1KX4B

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4B00
1HQ3C 5GT3C 3WA9A 3REIA 3MGRA 5AV6B 4DRAA 2LY8A 3AZIC 1KX3A 2HIOC 5B0ZB 3AZND 3REHA 3R45B 3C1CC 1P3BD 5FUGB 5CPKA 3AZHD 4KUDD 4WV4B 5AV6C 2PYOC 3REJA 5B0ZC 1A7WA 3KUYB 5B31A 5B32B 3X1SB 1P3LB 3AFAA 5B2ID 3B6FA 1HQ3D 5GT3D 4QLCA 2AROA 5B1MA 1M18B 3NQJA 4ZBJB 3AZID 5GSUB 2HIOD 4ZUXA 3KUYC 5B32C 3C1CD 3X1TA 1P3MB 1M18C 3MVDB 1S32B 3VH6W 2CV5A 2PYOD 5GSUC 3C1BA 3AZLC 5B0ZD 3RELA 3W96B 1ZLAA 3TU4B 1B67A 4H9OA 3MVDC 3X1VA 5AVCA 2NZDB 1BH8B 4EO5B 5GT0B 3AN2A 2YFWA 1ULYA 4J8WC 3KUYD 5B32D 5KDMB 3W96C 5B0YB 3TU4C 5B33A 1ID3A 1M18D 4G91B 5JA4B 3V9RA 5GSUD 3AZLD 2NZDC 4EO5C 3AZMA 1EQZB 4Z2MG 5GT0C 5B0YC 5CHLB 5DNNA 3W98B 4WU8A 5AY8B 3MVDD 5AV8B 3LELB 2NQBA 4J8VA 3KWQA 4XZQB 4J8WD 3B0BA 4J8UD 3W96D 1F66A 3W98C 1P3GA 1R4VA 5AY8C 4YM6B 3LELC 2NZDD 4NE3A 2BYKA 5GT0D 4Z66B 4XZQC 3AZJA 5B0YD 1TZYB 5DNMA 5BO0B 3KXBC 3VH5W 3LZ1B 2F8NG 4YM6C 3AYWC 3WA9B 2JSSA 3WTPE 3MGRB 3UT9A 1KX3B 3W99C 5AV9C 1TZYC 3W98D 1KU5A 3REHB 5AY8D 3LZ1C 3WA9C 3WKJC 5CPKB 3LELD 3MGRC 4XUJA 1M19A 3AZGB 3AZFC 1KX3C 3REJB 4XZQD 3W97A 1P3KA 1P34B 3REHC 3KXBD 1P3OA 3WTPC 3AFAB 3B6FB 5B32G 4YM6D 3AYWD 3MGPB 4QLCB 2AROB 5B1MB 3AZGC 3NQJB 3W99D 5BS7A 5AVBA 4ZUXB 4WU9A 4UUZA 5CP6A 5AV9D 1TZYD 4X23A 2HUEB 1P3AC 3LZ0C 1P34C 3MGQA 3LZ1D 3B6FC 3WAAA 3UTAA 3VH5T 3WA9D 3X1TB 3WKJD 3MGPC 2AROC 3AZFD 1KX3D 3C1BB 2L5AA 4ZUXC 2FJ7A 3RELB 2HUEC 4H9QA 3B6GA 3REHD 1ZLAB 3WTPD 4H9OB 1P3IA 3AZEA 3AZGD 5B40A 3X1VB 5AVCB 3MGSC 3C1BC 4DRBA 3RELC 2YFWB 1P3AD 3B0DC 3LZ0D 1P34D 3B6FD 5B33B 1ID3B 3MGPD 1KX4A 4WZSB 1U35A 5B2JC 3X1VC 5AVCC 3V9RB 3O62A 5CPIB 1M1AB 4ZUXD 3AZKB 3AZMB 5JRGB 5E5AA 3REKA 4NE5A 4LD9A 5B33C 5DNNB 3UTBB 4WU8B 3MGSD 2RVQC 5CPIC 3C1BD 2NQBB 1M1AC 3AZKC 3AZMC 3B0CT 3KWQB 5JRGC 5CPJA 3AV2A 4JJNB 3AV1B 1F66B 5DNNC 3UTBC 1P3GB 5B1LA 5B2JD 3X1VD 2F8ND 2NQBC 3X1SC 1P3LC 4JJNC 5AV6D 3AV1C 4ZBJC 5DNMB 5B33D 5BT1C 1AOIA 4J8UA 5B24B 2RVQD 5CPID 1M1AD 3AZKD 1HTAA 3UT9B 5JRGD 1P3MC 1S32C 3AZNA 5DNND 3UTBD 3NQUA 4YS3A 