3KXBD

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
b'YVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 33
structure length 86
sequence length 86
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbD00
3UT9A 3AZHA 3AZLC 4Z66B 1KX5B 5C3IB 3W96A 3TU4D 4Z66C 3REHA 1P3BA 5C3IC 2F8NH 1ULYA 1M19A 5DNNC 4Z5TA 1F66A 4KUDA 5BT1C 2NQBB 3B6GB 5B2ID 1ID3B 2NQBC 5AV9D 1P3FD 3MVDB 4YM6B 1KX3A 1ID3C 3AZEA 2FJ7C 5DNMD 3MVDC 5FUGA 1P3MB 1M1AD 4XUJB 4R8PB 2BYMB 4X23C 3W97D 3AZKA 3VH6T 2PYOA 3UT9B 3B6FA 3AZHB 4LD9A 4XZQD 3W98C 1P3BB 3AZFA 3LZ1A 3REKD 5AY8B 1M19B 5B32A 3B0BA 2F8NA 5AY8C 3VH6A 4JJNC 4KUDB 2CV5A 3AZID 5CP6A 5B1LA 5G49B 1TAFA 1P3OA 5B24D 1KX3B 5B33C 5CPID 5B40D 3AZEB 1U35C 3WTPA 3AZJD 2HIOC 4EO5B 3X1UC 4E45A 3LELA 3MGSA 3AZKB 1TZYC 4YS3C 5B2JB 3O62D 4J8WA 3B6FB 4WNNB 5AVBA 5B2JC 3AZLD 3LJAC 5AV6A 2F8NB 4KGCB 3MGRC 3LZ0A 4M6BA 4KGCC 1BFMA 3X1SC 4QLCC 5B0YB 5DNND 5CP6B 5B0YC 1TAFB 5E5AB 4Z2MG 3KUYD 3W99A 1P3KC 1P3FA 1EQZC 5DNMA 1ID3D 3WTPB 1M1AA 2FJ7D 3MGSB 3LELB 4UUZA 4WU8C 3NQJB 5BO0B 5GXQA 4X23D 3RELA 1BH9A 3UTAA 5GT3C 5AVBB 4ZBJB 4XZQA 3WA9C 3AV1A 3WTPE 5AV6B 3REIC 3W98D 1AOIA 3X1VC 3LZ0B 3UTBC 4NFTA 3A6NA 1P3AB 1P3GC 5AY8D 5AVCA 1P3AC 1HQ3B 4JJND 2IO5C 3VH6W 3AZIA 4ZUXB 3W99B 5B24A 2AROB 4ZUXC 3C1CD 3AN2A 4H9RA 3X1TC 5B33D 1WWIA 2AROC 1U35D 4J8UB 4UUZB 5BS7C 3MGPB 5CPJB 2HIOD 5GXQB 3AZNC 3X1UD 3RELB 3MGPC 5CPJC 4H9PA 1TZYD 4YS3D 1M18A 5B1MA 3AFAC 4CSRA 4J8XA 3AV1B 1S32B 2HUEB 1S32C 3LJAD 5JRGB 1AOIB 2HUEC 5JRGC 3A6NB 1P34B 1N1JA 5AVCB 3KWQB 3MGRD 3WAAC 5AV5A 5F99A 5B31B 1P34C 3KWQC 3REJC 1P3IA 3X1SD 4QLCD 1KX4B 4DRBA 3NQUA 1KX5C 3KUYA 1KX4C 4Z2MH 3AZGD 3AN2B 4H9RB 5AV8A 1P3KD 3C1BB 1EQZD 3C1BC 1P3PA 2L5AA 4X23A 5B0ZB 3AV2A 4WU8D 1M18B 4WU9A 5GT0A 5B1MB 4J8XB 3B6GC 5B0ZC 5GT3D 4AWLB 4YM6C 3WA9D 1ZLAD 3REID 4G91B 1P3MC 4XUJC 4R8PC 5CPKD 1N1JB 3V9RA 3X1VD 4G91C 3AZMD 3UTBD 5F99B 3MNNA 3MGQA 1P3GD 2F8NK 3UT9C 3W96B 3AZHC 1P3AD 3REHB 3NQUB 3W96C 3REHC 1P3BC 3KXBA 3C1CA 5AV8B 5JA4A 1M19C 3X1TD 2AROD 4Z5TB 1P3PB 1F66B 4H9SA 4Z5TC 3X1UA 1F66C 4J8VA 1TZYA 4WU9B 5GT0B 3AZND 1P3LD 4KUDC 3MGPD 1H3OA 2NZDD 5BNVA 1KX3C 2YFWA 5FUGB 2BYKA 3AFAD 3AZEC 3LJAA 5KDMA 3AYWD 4EO5C 2PYOB 3MNNB 3WKJD 3AZKC 4LD9B 5GSUD 3B6FC 3WAAD 4LD9C 3TU4A 4QLCA 3B0DB 3AZFB 3LZ1B 3REJD 4Z66D 3KXBB 3AZFC 4WV4B 5B32B 3AZGA 5JA4B 1KX5D 4H9NA 2CV5B 3B0CW 5B2IA 5B1LB 4J8VB 2CV5C 4NE6A 1P3OB 5BT1D 5CP6C 5B1LC 5AV9A 5E5AC 5BNVB 2NQBD 3B6GD 2BYKB 4HGAB 5KDMB 3R45A 3REIA 1ZLAA 3MVDD 4YM6D 3WTPC 3W97A 5CPKA 3MGSC 2YFVA 3LELC 4XUJD 4J8WB 4R8PD 3UTBA 3AZMA 1P3MD 1P3GA 5AVBC 1Q9CA 3TU4B 4ZBJC 3UT9D 3AZHD 3REKA 5AV6C 2F8NG 1P3BD 3LZ0C 3X1TA 1M19D 5B2IB 1HQ3C 3VH5W 4Z5TD 5AV9B 1P3FB 1P3LA 4KUDD 5CPIA 4H9OA 5B40A 3W99C 2NZDA 4NE5A 5DNMB 1P3FC 1M1AB 1KX3D 5DNMC 3AZJA 1M1AC 2CWEA 3AZED 3AYWA 3W97B 2YFVB 4J8UC 3UTAB 1BH9B 3O62A 3WKJA 5GXQC 4XZQB 3RELC 3UTAC 5GSUA 3AZKD 5B2JD 3AZLA 3B6FD 3REKB 3AV1C 4Z66A 3AZFD 1AOIC 3B0CT 4E44A 3A6NC 2F8ND 4KGCD 5AVCC 5B31C 3AZIB 1KU5A 5DNNA 5B24B 3AZIC 5B0YD 5CPIB 1R4VA 5B24C 2NQBA 5CP6D 5E5AD 3AN2C 1ID3A 3AZJB 2FJ7A 1JFIA 3MVDA 4G92B 3WTPD 3O62B 4H9PB 3MGSD 3LELD 4CSRB 1M18C 5B1MC 4J8XC 4AWLC 5AVBD 3W98A 5AV6D 5AY8A 5AV5B 3VH5T 5B31G 3LZ0D 5AV5C 4JJNA 5F99C 1P3IB 5DNNB 1BH8A 1P3IC 3KUYB 1HQ3D 3KUYC 1WWSA 5B33A 4ZUXD 5G49A 3W99D 5AV8C 2FJ7B 1JFIB 1U35A 3VH5A 2HIOA 4X23B 3KSYA 1P3PC 3AV2B 2LY8A 4YS3A 4J8UD 3AV2C 2JSSA 5CPJD 5GXQD 5GT0C 4DRAA 5B2JA 3RELD 3UTAD 4WU9C 3W98B 4WNNA 3AZLB 3AV1D 1S32D 2RVQC 3V9RB 3MGRA 5JRGD 3MGQB 1AOID 4KGCA 2PYOC 4JJNB 3MNNC 3A6ND 3MGQC 1P34D 3X1SA 1BH8B 5AVCD 3KWQD 1HTAA 5B31D 4H9QA 3B0DC 5B0YA 3LZ1C 3C1CB 5B33B 1P3KA 3KXBC 1KX4D 5B32C 3C1CC 5E5AA 1EQZA 1U35B 3AN2D 2HIOB 3X1UB 3C1BD 1B67A 1TZYB 4YS3B 4WU8A 4H9SC 4WZSB 1H3OB 4J8VC 5GT3A 1P3OC 3NQJA 5BO0A 2YFWB 5B0ZD 3WA9A 3LJAB 1M18D 5B1MD 4J8XD 4HGAC 3MGRB 3X1VA 4J8WC 3X1SB 4QLCB 1P3AA 5AV5D 5F99D 3TU4C 4H9QB 1HQ3A 3AZGB 1P3ID 5B32G 3W96D 1P3KB 3REHD 3AZGC 1EQZB 4ZUXA 4H9NB 2AROA 4CAYA 5AV8D 5BS7A 4WU8B 4J8UA 5B2IC 3AZNA 1P3PD 5GT3B 5BNXA 3MGPA 5CPJA 1F66D 5AV9C 3AV2D 3WA9B 3AFAA 4WU9D 5GT0D 3R45B 3REIB 1ZLAB 1S32A 1ZLAC 5CPKB 3X1VB 4KHAA 3AZMB 3UTBB 2RVQD 3W97C 5CPKC 5JRGA 1P3GB 3AZMC 3WAAA 1P34A 2PYOD 4XZQC 2IO5B 3MNND 3KWQA 3MGQD 3REJA 4LD9D 5B31A 5CHLB 3REKC 1KX5A 1KX4A 3LZ1D 3X1TB 3KXBD 5B32D 4CAYB 3C1BA 3AZNB 1P3LB 5BNXB 4H9OB 5B40B 2CV5D 2NZDB 1P3LC 3B6GA 3AFAB 5B1LD 5CPIC 5B0ZA 4J8VD 5B40C 1P3OD 2NZDC 4NE3A 4YM6A 3AYWB 3AZJC 4KHAB 3AYWC 1P3MA 4XUJA 4G92C 4R8PA 3WKJB 3O62C 2BYMA 5GSUB 3WAAB 3WKJC 1A7WA 1B6WA 1F1EA 4J8WD 5GSUC 3REJB
