5TA 3O62A 1KX4C 1H3OB 4WU8A 2F8ND 1S32A 3WTPA 3UTAB 3AZHC 5AV9A 3X1TB 1KX4A 4LD9C 4NE3A 3KSYA 4YM6C 1P3OC 2CV5B 4R8PA 1P3FC 4KHAB 5GT0A 3B6GC 5DNMC 1P3MB 5CPJD 5E5AA 5B24A 5CPID 3VH5A 1BH9A 4X23A 1P34D 3W96A 3REKB 4Z66B 4J8XC 4J8UB 4H9RA 4G92B 3AZLA 3NQUA 3UTBB 5AV6B 3AV1D 1P3OB 4NE6A 1HQ3C 5AY8C 3UT9B 4KUDA 5AVBA 3X1VA 5B1LD 5DNMD 1P3KD 1ZLAB 1HQ3A 4XZQC 4XUJD 4WZSB 5CPKB 2RVQD 3AV1B 1P3OD 5AV8B 3AV2B 2HIOA 5AVCB 1M18C 5F99B 5C3IC 3X1UC 3R45B 4J8VA 1JFIB 5AY8D
chains in the Genus database with same CATH superfamily
1ID3C 5AV5A 3MNND 1F66C 3AZHB 2PYOB 4LD9B 3REHC 3W98B 3MGSB 3AV2D 5BT1C 3AZJA 4UUZA 4XZQB 5GXQC 4Z2MG 5GSUB 5B31B 3KWQC 3WKJB 3NQJB 5CPIC 3AZEB 3H0MC 1EQZC 2PYOD 1TAFB 4ZBJC 2YFWB 5FUGA 3AFAB 5CPIA 3LZ0D 3V9RA 1TZYB 3B6GD 1ID3B 5GT3A 1F66B 4Z5TB 2YFVA 3REKC 5BNVA 4JJNA 4WNNA 1P34B 3RELB 5B33D 3MGPC 1P3IC 2IO5C 4CSRA 3AZHD 4LD9D 3A1KA 5DNNA 3W96D 5CPJB 4UPKA 3LZ1C 4HGAB 3WA9D 4YS3A 2L5AA 4XUJA 3LZ0A 4WU8D 2BYMA 4YS3C 3O62C 4Z5TC 4KUDD 2HIOD 1P3GC 3REID 4H9NA 5AVCC 1M18B 1M1AA 2FJ7D 3W97A 2NQBD 1W2EA 5B0YB 3B6FC 3X1UB 4ZUXC 4QLCD 1HTAA 3TU4A 3AZLD 3REKA 5CP6C 5B2IB 3WAAA 2BYKA 4J8WC 5B24D 2NQBB 5CPKD 3AZNC 1Q9CA 3VH6T 3LELC 4J8VD 1S32C 3KUYA 1P3KA 1BH8B 5BO0B 1M1AD 3MGRB 1U35D 1AOIA 4ZBJB 3AZJD 3AV1A 1P3AA 4YM6B 3A6ND 2NZDB 3AZGC 3X1TC 2F8NH 1WWSA 1P3BD 3WAAD 2HUEB 5AY8A 3B0DB 2LY8A 3AZGD 3RELC 3C1BC 1P3LB 2ZY5A 5E5AD 3LJAA 5DNMB 4J8XA 4JJND 4WU9A 2NZDC 4XZQA 5GXQA 5JA4B 1KX3C 4NFTA 3KWQA 3AZKA 3C1BD 1KU5A 3O62B 1N1JB 4Z66C 1H3OA 4WU8B 3KXBC 2HUEC 3AZMA 2CV5D 5AV5C 2W8SA 3UTAA 3AZGA 1KX3A 1KX4B 1ZLAD 4QLCC 3VH6A 3W98D 2G5HC 3C1CC 3REJA 2JCHA 3W99C 3C1CD 3AYWA 3REIC 2FJ7C 2XD1A 5B0ZC 1KX5B 3F6TA 1ZLAC 3W99A 3UTAC 3LZ1A 3AZKD 4H9SC 1B67A 4WU8C 3LELD 1P3MA 4QLCA 3X1SB 1S32B 4Z66D 5C3IB 5B2JD 2ZM5A 2F2AC 4G91B 5B32C 3WA9C 5JRGB 3AFAD 1M19C 3C1CB 3AZKC 3UTAD 3MVDD 5B32A 4JJNC 5B33C 2ZY3A 3WKJD 3B6FD 5B1MC 3REHB 3W98C 3REKD 4DRBA 3AZID 1ULYA 5B24B 1U35A 4YS3D 2XD5A 3X1VB 3X1TD 4G92C 1BH9B 1HQ3B 4H9PA 1EQZD 3WA9B 4R8PC 5AV8A 3KWQD 3KUYB 3W97C 2HIOB 5B33B 5AVCA 1P3FA 1M1AC 5BO0A 3B6FA 4H9QB 4CAYB 5B0YD 3AV2C 3A6NA 5CPKC 3MGPB 1P3IB 2IO5B 4H9OB 3MNNC 5GT0D 5AV5B 4X23C 5CPKA 3WAAC 2AROA 2ZY2A 5CP6D 2PYOC 2F8NK 3A6NC 3B0CW 5AV6D 3UTBD 1P3GB 5BNXA 1P3AD 4Z5TD 4XZQD 5GXQD 3O62D 3A1IA 1AOIC 4Z2MH 3WTPB 4J8VC 1S32D 3MGQB 3MGSA 3AN2B 2F8NG 5GSUC 5B31C 3KWQB 3MNNB 3LZ1D 2F8NB 5B40D 3LELA 1N1JA 3W96C 2CV5A 3AZMB 4KHAA 5F99D 3MGPD 3RELA 1P3ID 4J8XD 3WTPD 1TZYC 3EG5B 1P34C 4KGCC 5DNNB 2RVQC 2NQBC 5CPJA 1R4VA 3X1SD 4J8UD 3AYWB 4KUDC 1ID3A 5GT3C 1F66A 5CPJC 3LZ0B 3MGSD 3W96B 4H9SA 1P34A 3VH5T 1P3FD 1P3BA 3B0DC 5B0YA 4KGCB 1EQZA 3C1CA 3AYWD 3AYWC 4KUDB 4YS3B 5BS7A 1A7WA 5DNNC 5AV8D 4X23B 3C1BB 3AZIA 1P3LC 3REHA 2BG1A 3KXBA 4AWLB 3B6GA 1P3OA 5GT3D 5B2JB 5BS7C 3AZFB 2RIQA 1M18D 3R45A 5JRGD 5AVBB 1P3PD 5B1LA 1AOIB 1P3PC 1JFIA 3WTPC 1P3AB 3AL0C 3AZHA 4LD9A 3W98A 3IP4C 5B1MA 2Y2OA 4NE5A 5KDMA 5B40C 3AV2A 3AZJB 4J8WA 5GT0C 3WTPE 3MGPA 5F99A 1P3IA 4H9OA 3REIB 2FJ7B 1P3MD 3NQJA 5AVBC 5CP6A 3X1UD 1BFMA 4J8XB 4ZUXA 1P3AC 4YM6A 5B40A 3W97D 2PYOA 3AFAA 3MVDA 3V9RB 5JRGC 5CHLB 3H0LC 4XUJC 4UUZB 2YFVB 1P3KC 5GSUA 5B1LC 5B31A 3AZNA 5GT0B 1HQ3D 1Z2CB 4CSRB 1P3LD 3X1VC 4WU9B 1TAFA 5FUGB 3AV1C 4KGCD 5DNND 5AV8C 5B31G 1TZYA 4YM6D 5F99C 4XUJB 3W99B 4WNNB 4J8UA 4AWLC 4QLCB 5G49A 4WV4B 3NQUB 5B2JC 5GSUD 5B31D 3KUYC 3W97B 3MGRD 3MGSC 4G91C 5B32B 3TU4B 5B0ZD 4J8UC 3X1SC 4E45A 2Y2MA 2AROD 5B1MD 3LJAD 3UTBC 5AV6C 1TZYD 2BYKB 3X1SA 1EQZB 3UT9D 2NQBA 5B2ID 3UTBA 1M19D 2Y2JA 3TU4D 1KX4D 4H9PB 3AZIB 3MGRA 4J8VB 2DF4C 2J8PA 1KX3D 1ZLAA 1AOID 5B0ZA 3B6GB 5B32G 1KX5D 5B33A 1P3FB 1P3PA 1U35B 1P3KB 5B1LB 3RELD 3AZED 2FFFB 4HGAC 3AZMC 1M19A 1WWIA 4EO5B 3KXBD 4X23D 3KFUG 3AZIC 5GXQB 3AZEC 5CPIB 4WU9D 5AV9C 2CWEA 3AZKB 3WKJC 5B0YC 3B6FB 1U35C 5GT3B 4H9QA 4CAYA 5AY8B 4M6BA 