3VH6A 5B24C 1P3BA 3AZHA 4XUJB 3X1SD 1P3LD 1M19B 2NQBD 4JJND 3AV1D 1BFMA 3W97B 1P3KB 5F99B 5BT1D 4H9PA 1P3OB 2CWEA 5B31G 5B2IA 1HQ3A 5AV5B 1M19C 4XUJC 2IO5B 4WNNA 3AZIA 5G49B 1P3MD 4WU9B 4G91C 4UUZB 5CP6B 1S32D 3W97C 4X23B 4H9SC 5F99C 3VH6T 1EQZC 5B24D 3C1CA 3WAAB 3UTAB 5AV5C 1KX5A 3TU4D 2BYMB 2PYOA 4J8XB 4WU9C 5AV8C 4H9QB 3B6GB 3WAAC 3UTAC 1P3IB 1M19D 4XUJD 4KHAB 4J8XC 3W97D 5F99D 3B6GC 3REIB 3X1UA 1EQZD 4Z66C 5AV5D 1P3IC 1KX4B 1M18A 3O62B 3AZLA 4WU9D 5AV8D 3REIC 3VH5A 4H9NA 3A6NA 3WAAD 1P3FA 4J8XD 4R8PA 5B31B 2YFVA 5CPJB 5CPKC 3AV2B 4J8WA 4Z66D 3REJC 1P3ID 5B1LB 5B31C 2NZDA 3AFAC 4HGAB 4QLCC 3MGRD 3REID 5B1MC 3AV2C 2CV5B 5KDMA 1P3PA 1AOIB 4J8UB 4KGCA 4Z5TA 3X1TC 5CPKD 4HGAC 5BNVA 2CV5C 3REJD 4NFTA 4YS3B 3NQUB 4CSRA 1AOIC 4J8UC 3AN2B 1P3BB 5B31D 3AZHB 3LELA 1ZLAC 4CAYA 3AFAD 1Q9CA 3AV2D 4QLCD 2AROD 5B1MD 4YS3C 3KXBA 4H9PB 3AN2C 1P3BC 3AYWA 1HQ3B 4WNNB 3AZIB 1ID3C 3X1TD 3W99A 1TAFA 2CV5D 5AV9A 4H9RA 1AOID 4J8VB 3MNNA 3RELD 3C1CB 1KX5B 3WKJA 1ZLAD 2F8NK 2PYOB 3AZFA 4WU8C 5AVCD 5GXQA 4YS3D 2BYKB 4J8VC 3AN2D 1JFIA 3KWQC 3WTPA 3LJAA 3AZJB 1KX5C 1BH9A 4Z2MH 3AZGA 1F66C 1ID3D 1P3GC 1P3AA 3LZ0A 1P34A 1F1EA 3X1UB 3AZMD 3AZJC 3MGPA 5DNMC 1B6WA 1N1JA 3AZLB 4WU8D 4KUDA 3X1UC 4J8VD 3UT9C 4H9NB 3A6NB 3KWQD 1KX5D 5BNXA 1F66D 1P3FB 3MGSA 1P3GD 4R8PB 2YFVB 5GT3A 4J8WB 2F8NH 3A6NC 4G92B 5AVBB 3AZJD 2HIOA 1P3KC 5DNMD 5B2JA 1P3FC 3MGQB 4R8PC 2F8NA 1H3OA 1P3OC 2IO5C 4NE6A 3X1UD 5AV6A 3UT9D 4G92C 1P3PB 5BS7C 5AVBC 5CP6C 5B0ZA 2FJ7B 4X23C 4KGCB 4Z5TB 3MGQC 5CPIA 3R45A 1M1AA 3AZKA 5FUGA 5JRGA 3AZEB 5BNVB 5B40B 3A6ND 1P3PC 3UTBA 4CSRB 4KGCC 2FJ7C 1P3KD 4Z5TC 1P3FD 4R8PD 4AWLB 4M6BA 5B32A 4CAYB 3X1SA 3KUYA 1P3LA 1P3OD 4JJNA 3AZEC 1U35B 3AV1A 5B40C 5AVBD 5GSUA 4E45A 3KXBB 5CP6D 4X23D 5E5AB 3MGQD 3AYWB 4AWLC 3REKB 4LD9B 3UTAD 3W99B 1KX4C 1U35C 1P3MA 1TAFB 3MVDA 5AV9B 1S32A 3O62C 1P3PD 4H9RB 4KGCD 3MNNB 2FJ7D 4Z5TD 5B24A 3B6GD 5E5AC 3WKJB 3REKC 4LD9C 3W96A 3TU4A 3AZFB 3AZED 5C3IB 5B40D 5GXQB 1BH8A 3MNNC 5GT0A 1JFIB 3WTPB 5CPJC 4E44A 3LJAB 1BH9B 5B0YA 