chains in the Genus database with same CATH superfamily
3UT9A 3AZHA 3AZLC 4Z66B 1KX5B 5C3IB 3W96A 3TU4D 4Z66C 3REHA 1P3BA 5C3IC 2F8NH 1ULYA 1M19A 5DNNC 4Z5TA 1F66A 4KUDA 5BT1C 2NQBB 3B6GB 5B2ID 1ID3B 2NQBC 5AV9D 1P3FD 3MVDB 4YM6B 1KX3A 1ID3C 3AZEA 2Y2OA 2FJ7C 5DNMD 3MVDC 5FUGA 1P3MB 1M1AD 4XUJB 4R8PB 2BYMB 4X23C 3W97D 3EPKA 3AZKA 3VH6T 2PYOA 3UT9B 3B6FA 3AZHB 4LD9A 4XZQD 3W98C 1P3BB 3AZFA 3LZ1A 3REKD 5AY8B 1M19B 5B32A 3B0BA 2F8NA 5AY8C 3VH6A 4JJNC 2F2AC 4KUDB 2CV5A 4UPKA 3AZID 5CP6A 2ZY3A 5B1LA 5G49B 1TAFA 1P3OA 5B24D 1KX3B 5B33C 5CPID 5B40D 3AZEB 1U35C 3WTPA 3AZJD 2HIOC 4EO5B 3X1UC 4E45A 3LELA 3MGSA 3AZKB 1TZYC 4YS3C 5B2JB 3O62D 3P5JB 4J8WA 3B6FB 4WNNB 5AVBA 5B2JC 2Y2KA 3AZLD 3LJAC 5AV6A 2JE5A 2F8NB 4KGCB 3MGRC 3LZ0A 4M6BA 4KGCC 1BFMA 3X1SC 4QLCC 5B0YB 5DNND 5CP6B 5B0YC 2Y2LA 1TAFB 5E5AB 4Z2MG 3KUYD 3W99A 1P3KC 1P3FA 1EQZC 5DNMA 1ID3D 3WTPB 1M1AA 2FJ7D 3EG5B 3MGSB 3LELB 4UUZA 2Y2MA 4WU8C 3NQJB 5BO0B 5GXQA 4X23D 3RELA 1BH9A 3UTAA 5GT3C 5AVBB 4ZBJB 4XZQA 3WA9C 3AV1A 5AV6B 3WTPE 3REIC 3F6TA 3W98D 1AOIA 3X1VC 3LZ0B 3UTBC 4NFTA 3A6NA 1P3AB 1P3GC 5AY8D 2RIQA 5AVCA 1P3AC 1HQ3B 3EPLA 2IO5C 4JJND 3VH6W 3AZIA 4ZUXB 3W99B 5B24A 2AROB 4ZUXC 3C1CD 3AN2A 4H9RA 3X1TC 5B33D 1WWIA 2AROC 1U35D 4J8UB 4UUZB 5BS7C 3MGPB 5CPJB 2HIOD 5GXQB 3AZNC 3X1UD 3RELB 3MGPC 5CPJC 4H9PA 1TZYD 4YS3D 1M18A 5B1MA 3AFAC 4CSRA 4J8XA 3AV1B 1S32B 2HUEB 1S32C 3LJAD 5JRGB 1AOIB 2HUEC 5JRGC 3A6NB 1P34B 1N1JA 5AVCB 3KWQB 3MGRD 3H0LC 3WAAC 5AV5A 5F99A 5B31B 1P34C 3AL0C 3KWQC 3REJC 1P3IA 3X1SD 4QLCD 1KX4B 4DRBA 3NQUA 4DQYB 1KX5C 3KUYA 1KX4C 4Z2MH 3AZGD 3AN2B 4H9RB 5AV8A 1P3KD 3C1BB 1EQZD 3C1BC 1P3PA 2L5AA 4X23A 5B0ZB 3AV2A 4WU8D 1M18B 4WU9A 5GT0A 5B1MB 4J8XB 3B6GC 5B0ZC 5GT3D 4AWLB 4YM6C 3WA9D 2Y2QA 1ZLAD 3REID 2G5HC 4G91B 1P3MC 4XUJC 4R8PC 5CPKD 1N1JB 3V9RA 3X1VD 4G91C 3AZMD 3UTBD 5F99B 3MNNA 3MGQA 1P3GD 2F8NK 3UT9C 3W96B 3AZHC 1P3AD 3REHB 3NQUB 3W96C 3REHC 1P3BC 3KXBA 3C1CA 5AV8B 5JA4A 1M19C 3X1TD 2AROD 2FFFB 4Z5TB 1P3PB 1F66B 4H9SA 4Z5TC 3X1UA 1F66C 4J8VA 1TZYA 4WU9B 5GT0B 3AZND 1P3LD 4KUDC 3MGPD 1H3OA 2W8SA 2NZDD 5BNVA 1KX3C 2YFWA 5FUGB 2BYKA 3AFAD 3AZEC 3LJAA 5KDMA 3AYWD 4EO5C 1T3UA 2PYOB 3MNNB 3WKJD 3AZKC 4LD9B 5GSUD 3B6FC 3WAAD 4LD9C 3TU4A 4QLCA 3B0DB 3AZFB 3LZ1B 3REJD 4Z66D 3KXBB 3AZFC 4WV4B 5B32B 3AZGA 5JA4B 1KX5D 3EPHA 2Y2JA 2Y2PA 4H9NA 3EPJA 3A1KA 2CV5B 3B0CW 5B2IA 3A1IA 5B1LB 4J8VB 2CV5C 4NE6A 1P3OB 5BT1D 5CP6C 5B1LC 5AV9A 5E5AC 5BNVB 2NQBD 3B6GD 2BYKB 4HGAB 2Y2NA 5KDMB 3R45A 3REIA 1ZLAA 2VQRA 4YM6D 3MVDD 3WTPC 3W97A 5CPKA 3MGSC 2YFVA 3LELC 4XUJD 4J8WB 4R8PD 3UTBA 3AZMA 1P3MD 2J8PA 2JCHA 2ZY4A 1P3GA 5AVBC 1Q9CA 3TU4B 4ZBJC 3UT9D 2Y2IA 3H0RC 3AZHD 3REKA 1PZRA 5AV6C 2F8NG 1P3BD 3LZ0C 3X1TA 1M19D 5B2IB 1HQ3C 2BG1A 3VH5W 4Z5TD 5AV9B 1P3FB 1P3LA 4KUDD 5CPIA 4H9OA 5B40A 3W99C 2NZDA 4NE5A 5DNMB 1P3FC 1M1AB 2UWXA 1KX3D 5DNMC 3AZJA 1M1AC 2CWEA 3AZED 3AYWA 3W97B 2YFVB 4J8UC 3UTAB 1BH9B 3O62A 3WKJA 5GXQC 4XZQB 3RELC 3UTAC 5GSUA 3AZKD 5B2JD 3AZLA 3B6FD 3REKB 3AV1C 4Z66A 2XD5A 3AZFD 1AOIC 3B0CT 4E44A 3A6NC 2F8ND 4KGCD 5AVCC 5B31C 3AZIB 1KU5A 5DNNA 5B24B 3AZIC 5B0YD 5CPIB 1R4VA 5B24C 2NQBA 5CP6D 3KFUG 5E5AD 3AN2C 1ID3A 3AZJB 2FJ7A 1JFIA 3MVDA 2XD1A 4G92B 3WTPD 3O62B 4H9PB 3MGSD 3LELD 4CSRB 1M18C 5B1MC 4J8XC 4AWLC 5AVBD 3W98A 5AV6D 5AY8A 5AV5B 3VH5T 5B31G 3LZ0D 5AV5C 4JJNA 5F99C 1P3IB 1Z2CB 5DNNB 1BH8A 1P3IC 3KUYB 2DF4C 1HQ3D 3KUYC 1WWSA 5B33A 4ZUXD 5G49A 3W99D 5AV8C 2FJ7B 1JFIB 1U35A 3VH5A 2HIOA 4X23B 3KSYA 1P3PC 3AV2B 3H0MC 2LY8A 4YS3A 4J8UD 3AV2C 2JSSA 5CPJD 2Y2GA 5GXQD 4DRAA 5GT0C 5B2JA 3RELD 3UTAD 4WU9C 3W98B 4WNNA 3AZLB 3AV1D 1S32D 2RVQC 3V9RB 3MGRA 5JRGD 3MGQB 1AOID 4KGCA 2PYOC 4JJNB 3MNNC 3A6ND 3MGQC 2G5IC 3X1SA 1P34D 1BH8B 5AVCD 3KWQD 1HTAA 5B31D 4H9QA 3B0DC 5B0YA 3LZ1C 3C1CB 5B33B 1P3KA 3KXBC 1KX4D 5B32C 3C1CC 5E5AA 3IP4C 1EQZA 1U35B 3AN2D 2HIOB 2DQNC 3X1UB 3C1BD 1B67A 1TZYB 4YS3B 4WU8A 4H9SC 4WZSB 1H3OB 4J8VC 5GT3A 1P3OC 3NQJA 5BO0A 2YFWB 5B0ZD 3WA9A 3LJAB 1M18D 5B1MD 4J8XD 4HGAC 2ZY5A 3MGRB 3X1VA 4J8WC 3X1SB 4QLCB 1P3AA 5AV5D 5F99D 3TU4C 4H9QB 1HQ3A 3AZGB 1P3ID 5B32G 3W96D 1P3KB 3REHD 3AZGC 1EQZB 4ZUXA 4H9NB 2AROA 4CAYA 5AV8D 5BS7A 4WU8B 4J8UA 5B2IC 3AZNA 1P3PD 5GT3B 5BNXA 3MGPA 5CPJA 1F66D 5AV9C 3AV2D 3WA9B 3AFAA 4WU9D 5GT0D 3R45B 3REIB 1ZLAB 1S32A 1ZLAC 5CPKB 3X1VB 4KHAA 3AZMB 3UTBB 2RVQD 3W97C 5CPKC 5JRGA 4WJ3C 1P3GB 3AZMC 3WAAA 1P34A 2PYOD 4XZQC 2IO5B 3MNND 3KWQA 3MGQD 3REJA 4LD9D 5B31A 5CHLB 3REKC 1KX5A 1KX4A 3LZ1D 3X1TB 3KXBD 5B32D 4CAYB 2ZY2A 2ZM5A 3C1BA 3FDDA 3AZNB 1W2EA 1P3LB 5BNXB 4H9OB 5B40B 2CV5D 2NZDB 1P3LC 3B6GA 3AFAB 5B1LD 5CPIC 5B0ZA 4J8VD 5B40C 1P3OD 2Y2HA 2NZDC 4NE3A 4YM6A 3AYWB 3AZJC 4KHAB 3AYWC 1P3MA 4XUJA 4G92C 4R8PA 3WKJB 3O62C 2BYMA 5GSUB 3WAAB 3WKJC 1A7WA 1B6WA 1F1EA 4J8WD 5GSUC 3REJB