3AZFD 5BNVB 3A6NB 4JJNB 2NZDD 3WKJA 5E5AC 4R8PD 4DRAA 3AFAC 3AZEA 5DNMA 4WJ3C 5B24C 4J8WD 3TU4C 2Y2QA 3LELB 4EO5C 5AV9B 2JSSA 3REJD 3X1TA 3VH6W 3AZLC 1P3GA 5BNXB 4ZUXD 3LZ1B 3MGQC 3AN2C 4R8PB 3W99D 5AVCD 2HIOC 4H9NB 3MGQA 3AZGB 3AN2A 1M18A 1M1AB 5JRGA 5AV5D 3MNNA 3MVDC 5E5AB 3REJB 2F8NA 4E44A 3AZND 5B32D 5B2IA 5G49B 1KX5A 3WAAB 1B6WA 2UWXA 4Z66A 2BYMB 4KGCA 5B2IC 4H9RB 3AZLB 3B0CT 5AV6A 1BH8A 3EPKA 3LJAC 3X1UA 2AROC 3FDDA 5AV9D 3MGQD 3AN2D 3C1BA 3VH5W 3UT9A 2CV5C 3REJC 3KXBB 1P3BB 3MGRC 3AZMD 3AZFA 1P3LA 2Y2PA 5B0ZB 1KX5C 3WA9A 3B0BA 3AZFC 3EPLA 3LJAB 5AVBD 1P3PB 2AROB 3X1VD 4WU9C 2NZDA 2Y2HA 1ID3D 1F66D 5B2JA 3REIA 2FJ7A 3LZ0C 1P3BC 1M19B 5CP6B 3UT9C 4ZUXB 5B40B 1F1EA 3AZJC 1KX3B 5B1MB 3MVDB 1P3GD 5KDMB 2YFWA 4J8WB 5BT1D 5JA4A 2Y2LA 3AZNB 1P3MC 3KUYD 3REHD 4Z5TA 3O62A 1KX4C 1T3UA 1H3OB 4WU8A 2F8ND 2ZY4A 1S32A 3WTPA 3UTAB 1PZRA 5AV9A 2Y2KA 3AZHC 3X1TB 1KX4A 4LD9C 4NE3A 3KSYA 3P5JB 4YM6C 1P3OC 2CV5B 4R8PA 1P3FC 4KHAB 3EPHA 2G5IC 5GT0A 2Y2GA 3B6GC 5DNMC 1P3MB 5CPJD 5E5AA 5B24A 5CPID 3VH5A 1BH9A 4X23A 2Y2NA 2VQRA 1P34D 3W96A 3REKB 4Z66B 4J8XC 4J8UB 4H9RA 4DQYB 4G92B 3AZLA 3NQUA 3UTBB 5AV6B 3AV1D 1P3OB 4NE6A 2DQNC 1HQ3C 3H0RC 5AY8C 3UT9B 4KUDA 5AVBA 3X1VA 5B1LD 5DNMD 1P3KD 1ZLAB 1HQ3A 4XZQC 4XUJD 4WZSB 5CPKB 2RVQD 3AV1B 1P3OD 5AV8B 3AV2B 2HIOA 5AVCB 1M18C 2Y2IA 5F99B 5C3IC 2JE5A 3X1UC 3R45B 3EPJA 4J8VA 1JFIB 5AY8D
chains in the Genus database with same CATH topology
1ID3C 5AV5A 3MNND 1F66C 3AZHB 2PYOB 4LD9B 3REHC 3W98B 3MGSB 3AV2D 5BT1C 3AZJA 4UUZA 4XZQB 5GXQC 4Z2MG 5GSUB 5B31B 3KWQC 3WKJB 3NQJB 5CPIC 3AZEB 3H0MC 1EQZC 2PYOD 1TAFB 4ZBJC 2YFWB 5FUGA 3AFAB 5CPIA 3LZ0D 3V9RA 1TZYB 3B6GD 1ID3B 5GT3A 1F66B 4Z5TB 2YFVA 3REKC 5BNVA 4JJNA 4WNNA 1P34B 3RELB 5B33D 3MGPC 1P3IC 2IO5C 4CSRA 3AZHD 4LD9D 3A1KA 5DNNA 3W96D 5CPJB 4UPKA 3LZ1C 4HGAB 3WA9D 4YS3A 2L5AA 4XUJA 3LZ0A 4WU8D 2BYMA 4YS3C 3O62C 4Z5TC 4KUDD 2HIOD 1P3GC 3REID 4H9NA 5AVCC 1M18B 1M1AA 2FJ7D 3W97A 2NQBD 1W2EA 5B0YB 3B6FC 3X1UB 4ZUXC 4QLCD 1HTAA 3TU4A 3AZLD 3REKA 5CP6C 5B2IB 3WAAA 2BYKA 4J8WC 5B24D 2NQBB 5CPKD 3AZNC 1Q9CA 3VH6T 3LELC 4J8VD 1S32C 3KUYA 1P3KA 1BH8B 5BO0B 1M1AD 3MGRB 1U35D 1AOIA 4ZBJB 3AZJD 3AV1A 1P3AA 4YM6B 3A6ND 2NZDB 3AZGC 3X1TC 2F8NH 1WWSA 1P3BD 3WAAD 2HUEB 5AY8A 3B0DB 2LY8A 3AZGD 3RELC 3C1BC 1P3LB 2ZY5A 5E5AD 3LJAA 5DNMB 4J8XA 4JJND 4WU9A 2NZDC 4XZQA 5GXQA 5JA4B 1KX3C 4NFTA 3KWQA 3AZKA 3C1BD 1KU5A 3O62B 1N1JB 4Z66C 1H3OA 4WU8B 3KXBC 2HUEC 3AZMA 2CV5D 5AV5C 2W8SA 3UTAA 3AZGA 1KX3A 1KX4B 1ZLAD 4QLCC 3VH6A 3W98D 2G5HC 3C1CC 3REJA 2JCHA 3W99C 3C1CD 3AYWA 3REIC 2FJ7C 2XD1A 5B0ZC 1KX5B 3F6TA 1ZLAC 3W99A 3UTAC 3LZ1A 3AZKD 4H9SC 1B67A 4WU8C 3LELD 1P3MA 4QLCA 3X1SB 1S32B 4Z66D 5C3IB 5B2JD 2ZM5A 2F2AC 4G91B 5B32C 3WA9C 5JRGB 3AFAD 1M19C 3C1CB 3AZKC 3UTAD 3MVDD 5B32A 4JJNC 5B33C 2ZY3A 3WKJD 3B6FD 5B1MC 3REHB 3W98C 3REKD 4DRBA 3AZID 1ULYA 5B24B 1U35A 4YS3D 2XD5A 3X1VB 3X1TD 4G92C 1BH9B 1HQ3B 4H9PA 1EQZD 3WA9B 4R8PC 5AV8A 3KWQD 3KUYB 3W97C 2HIOB 5B33B 5AVCA 1P3FA 1M1AC 5BO0A 3B6FA 4H9QB 4CAYB 5B0YD 3AV2C 3A6NA 5CPKC 3MGPB 1P3IB 2IO5B 4H9OB 3MNNC 5GT0D 5AV5B 4X23C 5CPKA 3WAAC 2AROA 2ZY2A 5CP6D 2PYOC 2F8NK 3A6NC 3B0CW 5AV6D 3UTBD 1P3GB 5BNXA 1P3AD 4Z5TD 4XZQD 5GXQD 3O62D 3A1IA 1AOIC 4Z2MH 3WTPB 4J8VC 1S32D 3MGQB 3MGSA 3AN2B 2F8NG 5GSUC 5B31C 3KWQB 3MNNB 3LZ1D 2F8NB 5B40D 3LELA 1N1JA 3W96C 2CV5A 3AZMB 4KHAA 5F99D 3MGPD 3RELA 1P3ID 4J8XD 3WTPD 1TZYC 3EG5B 1P34C 4KGCC 5DNNB 2RVQC 2NQBC 5CPJA 1R4VA 3X1SD 4J8UD 3AYWB 4KUDC 1ID3A 5GT3C 1F66A 5CPJC 3LZ0B 3MGSD 3W96B 4H9SA 1P34A 3VH5T 1P3FD 1P3BA 3B0DC 5B0YA 4KGCB 1EQZA 3C1CA 3AYWD 3AYWC 4KUDB 4YS3B 5BS7A 1A7WA 5DNNC 5AV8D 4X23B 3C1BB 3AZIA 1P3LC 3REHA 2BG1A 3KXBA 4AWLB 3B6GA 1P3OA 5GT3D 5B2JB 5BS7C 3AZFB 2RIQA 1M18D 3R45A 5JRGD 5AVBB 1P3PD 5B1LA 1AOIB 1P3PC 1JFIA 3WTPC 1P3AB 3AL0C 3AZHA 4LD9A 3W98A 3IP4C 5B1MA 2Y2OA 4NE5A 5KDMA 5B40C 3AV2A 3AZJB 4J8WA 5GT0C 3WTPE 3MGPA 5F99A 1P3IA 4H9OA 3REIB 2FJ7B 1P3MD 3NQJA 5AVBC 5CP6A 3X1UD 1BFMA 4J8XB 4ZUXA 1P3AC 4YM6A 5B40A 3W97D 2PYOA 3AFAA 3MVDA 3V9RB 5JRGC 5CHLB 3H0LC 4XUJC 4UUZB 2YFVB 1P3KC 5GSUA 5B1LC 5B31A 3AZNA 5GT0B 1HQ3D 1Z2CB 4CSRB 1P3LD 3X1VC 4WU9B 1TAFA 5FUGB 3AV1C 4KGCD 5DNND 5AV8C 5B31G 1TZYA 4YM6D 5F99C 4XUJB 3W99B 4WNNB 4J8UA 4AWLC 4QLCB 5G49A 4WV4B 3NQUB 5B2JC 5GSUD 5B31D 3KUYC 3W97B 3MGRD 3MGSC 4G91C 5B32B 3TU4B 5B0ZD 4J8UC 3X1SC 4E45A 2Y2MA 2AROD 5B1MD 3LJAD 3UTBC 5AV6C 1TZYD 2BYKB 3X1SA 1EQZB 3UT9D 2NQBA 5B2ID 3UTBA 1M19D 2Y2JA 3TU4D 1KX4D 4H9PB 3AZIB 3MGRA 4J8VB 2DF4C 2J8PA 1KX3D 1ZLAA 1AOID 5B0ZA 3B6GB 5B32G 1KX5D 5B33A 1P3FB 1P3PA 1U35B 1P3KB 5B1LB 3RELD 3AZED 2FFFB 4HGAC 3AZMC 1M19A 1WWIA 4EO5B 3KXBD 4X23D 3KFUG 3AZIC 5GXQB 3AZEC 5CPIB 4WU9D 5AV9C 2CWEA 3AZKB 3WKJC 5B0YC 3B6FB 1U35C 5GT3B 4H9QA 4CAYA 5AY8B 4M6BA 3AZFD 5BNVB 3A6NB 4JJNB 2NZDD 3WKJA 5E5AC 4R8PD 4DRAA 3AFAC 3AZEA 5DNMA 4WJ3C 5B24C 4J8WD 3TU4C 2Y2QA 3LELB 4EO5C 5AV9B 2JSSA 3REJD 3X1TA 3VH6W 3AZLC 1P3GA 5BNXB 4ZUXD 3LZ1B 3MGQC 3AN2C 4R8PB 3W99D 5AVCD 2HIOC 4H9NB 3MGQA 3AZGB 3AN2A 1M18A 1M1AB 5JRGA 5AV5D 3MNNA 3MVDC 5E5AB 3REJB 2F8NA 4E44A 3AZND 5B32D 5B2IA 5G49B 1KX5A 3WAAB 1B6WA 2UWXA 4Z66A 2BYMB 4KGCA 5B2IC 4H9RB 3AZLB 3B0CT 5AV6A 1BH8A 3EPKA 3LJAC 3X1UA 2AROC 3FDDA 5AV9D 3MGQD 3AN2D 3C1BA 3VH5W 3UT9A 2CV5C 3REJC 3KXBB 1P3BB 3MGRC 3AZMD 3AZFA 1P3LA 2Y2PA 5B0ZB 1KX5C 3WA9A 3B0BA 3AZFC 3EPLA 3LJAB 5AVBD 1P3PB 2AROB 3X1VD 4WU9C 2NZDA 2Y2HA 1ID3D 1F66D 5B2JA 3REIA 2FJ7A 3LZ0C 1P3BC 1M19B 5CP6B 3UT9C 4ZUXB 5B40B 1F1EA 3AZJC 1KX3B 5B1MB 3MVDB 1P3GD 5KDMB 2YFWA 4J8WB 5BT1D 5JA4A 2Y2LA 3AZNB 1P3MC 3KUYD 3REHD 4Z5TA 3O62A 1KX4C 1T3UA 1H3OB 4WU8A 2F8ND 2ZY4A 1S32A 3WTPA 3UTAB 1PZRA 5AV9A 2Y2KA 3AZHC 3X1TB 1KX4A 4LD9C 4NE3A 3KSYA 3P5JB 4YM6C 1P3OC 2CV5B 4R8PA 1P3FC 4KHAB 3EPHA 2G5IC 5GT0A 2Y2GA 3B6GC 5DNMC 1P3MB 5CPJD 5E5AA 5B24A 5CPID 3VH5A 1BH9A 4X23A 2Y2NA 2VQRA 1P34D 3W96A 3REKB 4Z66B 4J8XC 4J8UB 4H9RA 4DQYB 4G92B 3AZLA 3NQUA 3UTBB 5AV6B 3AV1D 1P3OB 4NE6A 2DQNC 1HQ3C 3H0RC 5AY8C 3UT9B 4KUDA 5AVBA 3X1VA 5B1LD 5DNMD 1P3KD 1ZLAB 1HQ3A 4XZQC 4XUJD 4WZSB 5CPKB 2RVQD 3AV1B 1P3OD 5AV8B 3AV2B 2HIOA 5AVCB 1M18C 2Y2IA 5F99B 5C3IC 2JE5A 3X1UC 3R45B 3EPJA 4J8VA 1JFIB 5AY8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 C;  5AV5 A;  3MNN D;  1F66 C;  3AZH B;  2PYO B;  4LD9 B;  3REH C;  3W98 B;  3MGS B;  3AV2 D;  5BT1 C;  3AZJ A;  4UUZ A;  4XZQ B;  5GXQ C;  4Z2M G;  5GSU B;  5B31 B;  3KWQ C;  3WKJ B;  3NQJ B;  5CPI C;  3AZE B;  1EQZ C;  2PYO D;  1TAF B;  4ZBJ C;  2YFW B;  5FUG A;  3AFA B;  5CPI A;  3LZ0 D;  3V9R A;  1TZY B;  3B6G D;  1ID3 B;  5GT3 A;  1F66 B;  4Z5T B;  2YFV A;  3REK C;  5BNV A;  4JJN A;  4WNN A;  1P34 B;  3REL B;  5B33 D;  3MGP C;  1P3I C;  2IO5 C;  4CSR A;  3AZH D;  4LD9 D;  5DNN A;  3W96 D;  5CPJ B;  3LZ1 C;  4HGA B;  3WA9 D;  4YS3 A;  2L5A A;  4XUJ A;  3LZ0 A;  4WU8 D;  2BYM A;  4YS3 C;  3O62 C;  4Z5T C;  4KUD D;  2HIO D;  1P3G C;  3REI D;  4H9N A;  5AVC C;  1M18 B;  1M1A A;  2FJ7 D;  3W97 A;  2NQB D;  5B0Y B;  3B6F C;  3X1U B;  4ZUX C;  4QLC D;  1HTA A;  3TU4 A;  3AZL D;  3REK A;  5CP6 C;  5B2I B;  3WAA A;  2BYK A;  4J8W C;  5B24 D;  2NQB B;  5CPK D;  3AZN C;  1Q9C A;  3VH6 T;  3LEL C;  4J8V D;  1S32 C;  3KUY A;  1P3K A;  1BH8 B;  5BO0 B;  1M1A D;  3MGR B;  1U35 D;  1AOI A;  4ZBJ B;  3AZJ D;  3AV1 A;  1P3A A;  4YM6 B;  3A6N D;  2NZD B;  3AZG C;  3X1T C;  2F8N H;  1WWS A;  1P3B D;  3WAA D;  2HUE B;  5AY8 A;  3B0D B;  2LY8 A;  3AZG D;  3REL C;  3C1B C;  1P3L B;  5E5A D;  3LJA A;  5DNM B;  4J8X A;  4JJN D;  4WU9 A;  2NZD C;  4XZQ A;  5GXQ A;  5JA4 B;  1KX3 C;  4NFT A;  3KWQ A;  3AZK A;  3C1B D;  1KU5 A;  3O62 B;  1N1J B;  4Z66 C;  1H3O A;  4WU8 B;  3KXB C;  2HUE C;  3AZM A;  2CV5 D;  5AV5 C;  1KX3 A;  3UTA A;  3AZG A;  1KX4 