chains in the Genus database with same CATH topology
3UT9A 3AZHA 3AZLC 4Z66B 1KX5B 5C3IB 3W96A 3TU4D 4Z66C 3REHA 1P3BA 5C3IC 2F8NH 1ULYA 1M19A 5DNNC 4Z5TA 1F66A 4KUDA 5BT1C 2NQBB 3B6GB 5B2ID 1ID3B 2NQBC 5AV9D 1P3FD 3MVDB 4YM6B 1KX3A 1ID3C 3AZEA 2Y2OA 2FJ7C 5DNMD 3MVDC 5FUGA 1P3MB 1M1AD 4XUJB 4R8PB 2BYMB 4X23C 3W97D 3EPKA 3AZKA 3VH6T 2PYOA 3UT9B 3B6FA 3AZHB 4LD9A 4XZQD 3W98C 1P3BB 3AZFA 3LZ1A 3REKD 5AY8B 1M19B 5B32A 3B0BA 2F8NA 5AY8C 3VH6A 4JJNC 2F2AC 4KUDB 2CV5A 4UPKA 3AZID 5CP6A 2ZY3A 5B1LA 5G49B 1TAFA 1P3OA 5B24D 1KX3B 5B33C 5CPID 5B40D 3AZEB 1U35C 3WTPA 3AZJD 2HIOC 4EO5B 3X1UC 4E45A 3LELA 3MGSA 3AZKB 1TZYC 4YS3C 5B2JB 3O62D 3P5JB 4J8WA 3B6FB 4WNNB 5AVBA 5B2JC 2Y2KA 3AZLD 3LJAC 5AV6A 2JE5A 2F8NB 4KGCB 3MGRC 3LZ0A 4M6BA 4KGCC 1BFMA 3X1SC 4QLCC 5B0YB 5DNND 5CP6B 5B0YC 2Y2LA 1TAFB 5E5AB 4Z2MG 3KUYD 3W99A 1P3KC 1P3FA 1EQZC 5DNMA 1ID3D 3WTPB 1M1AA 2FJ7D 3EG5B 3MGSB 3LELB 4UUZA 2Y2MA 4WU8C 3NQJB 5BO0B 5GXQA 4X23D 3RELA 1BH9A 3UTAA 5GT3C 5AVBB 4ZBJB 4XZQA 3WA9C 3AV1A 5AV6B 3WTPE 3REIC 3F6TA 3W98D 1AOIA 3X1VC 3LZ0B 3UTBC 4NFTA 3A6NA 1P3AB 1P3GC 5AY8D 2RIQA 5AVCA 1P3AC 1HQ3B 3EPLA 2IO5C 4JJND 3VH6W 3AZIA 4ZUXB 3W99B 5B24A 2AROB 4ZUXC 3C1CD 3AN2A 4H9RA 3X1TC 5B33D 1WWIA 2AROC 1U35D 4J8UB 4UUZB 5BS7C 3MGPB 5CPJB 2HIOD 5GXQB 3AZNC 3X1UD 3RELB 3MGPC 5CPJC 4H9PA 1TZYD 4YS3D 1M18A 5B1MA 3AFAC 4CSRA 4J8XA 3AV1B 1S32B 2HUEB 1S32C 3LJAD 5JRGB 1AOIB 2HUEC 5JRGC 3A6NB 1P34B 1N1JA 5AVCB 3KWQB 3MGRD 3H0LC 3WAAC 5AV5A 5F99A 5B31B 1P34C 3AL0C 3KWQC 3REJC 1P3IA 3X1SD 4QLCD 1KX4B 4DRBA 3NQUA 4DQYB 1KX5C 3KUYA 1KX4C 4Z2MH 3AZGD 3AN2B 4H9RB 5AV8A 1P3KD 3C1BB 1EQZD 3C1BC 1P3PA 2L5AA 4X23A 5B0ZB 3AV2A 4WU8D 1M18B 4WU9A 5GT0A 5B1MB 4J8XB 3B6GC 5B0ZC 5GT3D 4AWLB 4YM6C 3WA9D 2Y2QA 1ZLAD 3REID 2G5HC 4G91B 1P3MC 4XUJC 4R8PC 5CPKD 1N1JB 3V9RA 3X1VD 4G91C 3AZMD 3UTBD 5F99B 3MNNA 3MGQA 1P3GD 2F8NK 3UT9C 3W96B 3AZHC 1P3AD 3REHB 3NQUB 3W96C 3REHC 1P3BC 3KXBA 3C1CA 5AV8B 5JA4A 1M19C 3X1TD 2AROD 2FFFB 4Z5TB 1P3PB 1F66B 4H9SA 4Z5TC 3X1UA 1F66C 4J8VA 1TZYA 4WU9B 5GT0B 3AZND 1P3LD 4KUDC 3MGPD 1H3OA 2W8SA 2NZDD 5BNVA 1KX3C 2YFWA 5FUGB 2BYKA 3AFAD 3AZEC 3LJAA 5KDMA 3AYWD 4EO5C 1T3UA 2PYOB 3MNNB 3WKJD 3AZKC 4LD9B 5GSUD 3B6FC 3WAAD 4LD9C 3TU4A 4QLCA 3B0DB 3AZFB 3LZ1B 3REJD 4Z66D 3KXBB 3AZFC 4WV4B 5B32B 3AZGA 5JA4B 1KX5D 3EPHA 2Y2JA 2Y2PA 4H9NA 3EPJA 3A1KA 2CV5B 3B0CW 5B2IA 3A1IA 5B1LB 4J8VB 2CV5C 4NE6A 1P3OB 5BT1D 5CP6C 5B1LC 5AV9A 5E5AC 5BNVB 2NQBD 3B6GD 2BYKB 4HGAB 2Y2NA 5KDMB 3R45A 3REIA 1ZLAA 2VQRA 4YM6D 3MVDD 3WTPC 3W97A 5CPKA 3MGSC 2YFVA 3LELC 4XUJD 4J8WB 4R8PD 3UTBA 3AZMA 1P3MD 2J8PA 2JCHA 2ZY4A 1P3GA 5AVBC 1Q9CA 3TU4B 4ZBJC 3UT9D 2Y2IA 3H0RC 3AZHD 3REKA 1PZRA 5AV6C 2F8NG 1P3BD 3LZ0C 3X1TA 1M19D 5B2IB 1HQ3C 2BG1A 3VH5W 4Z5TD 5AV9B 1P3FB 1P3LA 4KUDD 5CPIA 4H9OA 5B40A 3W99C 2NZDA 4NE5A 5DNMB 1P3FC 1M1AB 2UWXA 1KX3D 5DNMC 3AZJA 1M1AC 2CWEA 3AZED 3AYWA 3W97B 2YFVB 4J8UC 3UTAB 1BH9B 3O62A 3WKJA 5GXQC 4XZQB 3RELC 3UTAC 5GSUA 3AZKD 5B2JD 3AZLA 3B6FD 3REKB 3AV1C 4Z66A 2XD5A 3AZFD 1AOIC 3B0CT 4E44A 3A6NC 2F8ND 4KGCD 5AVCC 5B31C 3AZIB 1KU5A 5DNNA 5B24B 3AZIC 5B0YD 5CPIB 1R4VA 5B24C 2NQBA 5CP6D 3KFUG 5E5AD 3AN2C 1ID3A 3AZJB 2FJ7A 1JFIA 3MVDA 2XD1A 4G92B 3WTPD 3O62B 4H9PB 3MGSD 3LELD 4CSRB 1M18C 5B1MC 4J8XC 4AWLC 5AVBD 3W98A 5AV6D 5AY8A 5AV5B 3VH5T 5B31G 3LZ0D 5AV5C 4JJNA 5F99C 1P3IB 1Z2CB 5DNNB 1BH8A 1P3IC 3KUYB 2DF4C 1HQ3D 3KUYC 1WWSA 5B33A 4ZUXD 5G49A 3W99D 5AV8C 2FJ7B 1JFIB 1U35A 3VH5A 2HIOA 4X23B 3KSYA 1P3PC 3AV2B 3H0MC 2LY8A 4YS3A 4J8UD 3AV2C 2JSSA 5CPJD 2Y2GA 5GXQD 4DRAA 5GT0C 5B2JA 3RELD 3UTAD 4WU9C 3W98B 4WNNA 3AZLB 3AV1D 1S32D 2RVQC 3V9RB 3MGRA 5JRGD 3MGQB 1AOID 4KGCA 2PYOC 4JJNB 3MNNC 3A6ND 3MGQC 2G5IC 3X1SA 1P34D 1BH8B 5AVCD 3KWQD 1HTAA 5B31D 4H9QA 3B0DC 5B0YA 3LZ1C 3C1CB 5B33B 