B;  1ZLA D;  4QLC C;  3VH6 A;  3W98 D;  3C1C C;  3REJ A;  3W99 C;  3C1C D;  3AYW A;  3REI C;  2FJ7 C;  5B0Z C;  1KX5 B;  1ZLA C;  3W99 A;  3UTA C;  3LZ1 A;  3AZK D;  4H9S C;  1B67 A;  4WU8 C;  3LEL D;  1P3M A;  4QLC A;  3X1S B;  1S32 B;  4Z66 D;  5C3I B;  5B2J D;  4G91 B;  5B32 C;  3WA9 C;  5JRG B;  3AFA D;  1M19 C;  3C1C B;  3AZK C;  3UTA D;  3MVD D;  5B32 A;  4JJN C;  5B33 C;  3WKJ D;  3B6F D;  5B1M C;  3REH B;  3W98 C;  3REK D;  4DRB A;  3AZI D;  1ULY A;  5B24 B;  1U35 A;  4YS3 D;  3X1V B;  3X1T D;  4G92 C;  1BH9 B;  1HQ3 B;  4H9P A;  1EQZ D;  3WA9 B;  4R8P C;  5AV8 A;  3KWQ D;  3KUY B;  3W97 C;  2HIO B;  5B33 B;  5AVC A;  1P3F A;  1M1A C;  5BO0 A;  3B6F A;  4H9Q B;  4CAY B;  5B0Y D;  3AV2 C;  3A6N A;  5CPK C;  3MGP B;  1P3I B;  2IO5 B;  4H9O B;  3MNN C;  5GT0 D;  5AV5 B;  4X23 C;  5CPK A;  3WAA C;  2ARO A;  5CP6 D;  2PYO C;  2F8N K;  3A6N C;  3B0C W;  5AV6 D;  3UTB D;  1P3G B;  5BNX A;  1P3A D;  4Z5T D;  4XZQ D;  5GXQ D;  3O62 D;  1AOI C;  4Z2M H;  3WTP B;  4J8V C;  1S32 D;  3MGQ B;  3MGS A;  3AN2 B;  2F8N G;  5GSU C;  5B31 C;  3KWQ B;  3MNN B;  3LZ1 D;  2F8N B;  5B40 D;  3LEL A;  1N1J A;  3W96 C;  2CV5 A;  3AZM B;  4KHA A;  5F99 D;  3MGP D;  3REL A;  1P3I D;  4J8X D;  3WTP D;  1TZY C;  1P34 C;  4KGC C;  5DNN B;  2RVQ C;  2NQB C;  5CPJ A;  1R4V A;  3X1S D;  4J8U D;  3AYW B;  4KUD C;  1ID3 A;  5GT3 C;  1F66 A;  5CPJ C;  3LZ0 B;  3MGS D;  3W96 B;  4H9S A;  1P34 A;  3VH5 T;  1P3F D;  1P3B A;  3B0D C;  5B0Y A;  4KGC B;  1EQZ A;  3C1C A;  3AYW D;  3AYW C;  4KUD B;  4YS3 B;  5BS7 A;  1A7W A;  5DNN C;  5AV8 D;  4X23 B;  3C1B B;  3AZI A;  1P3L C;  3REH A;  3KXB A;  4AWL B;  3B6G A;  1P3O A;  5GT3 D;  5B2J B;  5BS7 C;  3AZF B;  1M18 D;  3R45 A;  5JRG D;  5AVB B;  1P3P D;  5B1L A;  1AOI B;  1P3P C;  1JFI A;  3WTP C;  1P3A B;  3AZH A;  4LD9 A;  3W98 A;  5B1M A;  4NE5 A;  5KDM A;  5B40 C;  3AV2 A;  3AZJ B;  4J8W A;  5GT0 C;  3WTP E;  3MGP A;  5F99 A;  1P3I A;  4H9O A;  3REI B;  2FJ7 B;  1P3M D;  3NQJ A;  5AVB C;  5CP6 A;  3X1U D;  1BFM A;  4J8X B;  4ZUX A;  1P3A C;  4YM6 A;  5B40 A;  3W97 D;  2PYO A;  3AFA A;  3MVD A;  3V9R B;  5JRG C;  5CHL B;  4XUJ C;  4UUZ B;  2YFV B;  1P3K C;  5GSU A;  5B1L C;  5B31 A;  3AZN A;  5GT0 B;  1HQ3 D;  4CSR B;  1P3L D;  3X1V C;  4WU9 B;  1TAF A;  5FUG B;  3AV1 C;  4KGC D;  5DNN D;  5AV8 C;  5B31 G;  1TZY A;  4YM6 D;  5F99 C;  4XUJ B;  3W99 B;  4WNN B;  4J8U A;  4AWL C;  4QLC B;  5G49 A;  4WV4 B;  3NQU B;  5B2J C;  5GSU D;  5B31 D;  3KUY C;  3W97 B;  3MGR D;  3MGS C;  4G91 C;  5B32 B;  3TU4 B;  5B0Z D;  4J8U C;  3X1S C;  4E45 A;  2ARO D;  5B1M D;  3LJA D;  3UTB C;  5AV6 C;  1TZY D;  2BYK B;  3X1S A;  1EQZ B;  3UT9 D;  2NQB A;  5B2I D;  3UTB A;  1M19 D;  3TU4 D;  1KX4 D;  4H9P B;  3AZI B;  3MGR A;  4J8V B;  1KX3 D;  1ZLA A;  1AOI D;  5B0Z A;  3B6G B;  5B32 G;  1KX5 D;  5B33 A;  1P3F B;  1P3P A;  1U35 B;  1P3K B;  5B1L B;  3REL D;  3AZE D;  4HGA C;  3AZM C;  1M19 A;  1WWI A;  4EO5 B;  3KXB D;  4X23 D;  3AZI C;  5GXQ B;  3AZE C;  5CPI B;  4WU9 D;  5AV9 C;  2CWE A;  3AZK B;  3WKJ C;  5B0Y C;  3B6F B;  1U35 C;  5GT3 B;  4H9Q A;  4CAY A;  5AY8 B;  4M6B A;  3AZF D;  5BNV B;  3A6N B;  4JJN B;  2NZD D;  3WKJ A;  5E5A C;  4R8P D;  4DRA A;  3AFA C;  3AZE A;  5DNM A;  5B24 C;  4J8W D;  3TU4 C;  3LEL B;  4EO5 C;  5AV9 B;  2JSS A;  3REJ D;  3X1T A;  3VH6 W;  3AZL C;  1P3G A;  5BNX B;  4ZUX D;  3LZ1 B;  3MGQ C;  3AN2 C;  4R8P B;  3W99 D;  5AVC D;  2HIO C;  4H9N B;  3MGQ A;  3AZG B;  3AN2 A;  1M18 A;  1M1A B;  5JRG A;  5AV5 D;  3MNN A;  3MVD C;  5E5A B;  3REJ B;  2F8N A;  4E44 A;  3AZN D;  5B32 D;  5B2I A;  5G49 B;  1KX5 A;  3WAA B;  1B6W A;  4Z66 A;  2BYM B;  4KGC A;  5B2I C;  4H9R B;  3AZL B;  3B0C T;  5AV6 A;  1BH8 A;  3LJA C;  3X1U A;  2ARO C;  5AV9 D;  3MGQ D;  3AN2 D;  3C1B A;  3VH5 W;  3UT9 A;  2CV5 C;  3REJ C;  