1P3KA 3KXBC 1KX4D 5B32C 3C1CC 5E5AA 3IP4C 1EQZA 1U35B 3AN2D 2HIOB 2DQNC 3X1UB 3C1BD 1B67A 1TZYB 4YS3B 4WU8A 4H9SC 4WZSB 1H3OB 4J8VC 5GT3A 1P3OC 3NQJA 5BO0A 2YFWB 5B0ZD 3WA9A 3LJAB 1M18D 5B1MD 4J8XD 4HGAC 2ZY5A 3MGRB 3X1VA 4J8WC 3X1SB 4QLCB 1P3AA 5AV5D 5F99D 3TU4C 4H9QB 1HQ3A 3AZGB 1P3ID 5B32G 3W96D 1P3KB 3REHD 3AZGC 1EQZB 4ZUXA 4H9NB 2AROA 4CAYA 5AV8D 5BS7A 4WU8B 4J8UA 5B2IC 3AZNA 1P3PD 5GT3B 5BNXA 3MGPA 5CPJA 1F66D 5AV9C 3AV2D 3WA9B 3AFAA 4WU9D 5GT0D 3R45B 3REIB 1ZLAB 1S32A 1ZLAC 5CPKB 3X1VB 4KHAA 3AZMB 3UTBB 2RVQD 3W97C 5CPKC 5JRGA 4WJ3C 1P3GB 3AZMC 3WAAA 1P34A 2PYOD 4XZQC 2IO5B 3MNND 3KWQA 3MGQD 3REJA 4LD9D 5B31A 5CHLB 3REKC 1KX5A 1KX4A 3LZ1D 3X1TB 3KXBD 5B32D 4CAYB 2ZY2A 2ZM5A 3C1BA 3FDDA 3AZNB 1W2EA 1P3LB 5BNXB 4H9OB 5B40B 2CV5D 2NZDB 1P3LC 3B6GA 3AFAB 5B1LD 5CPIC 5B0ZA 4J8VD 5B40C 1P3OD 2Y2HA 2NZDC 4NE3A 4YM6A 3AYWB 3AZJC 4KHAB 3AYWC 1P3MA 4XUJA 4G92C 4R8PA 3WKJB 3O62C 2BYMA 5GSUB 3WAAB 3WKJC 1A7WA 1B6WA 1F1EA 4J8WD 5GSUC 3REJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 A;  3AZH A;  3AZL C;  4Z66 B;  1KX5 B;  5C3I B;  3W96 A;  3TU4 D;  4Z66 C;  3REH A;  1P3B A;  5C3I C;  2F8N H;  1ULY A;  1M19 A;  5DNN C;  4Z5T A;  1F66 A;  4KUD A;  5BT1 C;  2NQB B;  3B6G B;  5B2I D;  1ID3 B;  2NQB C;  5AV9 D;  1P3F D;  3MVD B;  4YM6 B;  1KX3 A;  1ID3 C;  3AZE A;  2FJ7 C;  5DNM D;  3MVD C;  5FUG A;  1P3M B;  1M1A D;  4XUJ B;  4R8P B;  2BYM B;  4X23 C;  3W97 D;  3AZK A;  3VH6 T;  2PYO A;  3UT9 B;  3B6F A;  3AZH B;  4LD9 A;  4XZQ D;  3W98 C;  1P3B B;  3AZF A;  3LZ1 A;  3REK D;  5AY8 B;  1M19 B;  5B32 A;  3B0B A;  2F8N A;  5AY8 C;  3VH6 A;  4JJN C;  4KUD B;  2CV5 A;  3AZI D;  5CP6 A;  5B1L A;  5G49 B;  1TAF A;  1P3O A;  5B24 D;  1KX3 B;  5B33 C;  5CPI D;  5B40 D;  3AZE B;  1U35 C;  3WTP A;  3AZJ D;  2HIO C;  4EO5 B;  3X1U C;  4E45 A;  3LEL A;  3MGS A;  3AZK B;  1TZY C;  4YS3 C;  5B2J B;  3O62 D;  4J8W A;  3B6F B;  4WNN B;  5AVB A;  5B2J C;  3AZL D;  3LJA C;  5AV6 A;  2F8N B;  4KGC B;  3MGR C;  3LZ0 A;  4M6B A;  4KGC C;  1BFM A;  3X1S C;  4QLC C;  5B0Y B;  5DNN D;  5CP6 B;  5B0Y C;  1TAF B;  5E5A B;  4Z2M G;  3KUY D;  3W99 A;  1P3K C;  1P3F A;  1EQZ C;  5DNM A;  1ID3 D;  3WTP B;  1M1A A;  2FJ7 D;  3MGS B;  3LEL B;  4UUZ A;  4WU8 C;  3NQJ B;  5BO0 B;  5GXQ A;  4X23 D;  3REL A;  1BH9 A;  3UTA A;  5GT3 C;  5AVB B;  4ZBJ B;  4XZQ A;  3WA9 C;  3AV1 A;  3WTP E;  5AV6 B;  3REI C;  3W98 D;  1AOI A;  3X1V C;  3LZ0 B;  3UTB C;  4NFT A;  3A6N A;  1P3A B;  1P3G C;  5AY8 D;  5AVC A;  1P3A C;  1HQ3 B;  4JJN D;  2IO5 C;  3VH6 W;  3AZI A;  4ZUX B;  3W99 B;  5B24 A;  2ARO B;  4ZUX C;  3C1C D;  3AN2 A;  4H9R A;  3X1T C;  5B33 D;  1WWI A;  2ARO C;  1U35 D;  4J8U B;  4UUZ B;  5BS7 C;  3MGP B;  5CPJ B;  2HIO D;  5GXQ B;  3AZN C;  3X1U D;  3REL B;  3MGP C;  5CPJ C;  4H9P A;  1TZY D;  4YS3 D;  1M18 A;  5B1M A;  3AFA C;  4CSR A;  4J8X A;  3AV1 B;  1S32 B;  2HUE B;  1S32 C;  3LJA D;  5JRG B;  1AOI B;  2HUE C;  5JRG C;  3A6N B;  1P34 B;  1N1J A;  5AVC B;  3KWQ B;  3MGR D;  3WAA C;  5AV5 A;  5F99 A;  5B31 B;  1P34 C;  3KWQ C;  3REJ C;  1P3I A;  3X1S D;  4QLC D;  1KX4 B;  4DRB A;  3NQU A;  1KX5 C;  3KUY A;  1KX4 C;  4Z2M H;  3AZG D;  3AN2 B;  4H9R B;  5AV8 A;  1P3K D;  3C1B B;  1EQZ D;  3C1B C;  1P3P A;  2L5A A;  4X23 A;  5B0Z B;  3AV2 A;  4WU8 D;  1M18 B;  4WU9 A;  5GT0 A;  5B1M B;  4J8X B;  3B6G C;  5B0Z C;  5GT3 D;  4AWL B;  4YM6 C;  3WA9 D;  1ZLA D;  3REI D;  4G91 B;  1P3M C;  4XUJ C;  4R8P C;  5CPK D;  1N1J B;  3V9R A;  3X1V D;  4G91 C;  3AZM D;  3UTB D;  5F99 B;  3MNN A;  3MGQ A;  1P3G D;  2F8N K;  3UT9 C;  3W96 B;  3AZH C;  1P3A D;  3REH B;  3NQU B;  3W96 C;  3REH C;  1P3B C;  3KXB A;  3C1C A;  5AV8 B;  5JA4 A;  1M19 C;  3X1T D;  2ARO D;  4Z5T B;  1P3P B;  1F66 B;  4H9S A;  4Z5T C;  3X1U A;  1F66 C;  4J8V A;  1TZY A;  4WU9 B;  5GT0 B;  3AZN D;  1P3L D;  4KUD C;  3MGP D;  1H3O A;  2NZD D;  5BNV A;  1KX3 C;  2YFW A;  5FUG B;  2BYK A;  3AFA D;  3AZE C;  3LJA A;  5KDM A;  3AYW D;  4EO5 C;  2PYO B;  3MNN B;  3WKJ D;  3AZK C;  4LD9 B;  5GSU D;  3B6F C;  3WAA D;  4LD9 C;  3TU4 A;  4QLC A;  3B0D B;  3AZF B;  3LZ1 B;  3REJ D;  4Z66 D;  3KXB B;  3AZF C;  4WV4 B;  5B32 B;  3AZG A;  5JA4 B;  1KX5 D;  4H9N A;  2CV5 B;  3B0C W;  5B2I A;  5B1L B;  4J8V B;  2CV5 C;  4NE6 A;  1P3O B;  5BT1 D;  5CP6 C;  5B1L C;  5AV9 A;  5E5A C;  5BNV B;  2NQB D;  3B6G D;  2BYK B;  4HGA B;  5KDM B;  3R45 A;  3REI A;  1ZLA A;  3MVD D;  4YM6 D;  3WTP C;  3W97 A;  5CPK A;  3MGS C;  2YFV A;  3LEL C;  4XUJ D;  4J8W B;  4R8P D;  3UTB A;  3AZM A;  1P3M D;  1P3G A;  5AVB C;  1Q9C A;  3TU4 B;  4ZBJ C;  3UT9 D;  3AZH D;  3REK A;  5AV6 C;  2F8N G;  1P3B D;  3LZ0 C;  3X1T A;  1M19 D;  5B2I B;  1HQ3 C;  3VH5 W;  4Z5T D;  5AV9 B;  1P3F B;  1P3L A;  4KUD D;  5CPI A;  4H9O A;  5B40 A;  3W99 C;  2NZD A;  4NE5 A;  5DNM B;  1P3F C;  1M1A B;  1KX3 D;  5DNM C;  3AZJ A;  1M1A C;  2CWE A;  3AZE D;  3AYW A;  3W97 B;  2YFV B;  4J8U C;  3UTA B;  1BH9 B;  3O62 A;  3WKJ A;  5GXQ C;  4XZQ B;  3REL C;  3UTA C;  5GSU A;  3AZK D;  5B2J D;  3AZL A;  3B6F D;  3REK B;  3AV1 C;  4Z66 A;  3AZF D;  1AOI C;  3B0C T;  4E44 A;  3A6N C;  2F8N D;  4KGC D;  5AVC C;  5B31 C;  3AZI B;  1KU5 A;  5DNN A;  5B24 B;  3AZI C;  5B0Y D;  5CPI B;  1R4V A;  5B24 C;  2NQB A;  5CP6 D;  5E5A D;  3AN2 C;  1ID3 A;  3AZJ B;  2FJ7 A;  1JFI A;  3MVD A;  4G92 B;  3WTP D;  3O62 B;  4H9P B;  3MGS D;  3LEL D;  4CSR B;  1M18 C;  5B1M C;  4J8X C;  4AWL C;  5AVB D;  3W98 A;  5AV6 D;  5AY8 A;  5AV5 B;  3VH5 T;  5B31 G;  3LZ0 D;  5AV5 C;  4JJN A;  5F99 C;  1P3I B;  5DNN B;  1BH8 A;  1P3I C;  3KUY B;  1HQ3 D;  3KUY C;  1WWS A;  5B33 A;  4ZUX D;  5G49 A;  3W99 D;  5AV8 C;  2FJ7 B;  1JFI B;  1U35 A;  3VH5 A;  2HIO A;  4X23 B;  3KSY A;  1P3P C;  3AV2 B;  2LY8 A;  4YS3 A;  4J8U D;  3AV2 C;  2JSS A;  5CPJ D;  5GXQ D;  5GT0 C;  4DRA A;  5B2J A;  3REL D;  3UTA D;  4WU9 C;  3W98 B;  4WNN A;  3AZL B;  3AV1 D;  1S32 D;  2RVQ C;  3V9R B;  3MGR A;  5JRG D;  3MGQ B;  1AOI D;  4KGC A;  2PYO C;  4JJN B;  3MNN C;  3A6N D;  3MGQ C;  1P34 D;  3X1S A;  1BH8 B;  5AVC D;  3KWQ D;  1HTA A;  5B31 D;  4H9Q A;  3B0D C;  5B0Y A;  3LZ1 C;  3C1C B;  5B33 B;  1P3K A;  3KXB C;  1KX4 D;  5B32 C;  3C1C C;  5E5A A;  1EQZ A;  1U35 B;  3AN2 D;  2HIO B;  3X1U B;  3C1B D;  1B67 A;  1TZY B;  4YS3 B;  4WU8 A;  4H9S C;  4WZS B;  1H3O B;  4J8V C;  5GT3 A;  1P3O C;  3NQJ A;  5BO0 A;  2YFW B;  5B0Z D;  3WA9 A;  3LJA B;  1M18 D;  5B1M D;  4J8X D;  4HGA C;  3MGR B;  3X1V A;  4J8W C;  3X1S B;  4QLC B;  1P3A A;  5AV5 D;  5F99 D;  3TU4 C;  4H9Q B;  1HQ3 A;  3AZG B;  1P3I D;  5B32 G;  3W96 D;  1P3K B;  3REH D;  3AZG C;  1EQZ B;  4ZUX A;  4H9N B;  2ARO A;  4CAY A;  5AV8 D;  5BS7 A;  4WU8 B;  4J8U A;  5B2I C;  3AZN A;  1P3P D;  5GT3 B;  5BNX A;  3MGP A;  5CPJ A;  1F66 D;  5AV9 C;  3AV2 D;  3WA9 B;  3AFA A;  4WU9 D;  5GT0 D;  3R45 B;  3REI B;  1ZLA B;  1S32 A;  1ZLA C;  5CPK B;  3X1V B;  4KHA A;  3AZM B;  3UTB B;  2RVQ D;  3W97 C;  5CPK C;  5JRG A;  1P3G B;  3AZM C;  3WAA A;  1P34 A;  2PYO D;  4XZQ C;  2IO5 B;  3MNN D;  3KWQ A;  3MGQ D;  3REJ A;  4LD9 D;  5B31 A;  5CHL B;  3REK C;  1KX5 A;  1KX4 A;  3LZ1 D;  3X1T B;  3KXB D;  5B32 D;  4CAY B;  3C1B A;  3AZN B;  1P3L B;  5BNX B;  4H9O B;  5B40 B;  2CV5 D;  2NZD B;  1P3L C;  3B6G A;  3AFA B;  5B1L D;  5CPI C;  5B0Z A;  4J8V D;  5B40 C;  1P3O D;  2NZD C;  4NE3 A;  4YM6 A;  3AYW B;  3AZJ C;  4KHA B;  3AYW C;  1P3M A;  4XUJ A;  4G92 C;  4R8P A;  3WKJ B;  3O62 C;  2BYM A;  5GSU B;  3WAA B;  3WKJ C;  1A7W A;  1B6W A;  1F1E A;  4J8W D;  5GSU C;  3REJ B; 
#chains in the Genus database with same CATH topology
 3UT9 A;  3AZH A;  3AZL C;  4Z66 B;  1KX5 B;  5C3I B;  3W96 A;  3TU4 D;  4Z66 C;  3REH A;  1P3B A;  5C3I C;  2F8N H;  1ULY A;  1M19 A;  5DNN C;  4Z5T A;  1F66 A;  4KUD A;  5BT1 C;  2NQB B;  3B6G B;  5B2I D;  1ID3 B;  2NQB C;  5AV9 D;  1P3F D;  3MVD B;  4YM6 B;  1KX3 A;  1ID3 C;  3AZE A;  2Y2O A;  2FJ7 C;  5DNM D;  3MVD C;  5FUG A;  1P3M B;  1M1A D;  4XUJ B;  4R8P B;  2BYM B;  4X23 C;  3W97 D;  3EPK A;  3AZK A;  3VH6 T;  2PYO A;  3UT9 B;  3B6F A;  3AZH B;  4LD9 A;  4XZQ D;  3W98 C;  1P3B B;  3AZF A;  3LZ1 A;  3REK D;  5AY8 B;  1M19 B;  5B32 A;  3B0B A;  2F8N A;  5AY8 C;  3VH6 A;  4JJN C;  2F2A C;  4KUD B;  2CV5 A;  4UPK A;  3AZI D;  5CP6 A;  2ZY3 A;  5B1L A;  5G49 B;  1TAF A;  1P3O A;  5B24 D;  1KX3 B;  5B33 C;  5CPI D;  5B40 D;  3AZE B;  1U35 C;  3WTP A;  3AZJ D;  2HIO C;  4EO5 B;  3X1U C;  4E45 A;  3LEL A;  3MGS A;  3AZK B;  1TZY C;  4YS3 C;  5B2J B;  3O62 D;  3P5J B;  4J8W A;  3B6F B;  4WNN B;  5AVB A;  5B2J C;  2Y2K A;  3AZL D;  3LJA C;  5AV6 A;  2JE5 A;  2F8N B;  4KGC B;  3MGR C;  3LZ0 A;  4M6B A;  4KGC C;  1BFM A;  3X1S C;  4QLC C;  5B0Y