3KXB B;  1P3B B;  3MGR C;  3AZM D;  3AZF A;  1P3L A;  5B0Z B;  1KX5 C;  3WA9 A;  3B0B A;  3AZF C;  3LJA B;  5AVB D;  1P3P B;  2ARO B;  3X1V D;  4WU9 C;  2NZD A;  1ID3 D;  1F66 D;  5B2J A;  3REI A;  2FJ7 A;  3LZ0 C;  1P3B C;  1M19 B;  5CP6 B;  3UT9 C;  4ZUX B;  5B40 B;  1F1E A;  3AZJ C;  1KX3 B;  5B1M B;  3MVD B;  1P3G D;  5KDM B;  2YFW A;  4J8W B;  5BT1 D;  5JA4 A;  1P3M C;  3AZN B;  3KUY D;  3REH D;  4Z5T A;  3O62 A;  1KX4 C;  1H3O B;  4WU8 A;  2F8N D;  1S32 A;  3WTP A;  3UTA B;  3AZH C;  5AV9 A;  3X1T B;  1KX4 A;  4LD9 C;  4NE3 A;  3KSY A;  4YM6 C;  1P3O C;  2CV5 B;  4R8P A;  1P3F C;  4KHA B;  5GT0 A;  3B6G C;  5DNM C;  1P3M B;  5CPJ D;  5E5A A;  5B24 A;  5CPI D;  3VH5 A;  1BH9 A;  4X23 A;  1P34 D;  3W96 A;  3REK B;  4Z66 B;  4J8X C;  4J8U B;  4H9R A;  4G92 B;  3AZL A;  3NQU A;  3UTB B;  5AV6 B;  3AV1 D;  1P3O B;  4NE6 A;  1HQ3 C;  5AY8 C;  3UT9 B;  4KUD A;  5AVB A;  3X1V A;  5B1L D;  5DNM D;  1P3K D;  1ZLA B;  1HQ3 A;  4XZQ C;  4XUJ D;  4WZS B;  5CPK B;  2RVQ D;  3AV1 B;  1P3O D;  5AV8 B;  3AV2 B;  2HIO A;  5AVC B;  1M18 C;  5F99 B;  5C3I C;  3X1U C;  3R45 B;  4J8V A;  1JFI B;  5AY8 D; 
#chains in the Genus database with same CATH topology
 1ID3 C;  5AV5 A;  3MNN D;  1F66 C;  3AZH B;  2PYO B;  4LD9 B;  3REH C;  3W98 B;  3MGS B;  3AV2 D;  5BT1 C;  3AZJ A;  4UUZ A;  4XZQ B;  5GXQ C;  4Z2M G;  5GSU B;  5B31 B;  3KWQ C;  3WKJ B;  3NQJ B;  5CPI C;  3AZE B;  3H0M C;  1EQZ C;  2PYO D;  1TAF B;  4ZBJ C;  2YFW B;  5FUG A;  3AFA B;  5CPI A;  3LZ0 D;  3V9R A;  1TZY B;  3B6G D;  1ID3 B;  5GT3 A;  1F66 B;  4Z5T B;  2YFV A;  3REK C;  5BNV A;  4JJN A;  4WNN A;  1P34 B;  3REL B;  5B33 D;  3MGP C;  1P3I C;  2IO5 C;  4CSR A;  3AZH D;  4LD9 D;  3A1K A;  5DNN A;  3W96 D;  5CPJ B;  4UPK A;  3LZ1 C;  4HGA B;  3WA9 D;  4YS3 A;  2L5A A;  4XUJ A;  3LZ0 A;  4WU8 D;  2BYM A;  4YS3 C;  3O62 C;  4Z5T C;  4KUD D;  2HIO D;  1P3G C;  3REI D;  4H9N A;  5AVC C;  1M18 B;  1M1A A;  2FJ7 D;  3W97 A;  2NQB D;  1W2E A;  5B0Y B;  3B6F C;  3X1U B;  4ZUX C;  4QLC D;  1HTA A;  3TU4 A;  3AZL D;  3REK A;  5CP6 C;  5B2I B;  3WAA A;  2BYK A;  4J8W C;  5B24 D;  2NQB B;  5CPK D;  3AZN C;  1Q9C A;  3VH6 T;  3LEL C;  4J8V D;  1S32 C;  3KUY A;  1P3K A;  1BH8 B;  5BO0 B;  1M1A D;  3MGR B;  1U35 D;  1AOI A;  4ZBJ B;  3AZJ D;  3AV1 A;  1P3A A;  4YM6 B;  3A6N D;  2NZD B;  3AZG C;  3X1T C;  2F8N H;  1WWS A;  1P3B D;  3WAA D;  2HUE B;  5AY8 A;  3B0D B;  2LY8 A;  3AZG D;  3REL C;  3C1B C;  1P3L B;  2ZY5 A;  5E5A D;  3LJA A;  5DNM B;  4J8X A;  4JJN D;  4WU9 A;  2NZD C;  4XZQ A;  5GXQ A;  5JA4 B;  1KX3 C;  4NFT A;  3KWQ A;  3AZK A;  3C1B D;  1KU5 A;  3O62 B;  1N1J B;  4Z66 C;  1H3O A;  4WU8 B;  3KXB C;  2HUE C;  3AZM A;  2CV5 D;  5AV5 C;  2W8S A;  3UTA A;  3AZG A;  1KX3 A;  1KX4 B;  1ZLA D;  4QLC C;  3VH6 A;  3W98 D;  2G5H C;  3C1C C;  3REJ A;  2JCH A;  3W99 C;  3C1C D;  3AYW A;  3REI C;  2FJ7 C;  2XD1 A;  5B0Z C;  1KX5 B;  3F6T A;  1ZLA C;  3W99 A;  3UTA C;  3LZ1 A;  3AZK D;  4H9S C;  1B67 A;  4WU8 C;  3LEL D;  1P3M A;  4QLC A;  3X1S B;  1S32 B;  4Z66 D;  5C3I B;  5B2J D;  2ZM5 A;  2F2A C;  4G91 B;  5B32 C;  3WA9 C;  5JRG B;  3AFA D;  1M19 C;  3C1C B;  3AZK C;  3UTA D;  3MVD D;  5B32 A;  4JJN C;  5B33 C;  2ZY3 A;  3WKJ D;  3B6F D;  5B1M C;  3REH B;  3W98 C;  3REK D;  4DRB A;  3AZI D;  1ULY A;  5B24 B;  1U35 A;  4YS3 D;  2XD5 A;  3X1V B;  3X1T D;  4G92 C;  1BH9 B;  1HQ3 B;  4H9P A;  1EQZ D;  3WA9 B;  4R8P C;  5AV8 A;  3KWQ D;  3KUY B;  3W97 C;  2HIO B;  5B33 B;  5AVC A;  1P3F A;  1M1A C;  5BO0 A;  3B6F A;  4H9Q B;  4CAY B;  5B0Y D;  3AV2 C;  3A6N A;  5CPK C;  3MGP B;  1P3I B;  2IO5 B;  4H9O B;  3MNN C;  5GT0 D;  5AV5 B;  4X23 C;  5CPK A;  3WAA C;  2ARO A;  2ZY2 A;  5CP6 D;  2PYO C;  2F8N K;  3A6N C;  3B0C W;  5AV6 D;  3UTB D;  1P3G B;  5BNX A;  1P3A D;  4Z5T D;  4XZQ D;  5GXQ D;  