B;  5DNN D;  5CP6 B;  5B0Y C;  2Y2L A;  1TAF B;  5E5A B;  4Z2M G;  3KUY D;  3W99 A;  1P3K C;  1P3F A;  1EQZ C;  5DNM A;  1ID3 D;  3WTP B;  1M1A A;  2FJ7 D;  3EG5 B;  3MGS B;  3LEL B;  4UUZ A;  2Y2M A;  4WU8 C;  3NQJ B;  5BO0 B;  5GXQ A;  4X23 D;  3REL A;  1BH9 A;  3UTA A;  5GT3 C;  5AVB B;  4ZBJ B;  4XZQ A;  3WA9 C;  3AV1 A;  5AV6 B;  3WTP E;  3REI C;  3F6T A;  3W98 D;  1AOI A;  3X1V C;  3LZ0 B;  3UTB C;  4NFT A;  3A6N A;  1P3A B;  1P3G C;  5AY8 D;  2RIQ A;  5AVC A;  1P3A C;  1HQ3 B;  3EPL A;  2IO5 C;  4JJN D;  3VH6 W;  3AZI A;  4ZUX B;  3W99 B;  5B24 A;  2ARO B;  4ZUX C;  3C1C D;  3AN2 A;  4H9R A;  3X1T C;  5B33 D;  1WWI A;  2ARO C;  1U35 D;  4J8U B;  4UUZ B;  5BS7 C;  3MGP B;  5CPJ B;  2HIO D;  5GXQ B;  3AZN C;  3X1U D;  3REL B;  3MGP C;  5CPJ C;  4H9P A;  1TZY D;  4YS3 D;  1M18 A;  5B1M A;  3AFA C;  4CSR A;  4J8X A;  3AV1 B;  1S32 B;  2HUE B;  1S32 C;  3LJA D;  5JRG B;  1AOI B;  2HUE C;  5JRG C;  3A6N B;  1P34 B;  1N1J A;  5AVC B;  3KWQ B;  3MGR D;  3H0L C;  3WAA C;  5AV5 A;  5F99 A;  5B31 B;  1P34 C;  3AL0 C;  3KWQ C;  3REJ C;  1P3I A;  3X1S D;  4QLC D;  1KX4 B;  4DRB A;  3NQU A;  4DQY B;  1KX5 C;  3KUY A;  1KX4 C;  4Z2M H;  3AZG D;  3AN2 B;  4H9R B;  5AV8 A;  1P3K D;  3C1B B;  1EQZ D;  3C1B C;  1P3P A;  2L5A A;  4X23 A;  5B0Z B;  3AV2 A;  4WU8 D;  1M18 B;  4WU9 A;  5GT0 A;  5B1M B;  4J8X B;  3B6G C;  5B0Z C;  5GT3 D;  4AWL B;  4YM6 C;  3WA9 D;  2Y2Q A;  1ZLA D;  3REI D;  2G5H C;  4G91 B;  1P3M C;  4XUJ C;  4R8P C;  5CPK D;  1N1J B;  3V9R A;  3X1V D;  4G91 C;  3AZM D;  3UTB D;  5F99 B;  3MNN A;  3MGQ A;  1P3G D;  2F8N K;  3UT9 C;  3W96 B;  3AZH C;  1P3A D;  3REH B;  3NQU B;  3W96 C;  3REH C;  1P3B C;  3KXB A;  3C1C A;  5AV8 B;  5JA4 A;  1M19 C;  3X1T D;  2ARO D;  2FFF B;  4Z5T B;  1P3P B;  1F66 B;  4H9S A;  4Z5T C;  3X1U A;  1F66 C;  4J8V A;  1TZY A;  4WU9 B;  5GT0 B;  3AZN D;  1P3L D;  4KUD C;  3MGP D;  1H3O A;  2W8S A;  2NZD D;  5BNV A;  1KX3 C;  2YFW A;  5FUG B;  2BYK A;  3AFA D;  3AZE C;  3LJA A;  5KDM A;  3AYW D;  4EO5 C;  1T3U A;  2PYO B;  3MNN B;  3WKJ D;  3AZK C;  4LD9 B;  5GSU D;  3B6F C;  3WAA D;  4LD9 C;  3TU4 A;  4QLC A;  3B0D B;  3AZF B;  3LZ1 B;  3REJ D;  4Z66 D;  3KXB B;  3AZF C;  4WV4 B;  5B32 B;  3AZG A;  5JA4 B;  1KX5 D;  3EPH A;  2Y2J A;  2Y2P A;  4H9N A;  3EPJ A;  3A1K A;  2CV5 B;  3B0C W;  5B2I A;  3A1I A;  5B1L B;  4J8V B;  2CV5 C;  4NE6 A;  1P3O B;  5BT1 D;  5CP6 C;  5B1L C;  5AV9 A;  5E5A C;  5BNV B;  2NQB D;  3B6G D;  2BYK B;  4HGA B;  2Y2N A;  5KDM B;  3R45 A;  3REI A;  1ZLA A;  2VQR A;  4YM6 D;  3MVD D;  3WTP C;  3W97 A;  5CPK A;  3MGS C;  2YFV A;  3LEL C;  4XUJ D;  4J8W B;  4R8P D;  3UTB A;  3AZM A;  1P3M D;  2J8P A;  2JCH A;  2ZY4 A;  1P3G A;  5AVB C;  1Q9C A;  3TU4 B;  4ZBJ C;  3UT9 D;  2Y2I A;  3H0R C;  3AZH D;  3REK A;  1PZR A;  5AV6 C;  2F8N G;  1P3B D;  3LZ0 C;  3X1T A;  1M19 D;  5B2I B;  1HQ3 C;  2BG1 A;  3VH5 W;  4Z5T D;  5AV9 B;  1P3F B;  1P3L A;  4KUD D;  5CPI A;  4H9O A;  5B40 A;  3W99 C;  2NZD A;  4NE5 A;  5DNM B;  1P3F C;  1M1A B;  2UWX A;  1KX3 D;  5DNM C;  3AZJ A;  1M1A C;  2CWE A;  3AZE D;  3AYW A;  3W97 B;  2YFV B;  4J8U C;  3UTA B;  1BH9 B;  3O62 A;  3WKJ A;  5GXQ C;  4XZQ B;  3REL C;  3UTA C;  5GSU A;  3AZK D;  5B2J D;  3AZL A;  3B6F D;  3REK B;  3AV1 C;  4Z66 A;  2XD5 A;  3AZF D;  1AOI C;  3B0C T;  4E44 A;  3A6N C;  2F8N D;  4KGC D;  5AVC C;  5B31 C;  3AZI B;  1KU5 A;  5DNN A;  5B24 B;  3AZI C;  5B0Y D;  5CPI B;  1R4V A;  5B24 C;  2NQB A;  5CP6 D;  3KFU G;  5E5A D;  3AN2 C;  1ID3 A;  3AZJ B;  2FJ7 A;  1JFI A;  3MVD A;  2XD1 A;  4G92 B;  3WTP D;  3O62 B;  4H9P B;  3MGS D;  3LEL D;  4CSR B;  1M18 C;  5B1M C;  4J8X C;  4AWL C;  5AVB D;  3W98 A;  5AV6 D;  5AY8 A;  5AV5 B;  3VH5 T;  5B31 G;  3LZ0 D;  5AV5 C;  4JJN A;  5F99 C;  1P3I B;  1Z2C B;  5DNN B;  1BH8 A;  1P3I C;  3KUY B;  2DF4 C;  1HQ3 D;  3KUY C;  1WWS A;  5B33 A;  4ZUX D;  5G49 A;  3W99 D;  5AV8 C;  2FJ7 B;  1JFI B;  1U35 A;  3VH5 A;  2HIO A;  4X23 B;  3KSY A;  1P3P C;  3AV2 B;  3H0M C;  2LY8 A;  4YS3 A;  4J8U D;  3AV2 C;  2JSS A;  5CPJ D;  2Y2G A;  5GXQ D;  4DRA A;  5GT0 C;  5B2J A;  3REL D;  3UTA D;  4WU9 C;  3W98 B;  4WNN A;  3AZL B;  3AV1 D;  1S32 D;  2RVQ C;  3V9R B;  3MGR A;  5JRG D;  3MGQ B;  1AOI D;  4KGC A;  2PYO C;  4JJN B;  3MNN C;  3A6N D;  3MGQ C;  2G5I C;  3X1S A;  1P34 D;  1BH8 B;  5AVC D;  3KWQ D;  1HTA A;  5B31 D;  4H9Q A;  3B0D C;  5B0Y A;  3LZ1 C;  3C1C B;  5B33 B;  1P3K A;  3KXB C;  1KX4 D;  5B32 C;  3C1C C;  5E5A A;  3IP4 C;  1EQZ A;  1U35 B;  3AN2 D;  2HIO B;  2DQN C;  3X1U B;  3C1B D;  1B67 A;  1TZY B;  4YS3 B;  4WU8 A;  4H9S C;  4WZS B;  1H3O B;  4J8V C;  5GT3 A;  1P3O C;  3NQJ A;  5BO0 A;  2YFW B;  5B0Z D;  3WA9 A;  3LJA B;  1M18 D;  5B1M D;  4J8X D;  4HGA C;  2ZY5 A;  3MGR B;  3X1V A;  4J8W C;  3X1S B;  4QLC B;  1P3A A;  5AV5 D;  5F99 D;  3TU4 C;  4H9Q B;  1HQ3 A;  3AZG B;  1P3I D;  5B32 G;  3W96 D;  1P3K B;  3REH D;  3AZG C;  1EQZ B;  4ZUX A;  4H9N B;  2ARO A;  4CAY A;  5AV8 D;  5BS7 A;  4WU8 B;  4J8U A;  5B2I C;  3AZN A;  1P3P D;  5GT3 B;  5BNX A;  3MGP A;  5CPJ A;  1F66 D;  5AV9 C;  3AV2 D;  3WA9 B;  3AFA A;  4WU9 D;  5GT0 D;  3R45 B;  3REI B;  1ZLA B;  1S32 A;  1ZLA C;  5CPK B;  3X1V B;  4KHA A;  3AZM B;  3UTB B;  2RVQ D;  3W97 C;  5CPK C;  5JRG A;  4WJ3 C;  1P3G B;  3AZM C;  3WAA A;  1P34 A;  2PYO D;  4XZQ C;  2IO5 B;  3MNN D;  3KWQ A;  3MGQ D;  3REJ A;  4LD9 D;  5B31 A;  5CHL B;  3REK C;  1KX5 A;  1KX4 A;  3LZ1 D;  3X1T B;  3KXB D;  5B32 D;  4CAY B;  2ZY2 A;  2ZM5 A;  3C1B A;  3FDD A;  3AZN B;  1W2E A;  1P3L B;  5BNX B;  4H9O B;  5B40 B;  2CV5 D;  2NZD B;  1P3L C;  3B6G A;  3AFA B;  5B1L D;  5CPI C;  5B0Z A;  4J8V D;  5B40 C;  1P3O D;  2Y2H A;  2NZD C;  4NE3 A;  4YM6 A;  3AYW B;  3AZJ C;  4KHA B;  3AYW C;  1P3M A;  4XUJ A;  4G92 C;  4R8P A;  3WKJ B;  3O62 C;  2BYM A;  5GSU B;  3WAA B;  3WKJ C;  1A7W A;  1B6W A;  1F1E A;  4J8W D;  5GSU C;  3REJ B; 
#chains in the Genus database with same CATH homology
 3UT9 A;  3AZH A;  3AZL C;  4Z66 B;  1KX5 B;  5C3I B;  3W96 A;  3TU4 D;  4Z66 C;  3REH A;  1P3B A;  5C3I C;  2F8N H;  1ULY A;  1M19 A;  5DNN C;  4Z5T A;  1F66 A;  4KUD A;  5BT1 C;  2NQB B;  3B6G B;  5B2I D;  1ID3 B;  2NQB C;  5AV9 D;  1P3F D;  3MVD B;  4YM6 B;  1KX3 A;  1ID3 C;  3AZE A;  2Y2O A;  2FJ7 C;  5DNM D;  3MVD C;  5FUG A;  1P3M B;  1M1A D;  4XUJ B;  4R8P B;  2BYM B;  4X23 C;  3W97 D;  3EPK A;  3AZK A;  3VH6 T;  2PYO A;  3UT9 B;  3B6F A;  3AZH B;  4LD9 A;  4XZQ D;  3W98 C;  1P3B B;  3AZF A;  3LZ1 A;  3REK D;  5AY8 B;  1M19 B;  5B32 A;  3B0B A;  2F8N A;  5AY8 C;  3VH6 A;  4JJN C;  2F2A C;  4KUD B;  2CV5 A;  4UPK A;  3AZI D;  5CP6 A;  2ZY3 A;  5B1L A;  5G49 B;  1TAF A;  1P3O A;  5B24 D;  1KX3 B;  5B33 C;  5CPI D;  5B40 D;  3AZE B;  1U35 C;  3WTP A;  3AZJ D;  2HIO C;  4EO5 B;  3X1U C;  4E45 A;  3LEL A;  3MGS A;  3AZK B;  1TZY C;  4YS3 C;  5B2J B;  3O62 D;  3P5J B;  4J8W A;  3B6F B;  4WNN B;  5AVB A;  5B2J C;  2Y2K A;  3AZL D;  3LJA C;  5AV6 A;  2JE5 A;  2F8N B;  4KGC B;  3MGR C;  3LZ0 A;  4M6B A;  4KGC C;  1BFM A;  3X1S C;  4QLC C;  5B0Y B;  5DNN D;  5CP6 B;  5B0Y C;  2Y2L A;  1TAF B;  5E5A B;  4Z2M G;  3KUY D;  3W99 A;  1P3K C;  1P3F A;  1EQZ C;  5DNM A;  1ID3 D;  3WTP B;  1M1A A;  2FJ7 D;  3EG5 B;  3MGS B;  3LEL B;  4UUZ A;  2Y2M A;  4WU8 C;  3NQJ B;  5BO0 B;  5GXQ A;  4X23 D;  3REL A;  1BH9 A;  3UTA A;  5GT3 C;  5AVB B;  4ZBJ B;  4XZQ A;  3WA9 C;  3AV1 A;  5AV6 B;  3WTP E;  3REI C;  3F6T A;  3W98 D;  1AOI A;  3X1V C;  3LZ0 B;  3UTB C;  4NFT A;  3A6N A;  1P3A B;  1P3G C;  5AY8 D;  2RIQ A;  5AVC A;  1P3A C;  1HQ3 B;  3EPL A;  2IO5 C;  4JJN D;  3VH6 W;  3AZI A;  4ZUX B;  3W99 B;  5B24 A;  2ARO B;  4ZUX C;  3C1C D;  3AN2 A;  4H9R A;  3X1T C;  5B33 D;  1WWI A;  2ARO C;  1U35 D;  4J8U B;  4UUZ B;  5BS7 C;  3MGP B;  5CPJ B;  2HIO D;  5GXQ B;  3AZN C;  3X1U D;  3REL B;  3MGP C;  5CPJ C;  4H9P A;  1TZY D;  4YS3 D;  1M18 A;  5B1M A;  3AFA C;  4CSR A;  4J8X A;  3AV1 B;  1S32 B;  2HUE B;  1S32 C;  3LJA D;  5JRG B;  1AOI B;  2HUE C;  5JRG C;  3A6N B;  1P34 B;  1N1J A;  5AVC B;  3KWQ B;  3MGR D;  3H0L C;  3WAA C;  5AV5 A;  5F99 A;  5B31 B;  1P34 C;  3AL0 C;  3KWQ C;  3REJ C;  1P3I A;  3X1S D;  4QLC D;  1KX4 B;  4DRB A;  3NQU A;  4DQY B;  1KX5 C;  3KUY A;  1KX4 C;  4Z2M H;  3AZG D;  3AN2 B;  4H9R B;  5AV8 A;  1P3K D;  3C1B B;  1EQZ D;  3C1B C;  1P3P A;  2L5A A;  4X23 A;  5B0Z B;  3AV2 A;  4WU8 D;  1M18 B;  4WU9 A;  5GT0 A;  5B1M B;  4J8X B;  3B6G C;  5B0Z C;  5GT3 D;  4AWL B;  4YM6 C;  3WA9 D;  2Y2Q A;  1ZLA D;  3REI D;  2G5H C;  4G91 B;  1P3M C;  4XUJ C;  4R8P C;  5CPK D;  1N1J B;  3V9R A;  3X1V D;  4G91 C;  3AZM D;  3UTB D;  5F99 B;  3MNN A;  3MGQ A;  1P3G D;  2F8N K;  3UT9 C;  