3O62 D;  3A1I A;  1AOI C;  4Z2M H;  3WTP B;  4J8V C;  1S32 D;  3MGQ B;  3MGS A;  3AN2 B;  2F8N G;  5GSU C;  5B31 C;  3KWQ B;  3MNN B;  3LZ1 D;  2F8N B;  5B40 D;  3LEL A;  1N1J A;  3W96 C;  2CV5 A;  3AZM B;  4KHA A;  5F99 D;  3MGP D;  3REL A;  1P3I D;  4J8X D;  3WTP D;  1TZY C;  3EG5 B;  1P34 C;  4KGC C;  5DNN B;  2RVQ C;  2NQB C;  5CPJ A;  1R4V A;  3X1S D;  4J8U D;  3AYW B;  4KUD C;  1ID3 A;  5GT3 C;  1F66 A;  5CPJ C;  3LZ0 B;  3MGS D;  3W96 B;  4H9S A;  1P34 A;  3VH5 T;  1P3F D;  1P3B A;  3B0D C;  5B0Y A;  4KGC B;  1EQZ A;  3C1C A;  3AYW D;  3AYW C;  4KUD B;  4YS3 B;  5BS7 A;  1A7W A;  5DNN C;  5AV8 D;  4X23 B;  3C1B B;  3AZI A;  1P3L C;  3REH A;  2BG1 A;  3KXB A;  4AWL B;  3B6G A;  1P3O A;  5GT3 D;  5B2J B;  5BS7 C;  3AZF B;  2RIQ A;  1M18 D;  3R45 A;  5JRG D;  5AVB B;  1P3P D;  5B1L A;  1AOI B;  1P3P C;  1JFI A;  3WTP C;  1P3A B;  3AL0 C;  3AZH A;  4LD9 A;  3W98 A;  3IP4 C;  5B1M A;  2Y2O A;  4NE5 A;  5KDM A;  5B40 C;  3AV2 A;  3AZJ B;  4J8W A;  5GT0 C;  3WTP E;  3MGP A;  5F99 A;  1P3I A;  4H9O A;  3REI B;  2FJ7 B;  1P3M D;  3NQJ A;  5AVB C;  5CP6 A;  3X1U D;  1BFM A;  4J8X B;  4ZUX A;  1P3A C;  4YM6 A;  5B40 A;  3W97 D;  2PYO A;  3AFA A;  3MVD A;  3V9R B;  5JRG C;  5CHL B;  3H0L C;  4XUJ C;  4UUZ B;  2YFV B;  1P3K C;  5GSU A;  5B1L C;  5B31 A;  3AZN A;  5GT0 B;  1HQ3 D;  1Z2C B;  4CSR B;  1P3L D;  3X1V C;  4WU9 B;  1TAF A;  5FUG B;  3AV1 C;  4KGC D;  5DNN D;  5AV8 C;  5B31 G;  1TZY A;  4YM6 D;  5F99 C;  4XUJ B;  3W99 B;  4WNN B;  4J8U A;  4AWL C;  4QLC B;  5G49 A;  4WV4 B;  3NQU B;  5B2J C;  5GSU D;  5B31 D;  3KUY C;  3W97 B;  3MGR D;  3MGS C;  4G91 C;  5B32 B;  3TU4 B;  5B0Z D;  4J8U C;  3X1S C;  4E45 A;  2Y2M A;  2ARO D;  5B1M D;  3LJA D;  3UTB C;  5AV6 C;  1TZY D;  2BYK B;  3X1S A;  1EQZ B;  3UT9 D;  2NQB A;  5B2I D;  3UTB A;  1M19 D;  2Y2J A;  3TU4 D;  1KX4 D;  4H9P B;  3AZI B;  3MGR A;  4J8V B;  2DF4 C;  2J8P A;  1KX3 D;  1ZLA A;  1AOI D;  5B0Z A;  3B6G B;  5B32 G;  1KX5 D;  5B33 A;  1P3F B;  1P3P A;  1U35 B;  1P3K B;  5B1L B;  3REL D;  3AZE D;  2FFF B;  4HGA C;  3AZM C;  1M19 A;  1WWI A;  4EO5 B;  3KXB D;  4X23 D;  3KFU G;  3AZI C;  5GXQ B;  3AZE C;  5CPI B;  4WU9 D;  5AV9 C;  2CWE A;  3AZK B;  3WKJ C;  5B0Y C;  3B6F B;  1U35 C;  5GT3 B;  4H9Q A;  4CAY A;  5AY8 B;  4M6B A;  3AZF D;  5BNV B;  3A6N B;  4JJN B;  2NZD D;  3WKJ A;  5E5A C;  4R8P D;  4DRA A;  3AFA C;  3AZE A;  5DNM A;  4WJ3 C;  5B24 C;  4J8W D;  3TU4 C;  2Y2Q A;  3LEL B;  4EO5 C;  5AV9 B;  2JSS A;  3REJ D;  3X1T A;  3VH6 W;  3AZL C;  1P3G A;  5BNX B;  4ZUX D;  3LZ1 B;  3MGQ C;  3AN2 C;  4R8P B;  3W99 D;  5AVC D;  2HIO C;  4H9N B;  3MGQ A;  3AZG B;  3AN2 A;  1M18 A;  1M1A B;  5JRG A;  5AV5 D;  3MNN A;  3MVD C;  5E5A B;  3REJ B;  2F8N A;  4E44 A;  3AZN D;  5B32 D;  5B2I A;  5G49 B;  1KX5 A;  3WAA B;  1B6W A;  2UWX A;  4Z66 A;  2BYM B;  4KGC A;  5B2I C;  4H9R B;  3AZL B;  3B0C T;  5AV6 A;  1BH8 A;  3EPK A;  3LJA C;  3X1U A;  2ARO C;  3FDD A;  5AV9 D;  3MGQ D;  3AN2 D;  3C1B A;  3VH5 W;  3UT9 A;  2CV5 C;  3REJ C;  3KXB B;  1P3B B;  3MGR C;  3AZM D;  3AZF A;  1P3L A;  2Y2P A;  5B0Z B;  1KX5 C;  3WA9 A;  3B0B A;  3AZF C;  3EPL A;  3LJA B;  5AVB D;  1P3P B;  2ARO B;  3X1V D;  4WU9 C;  2NZD A;  2Y2H A;  1ID3 D;  1F66 D;  5B2J A;  3REI A;  2FJ7 A;  3LZ0 C;  1P3B C;  1M19 B;  5CP6 B;  3UT9 C;  4ZUX B;  5B40 B;  1F1E A;  3AZJ C;  1KX3 B;  5B1M B;  3MVD B;  1P3G D;  5KDM B;  2YFW A;  4J8W B;  5BT1 D;  5JA4 A;  2Y2L A;  3AZN B;  1P3M C;  3KUY D;  3REH D;  4Z5T A;  3O62 A;  1KX4 C;  1T3U A;  1H3O B;  4WU8 A;  2F8N D;  2ZY4 A;  1S32 A;  3WTP A;  3UTA B;  1PZR A;  5AV9 A;  2Y2K A;  3AZH C;  3X1T B;  1KX4 A;  4LD9 C;  4NE3 A;  3KSY A;  3P5J B;  4YM6 C;  1P3O C;  2CV5 B;  4R8P A;  1P3F C;  4KHA B;  3EPH A;  2G5I C;  5GT0 A;  2Y2G A;  3B6G C;  5DNM C;  1P3M B;  5CPJ D;  5E5A A;  5B24 A;  5CPI D;  3VH5 A;  1BH9 A;  4X23 A;  2Y2N A;  2VQR A;  1P34 D;  3W96 A;  3REK B;  4Z66 B;  4J8X C;  4J8U B;  4H9R A;  4DQY B;  4G92 B;  3AZL A;  3NQU A;  3UTB B;  5AV6 B;  3AV1 D;  1P3O B;  4NE6 A;  2DQN C;  1HQ3 C;  3H0R C;  5AY8 C;  3UT9 B;  4KUD A;  5AVB A;  3X1V A;  5B1L D;  5DNM D;  1P3K D;  1ZLA B;  1HQ3 A;  4XZQ C;  4XUJ D;  4WZS B;  5CPK B;  2RVQ D;  3AV1 B;  1P3O D;  5AV8 B;  3AV2 B;  2HIO A;  5AVC B;  1M18 C;  2Y2I A;  5F99 B;  5C3I C;  2JE5 A;  3X1U C;  3R45 B;  3EPJ A;  4J8V A;  1JFI B;  5AY8 D; 