3W96 B;  3AZH C;  1P3A D;  3REH B;  3NQU B;  3W96 C;  3REH C;  1P3B C;  3KXB A;  3C1C A;  5AV8 B;  5JA4 A;  1M19 C;  3X1T D;  2ARO D;  2FFF B;  4Z5T B;  1P3P B;  1F66 B;  4H9S A;  4Z5T C;  3X1U A;  1F66 C;  4J8V A;  1TZY A;  4WU9 B;  5GT0 B;  3AZN D;  1P3L D;  4KUD C;  3MGP D;  1H3O A;  2W8S A;  2NZD D;  5BNV A;  1KX3 C;  2YFW A;  5FUG B;  2BYK A;  3AFA D;  3AZE C;  3LJA A;  5KDM A;  3AYW D;  4EO5 C;  1T3U A;  2PYO B;  3MNN B;  3WKJ D;  3AZK C;  4LD9 B;  5GSU D;  3B6F C;  3WAA D;  4LD9 C;  3TU4 A;  4QLC A;  3B0D B;  3AZF B;  3LZ1 B;  3REJ D;  4Z66 D;  3KXB B;  3AZF C;  4WV4 B;  5B32 B;  3AZG A;  5JA4 B;  1KX5 D;  3EPH A;  2Y2J A;  2Y2P A;  4H9N A;  3EPJ A;  3A1K A;  2CV5 B;  3B0C W;  5B2I A;  3A1I A;  5B1L B;  4J8V B;  2CV5 C;  4NE6 A;  1P3O B;  5BT1 D;  5CP6 C;  5B1L C;  5AV9 A;  5E5A C;  5BNV B;  2NQB D;  3B6G D;  2BYK B;  4HGA B;  2Y2N A;  5KDM B;  3R45 A;  3REI A;  1ZLA A;  2VQR A;  4YM6 D;  3MVD D;  3WTP C;  3W97 A;  5CPK A;  3MGS C;  2YFV A;  3LEL C;  4XUJ D;  4J8W B;  4R8P D;  3UTB A;  3AZM A;  1P3M D;  2J8P A;  2JCH A;  2ZY4 A;  1P3G A;  5AVB C;  1Q9C A;  3TU4 B;  4ZBJ C;  3UT9 D;  2Y2I A;  3H0R C;  3AZH D;  3REK A;  1PZR A;  5AV6 C;  2F8N G;  1P3B D;  3LZ0 C;  3X1T A;  1M19 D;  5B2I B;  1HQ3 C;  2BG1 A;  3VH5 W;  4Z5T D;  5AV9 B;  1P3F B;  1P3L A;  4KUD D;  5CPI A;  4H9O A;  5B40 A;  3W99 C;  2NZD A;  4NE5 A;  5DNM B;  1P3F C;  1M1A B;  2UWX A;  1KX3 D;  5DNM C;  3AZJ A;  1M1A C;  2CWE A;  3AZE D;  3AYW A;  3W97 B;  2YFV B;  4J8U C;  3UTA B;  1BH9 B;  3O62 A;  3WKJ A;  5GXQ C;  4XZQ B;  3REL C;  3UTA C;  5GSU A;  3AZK D;  5B2J D;  3AZL A;  3B6F D;  3REK B;  3AV1 C;  4Z66 A;  2XD5 A;  3AZF D;  1AOI C;  3B0C T;  4E44 A;  3A6N C;  2F8N D;  4KGC D;  5AVC C;  5B31 C;  3AZI B;  1KU5 A;  5DNN A;  5B24 B;  3AZI C;  5B0Y D;  5CPI B;  1R4V A;  5B24 C;  2NQB A;  5CP6 D;  3KFU G;  5E5A D;  3AN2 C;  1ID3 A;  3AZJ B;  2FJ7 A;  1JFI A;  3MVD A;  2XD1 A;  4G92 B;  3WTP D;  3O62 B;  4H9P B;  3MGS D;  3LEL D;  4CSR B;  1M18 C;  5B1M C;  4J8X C;  4AWL C;  5AVB D;  3W98 A;  5AV6 D;  5AY8 A;  5AV5 B;  3VH5 T;  5B31 G;  3LZ0 D;  5AV5 C;  4JJN A;  5F99 C;  1P3I B;  1Z2C B;  5DNN B;  1BH8 A;  1P3I C;  3KUY B;  2DF4 C;  1HQ3 D;  3KUY C;  1WWS A;  5B33 A;  4ZUX D;  5G49 A;  3W99 D;  5AV8 C;  2FJ7 B;  1JFI B;  1U35 A;  3VH5 A;  2HIO A;  4X23 B;  3KSY A;  1P3P C;  3AV2 B;  3H0M C;  2LY8 A;  4YS3 A;  4J8U D;  3AV2 C;  2JSS A;  5CPJ D;  2Y2G A;  5GXQ D;  4DRA A;  5GT0 C;  5B2J A;  3REL D;  3UTA D;  4WU9 C;  3W98 B;  4WNN A;  3AZL B;  3AV1 D;  1S32 D;  2RVQ C;  3V9R B;  3MGR A;  5JRG D;  3MGQ B;  1AOI D;  4KGC A;  2PYO C;  4JJN B;  3MNN C;  3A6N D;  3MGQ C;  2G5I C;  3X1S A;  1P34 D;  1BH8 B;  5AVC D;  3KWQ D;  1HTA A;  5B31 D;  4H9Q A;  3B0D C;  5B0Y A;  3LZ1 C;  3C1C B;  5B33 B;  1P3K A;  3KXB C;  1KX4 D;  5B32 C;  3C1C C;  5E5A A;  3IP4 C;  1EQZ A;  1U35 B;  3AN2 D;  2HIO B;  2DQN C;  3X1U B;  3C1B D;  1B67 A;  1TZY B;  4YS3 B;  4WU8 A;  4H9S C;  4WZS B;  1H3O B;  4J8V C;  5GT3 A;  1P3O C;  3NQJ A;  5BO0 A;  2YFW B;  5B0Z D;  3WA9 A;  3LJA B;  1M18 D;  5B1M D;  4J8X D;  4HGA C;  2ZY5 A;  3MGR B;  3X1V A;  4J8W C;  3X1S B;  4QLC B;  1P3A A;  5AV5 D;  5F99 D;  3TU4 C;  4H9Q B;  1HQ3 A;  3AZG B;  1P3I D;  5B32 G;  3W96 D;  1P3K B;  3REH D;  3AZG C;  1EQZ B;  4ZUX A;  4H9N B;  2ARO A;  4CAY A;  5AV8 D;  5BS7 A;  4WU8 B;  4J8U A;  5B2I C;  3AZN A;  1P3P D;  5GT3 B;  5BNX A;  3MGP A;  5CPJ A;  1F66 D;  5AV9 C;  3AV2 D;  3WA9 B;  3AFA A;  4WU9 D;  5GT0 D;  3R45 B;  3REI B;  1ZLA B;  1S32 A;  1ZLA C;  5CPK B;  3X1V B;  4KHA A;  3AZM B;  3UTB B;  2RVQ D;  3W97 C;  5CPK C;  5JRG A;  4WJ3 C;  1P3G B;  3AZM C;  3WAA A;  1P34 A;  2PYO D;  4XZQ C;  2IO5 B;  3MNN D;  3KWQ A;  3MGQ D;  3REJ A;  4LD9 D;  5B31 A;  5CHL B;  3REK C;  1KX5 A;  1KX4 A;  3LZ1 D;  3X1T B;  3KXB D;  5B32 D;  4CAY B;  2ZY2 A;  2ZM5 A;  3C1B A;  3FDD A;  3AZN B;  1W2E A;  1P3L B;  5BNX B;  4H9O B;  5B40 B;  2CV5 D;  2NZD B;  1P3L C;  3B6G A;  3AFA B;  5B1L D;  5CPI C;  5B0Z A;  4J8V D;  5B40 C;  1P3O D;  2Y2H A;  2NZD C;  4NE3 A;  4YM6 A;  3AYW B;  3AZJ C;  4KHA B;  3AYW C;  1P3M A;  4XUJ A;  4G92 C;  4R8P A;  3WKJ B;  3O62 C;  2BYM A;  5GSU B;  3WAA B;  3WKJ C;  1A7W A;  1B6W A;  1F1E A;  4J8W D;  5GSU C;  3REJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...