#chains in the Genus database with same CATH homology
 1ID3 C;  5AV5 A;  3MNN D;  1F66 C;  3AZH B;  2PYO B;  4LD9 B;  3REH C;  3W98 B;  3MGS B;  3AV2 D;  5BT1 C;  3AZJ A;  4UUZ A;  4XZQ B;  5GXQ C;  4Z2M G;  5GSU B;  5B31 B;  3KWQ C;  3WKJ B;  3NQJ B;  5CPI C;  3AZE B;  3H0M C;  1EQZ C;  2PYO D;  1TAF B;  4ZBJ C;  2YFW B;  5FUG A;  3AFA B;  5CPI A;  3LZ0 D;  3V9R A;  1TZY B;  3B6G D;  1ID3 B;  5GT3 A;  1F66 B;  4Z5T B;  2YFV A;  3REK C;  5BNV A;  4JJN A;  4WNN A;  1P34 B;  3REL B;  5B33 D;  3MGP C;  1P3I C;  2IO5 C;  4CSR A;  3AZH D;  4LD9 D;  3A1K A;  5DNN A;  3W96 D;  5CPJ B;  4UPK A;  3LZ1 C;  4HGA B;  3WA9 D;  4YS3 A;  2L5A A;  4XUJ A;  3LZ0 A;  4WU8 D;  2BYM A;  4YS3 C;  3O62 C;  4Z5T C;  4KUD D;  2HIO D;  1P3G C;  3REI D;  4H9N A;  5AVC C;  1M18 B;  1M1A A;  2FJ7 D;  3W97 A;  2NQB D;  1W2E A;  5B0Y B;  3B6F C;  3X1U B;  4ZUX C;  4QLC D;  1HTA A;  3TU4 A;  3AZL D;  3REK A;  5CP6 C;  5B2I B;  3WAA A;  2BYK A;  4J8W C;  5B24 D;  2NQB B;  5CPK D;  3AZN C;  1Q9C A;  3VH6 T;  3LEL C;  4J8V D;  1S32 C;  3KUY A;  1P3K A;  1BH8 B;  5BO0 B;  1M1A D;  3MGR B;  1U35 D;  1AOI A;  4ZBJ B;  3AZJ D;  3AV1 A;  1P3A A;  4YM6 B;  3A6N D;  2NZD B;  3AZG C;  3X1T C;  2F8N H;  1WWS A;  1P3B D;  3WAA D;  2HUE B;  5AY8 A;  3B0D B;  2LY8 A;  3AZG D;  3REL C;  3C1B C;  1P3L B;  2ZY5 A;  5E5A D;  3LJA A;  5DNM B;  4J8X A;  4JJN D;  4WU9 A;  2NZD C;  4XZQ A;  5GXQ A;  5JA4 B;  1KX3 C;  4NFT A;  3KWQ A;  3AZK A;  3C1B D;  1KU5 A;  3O62 B;  1N1J B;  4Z66 C;  1H3O A;  4WU8 B;  3KXB C;  2HUE C;  3AZM A;  2CV5 D;  5AV5 C;  2W8S A;  3UTA A;  3AZG A;  1KX3 A;  1KX4 B;  1ZLA D;  4QLC C;  3VH6 A;  3W98 D;  2G5H C;  3C1C C;  3REJ A;  2JCH A;  3W99 C;  3C1C D;  3AYW A;  3REI C;  2FJ7 C;  2XD1 A;  5B0Z C;  1KX5 B;  3F6T A;  1ZLA C;  3W99 A;  3UTA C;  3LZ1 A;  3AZK D;  4H9S C;  1B67 A;  4WU8 C;  3LEL D;  1P3M A;  4QLC A;  3X1S B;  1S32 B;  4Z66 D;  5C3I B;  5B2J D;  2ZM5 A;  2F2A C;  4G91 B;  5B32 C;  3WA9 C;  5JRG B;  3AFA D;  1M19 C;  3C1C B;  3AZK C;  3UTA D;  3MVD D;  5B32 A;  4JJN C;  5B33 C;  2ZY3 A;  3WKJ D;  3B6F D;  5B1M C;  3REH B;  3W98 C;  3REK D;  4DRB A;  3AZI D;  1ULY A;  5B24 B;  1U35 A;  4YS3 D;  2XD5 A;  3X1V B;  3X1T D;  4G92 C;  1BH9 B;  1HQ3 B;  4H9P A;  1EQZ D;  3WA9 B;  4R8P C;  5AV8 A;  3KWQ D;  3KUY B;  3W97 C;  2HIO B;  5B33 B;  5AVC A;  1P3F A;  1M1A C;  5BO0 A;  3B6F A;  4H9Q B;  4CAY B;  5B0Y D;  3AV2 C;  3A6N A;  5CPK C;  3MGP B;  1P3I B;  2IO5 B;  4H9O B;  3MNN C;  5GT0 D;  5AV5 B;  4X23 C;  5CPK A;  3WAA C;  2ARO A;  2ZY2 A;  5CP6 D;  2PYO C;  2F8N K;  3A6N C;  3B0C W;  5AV6 D;  3UTB D;  1P3G B;  5BNX A;  1P3A D;  4Z5T D;  4XZQ D;  5GXQ D;  3O62 D;  3A1I A;  1AOI C;  4Z2M H;  3WTP B;  4J8V C;  1S32 D;  3MGQ B;  3MGS A;  3AN2 B;  2F8N G;  5GSU C;  5B31 C;  3KWQ B;  3MNN B;  3LZ1 D;  2F8N B;  5B40 D;  3LEL A;  1N1J A;  3W96 C;  2CV5 A;  3AZM B;  4KHA A;  5F99 D;  3MGP D;  3REL A;  1P3I D;  4J8X D;  3WTP D;  1TZY C;  3EG5 B;  1P34 C;  4KGC C;  5DNN B;  2RVQ C;  2NQB C;  5CPJ A;  1R4V A;  3X1S D;  4J8U D;  3AYW B;  4KUD C;  1ID3 A;  5GT3 C;  1F66 A;  5CPJ C;  3LZ0 B;  3MGS D;  3W96 B;  4H9S A;  1P34 A;  3VH5 T;  1P3F D;  1P3B A;  3B0D C;  5B0Y A;  4KGC B;  1EQZ A;  3C1C A;  3AYW D;  3AYW C;  4KUD B;  4YS3 B;  5BS7 A;  1A7W A;  5DNN C;  5AV8 D;  4X23 B;  3C1B B;  3AZI A;  1P3L C;  3REH A;  2BG1 A;  3KXB A;  4AWL B;  3B6G A;  1P3O A;  5GT3 D;  5B2J B;  5BS7 C;  3AZF B;  2RIQ A;  1M18 D;  3R45 A;  5JRG D;  5AVB B;  1P3P D;  5B1L A;  1AOI B;  1P3P C;  1JFI A;  3WTP C;  1P3A B;  3AL0 C;  3AZH A;  4LD9 A;  3W98 A;  3IP4 C;  5B1M A;  2Y2O A;  4NE5 A;  5KDM A;  5B40 C;  3AV2 A;  3AZJ B;  4J8W A;  5GT0 C;  3WTP E;  3MGP A;  5F99 A;  1P3I A;  4H9O A;  3REI B;  2FJ7 B;  1P3M D;  3NQJ A;  5AVB C;  5CP6 A;  3X1U D;  1BFM A;  4J8X B;  4ZUX A;  1P3A C;  4YM6 A;  5B40 A;  3W97 D;  2PYO A;  3AFA A;  3MVD A;  3V9R B;  5JRG C;  5CHL B;  3H0L C;  4XUJ C;  4UUZ B;  2YFV B;  1P3K C;  5GSU A;  5B1L C;  5B31 A;  3AZN A;  5GT0 B;  1HQ3 D;  1Z2C B;  4CSR B;  1P3L D;  3X1V C;  4WU9 B;  1TAF A;  5FUG B;  3AV1 C;  4KGC D;  5DNN D;  5AV8 C;  5B31 G;  1TZY A;  4YM6 D;  5F99 C;  4XUJ B;  3W99 B;  4WNN B;  4J8U A;  4AWL C;  4QLC B;  5G49 A;  4WV4 B;  3NQU B;  5B2J C;  5GSU D;  5B31 D;  3KUY C;  3W97 B;  3MGR D;  3MGS C;  4G91 C;  5B32 B;  3TU4 B;  5B0Z D;  4J8U C;  3X1S C;  4E45 A;  2Y2M A;  2ARO D;  5B1M D;  3LJA D;  3UTB C;  5AV6 C;  1TZY D;  2BYK B;  3X1S A;  1EQZ B;  3UT9 D;  2NQB A;  5B2I D;  3UTB A;  1M19 D;  2Y2J A;  3TU4 D;  1KX4 D;  4H9P B;  3AZI B;  3MGR A;  4J8V B;  2DF4 C;  2J8P A;  1KX3 D;  1ZLA A;  1AOI D;  5B0Z A;  3B6G B;  5B32 G;  1KX5 D;  5B33 A;  1P3F B;  1P3P A;  1U35 B;  1P3K B;  5B1L B;  3REL D;  3AZE D;  2FFF B;  4HGA C;  3AZM C;  1M19 A;  1WWI A;  4EO5 B;  3KXB D;  4X23 D;  3KFU G;  3AZI C;  5GXQ B;  3AZE C;  5CPI B;  4WU9 D;  5AV9 C;  2CWE A;  3AZK B;  3WKJ C;  5B0Y C;  3B6F B;  1U35 C;  5GT3 B;  4H9Q A;  4CAY A;  5AY8 B;  4M6B A;  3AZF D;  5BNV B;  3A6N B;  4JJN B;  2NZD D;  3WKJ A;  5E5A C;  4R8P D;  4DRA A;  3AFA C;  3AZE A;  5DNM A;  4WJ3 C;  5B24 C;  4J8W D;  3TU4 C;  2Y2Q A;  3LEL B;  4EO5 C;  5AV9 B;  2JSS A;  3REJ D;  3X1T A;  3VH6 W;  3AZL C;  1P3G A;  5BNX B;  4ZUX D;  3LZ1 B;  3MGQ C;  3AN2 C;  4R8P B;  3W99 D;  5AVC D;  2HIO C;  4H9N B;  3MGQ A;  3AZG B;  3AN2 A;  1M18 A;  1M1A B;  5JRG A;  5AV5 D;  3MNN A;  3MVD C;  5E5A B;  3REJ B;  2F8N A;  4E44 A;  3AZN D;  5B32 D;  5B2I A;  5G49 B;  1KX5 A;  3WAA B;  1B6W A;  2UWX A;  4Z66 A;  2BYM B;  4KGC A;  5B2I C;  4H9R B;  3AZL B;  3B0C T;  5AV6 A;  1BH8 A;  3EPK A;  3LJA C;  3X1U A;  2ARO C;  3FDD A;  5AV9 D;  3MGQ D;  3AN2 D;  3C1B A;  3VH5 W;  3UT9 A;  2CV5 C;  3REJ C;  3KXB B;  1P3B B;  3MGR C;  3AZM D;  3AZF A;  1P3L A;  2Y2P A;  5B0Z B;  1KX5 C;  3WA9 A;  3B0B A;  3AZF C;  3EPL A;  3LJA B;  5AVB D;  1P3P B;  2ARO B;  3X1V D;  4WU9 C;  2NZD A;  2Y2H A;  1ID3 D;  1F66 D;  5B2J A;  3REI A;  2FJ7 A;  3LZ0 C;  1P3B C;  1M19 B;  5CP6 B;  3UT9 C;  4ZUX B;  5B40 B;  1F1E A;  3AZJ C;  1KX3 B;  5B1M B;  3MVD B;  1P3G D;  5KDM B;  2YFW A;  4J8W B;  5BT1 D;  5JA4 A;  2Y2L A;  3AZN B;  1P3M C;  3KUY D;  3REH D;  4Z5T A;  3O62 A;  1KX4 C;  1T3U A;  1H3O B;  4WU8 A;  2F8N D;  2ZY4 A;  1S32 A;  3WTP A;  3UTA B;  1PZR A;  5AV9 A;  2Y2K A;  3AZH C;  3X1T B;  1KX4 A;  4LD9 C;  4NE3 A;  3KSY A;  3P5J B;  4YM6 C;  1P3O C;  2CV5 B;  4R8P A;  1P3F C;  4KHA B;  3EPH A;  2G5I C;  5GT0 A;  2Y2G A;  3B6G C;  5DNM C;  1P3M B;  5CPJ D;  5E5A A;  5B24 A;  5CPI D;  3VH5 A;  1BH9 A;  4X23 A;  2Y2N A;  2VQR A;  1P34 D;  3W96 A;  3REK B;  4Z66 B;  4J8X C;  4J8U B;  4H9R A;  4DQY B;  4G92 B;  3AZL A;  3NQU A;  3UTB B;  5AV6 B;  3AV1 D;  1P3O B;  4NE6 A;  2DQN C;  1HQ3 C;  3H0R C;  5AY8 C;  3UT9 B;  4KUD A;  5AVB A;  3X1V A;  5B1L D;  5DNM D;  1P3K D;  1ZLA B;  1HQ3 A;  4XZQ C;  4XUJ D;  4WZS B;  5CPK B;  2RVQ D;  3AV1 B;  1P3O D;  5AV8 B;  3AV2 B;  2HIO A;  5AVC B;  1M18 C;  2Y2I A;  5F99 B;  5C3I C;  2JE5 A;  3X1U C;  3R45 B;  3EPJ A;  4J8V A;  1JFI B;  5AY8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...