1KX4D 5B1LC 1U35D 5C3IC 5JA4A 3O62D 4H9SA 5F99A 5GXQC 3LZ0B 1P3AB 3KSYA 1EQZA 5E5AD 3LJAC 5AV5A 3REKD 4LD9D 1WWSA 3AZNB 3W98A 1N1JB 5G49A 5AY8A 5AV8A 4KUDB 3MNND 5CPJD 4XZQA 5BNXB 3AZNC 2BYMA 3MGSB 4J8XA 5B1LD 3B0CW 5B2IB 4YM6A 5GT3B 5GXQD 3AZHC 3B0DB 4KUDC 1WWIA 4Z66A 3LJAD 2HIOB 1TZYA 5B2JB 4KHAA 5BO0A 2F8NB 1H3OB 3LZ1A 5B2IC
chains in the Genus database with same CATH superfamily
1HQ3C 5GT3C 3WA9A 3REIA 1Z2CB 3MGRA 5AV6B 4DRAA 2LY8A 3AZIC 1KX3A 2DF4C 2HIOC 5B0ZB 3AZND 2JE5A 3REHA 3R45B 3C1CC 1P3BD 5FUGB 5CPKA 3AZHD 4KUDD 4WV4B 5AV6C 2PYOC 3REJA 5B0ZC 1A7WA 3KUYB 5B31A 5B32B 3X1SB 1P3LB 3AFAA 2FFFB 5B2ID 3B6FA 1HQ3D 5GT3D 4QLCA 2AROA 5B1MA 2J8PA 1M18B 3NQJA 4ZBJB 3AZID 5GSUB 2HIOD 4ZUXA 3KUYC 5B32C 3C1CD 2Y2OA 3X1TA 1P3MB 1M18C 3MVDB 1S32B 3VH6W 2CV5A 2PYOD 5GSUC 3C1BA 3AZLC 5B0ZD 2BG1A 3RELA 3W96B 1ZLAA 3TU4B 1B67A 4H9OA 3MVDC 3X1VA 5AVCA 2NZDB 1BH8B 4EO5B 5GT0B 3AN2A 2YFWA 1ULYA 4J8WC 3KUYD 5B32D 5KDMB 3W96C 5B0YB 3TU4C 5B33A 1ID3A 1M18D 4G91B 5JA4B 3V9RA 5GSUD 3AZLD 2NZDC 4EO5C 3AZMA 1EQZB 4Z2MG 5GT0C 2DQNC 5B0YC 5CHLB 5DNNA 3W98B 4WU8A 5AY8B 3MVDD 5AV8B 3LELB 2NQBA 4J8VA 3KWQA 4XZQB 4J8WD 3B0BA 4J8UD 3W96D 2ZY4A 1F66A 3W98C 1P3GA 1R4VA 5AY8C 4YM6B 3LELC 2NZDD 4NE3A 2BYKA 5GT0D 4Z66B 4XZQC 3AZJA 5B0YD 1TZYB 5DNMA 5BO0B 3KXBC 3VH5W 3LZ1B 2F8NG 4YM6C 3AYWC 3WA9B 2JSSA 3WTPE 3MGRB 3UT9A 1PZRA 1KX3B 3W99C 5AV9C 1TZYC 3W98D 1KU5A 3REHB 4WJ3C 5AY8D 3LZ1C 3WA9C 3WKJC 5CPKB 3LELD 3MGRC 4XUJA 1M19A 3AZGB 3AZFC 1KX3C 3REJB 4XZQD 2Y2GA 3W97A 1P3KA 1P34B 3REHC 3KXBD 1P3OA 3WTPC 3AFAB 3B6FB 5B32G 4YM6D 3AYWD 3MGPB 4QLCB 2AROB 5B1MB 3AZGC 3NQJB 4UPKA 2ZY3A 3W99D 5BS7A 5AVBA 4ZUXB 4WU9A 4UUZA 5CP6A 5AV9D 1TZYD 4X23A 2HUEB 1P3AC 3LZ0C 1P34C 3MGQA 3LZ1D 3F6TA 3B6FC 3UTAA 3VH5T 3WA9D 2Y2NA 3X1TB 3MGPC 3WKJD 2AROC 3AZFD 1KX3D 3C1BB 2L5AA 4ZUXC 2FJ7A 3RELB 2HUEC 2Y2PA 4H9QA 3REHD 3B6GA 1ZLAB 3WTPD 4H9OB 1P3IA 3FDDA 3AZEA 3AZGD 5B40A 3X1VB 5AVCB 3MGSC 3C1BC 4DRBA 3RELC 2YFWB 1P3AD 3B0DC 3LZ0D 1P34D 3B6FD 5B33B 1ID3B 3MGPD 1KX4A 4WZSB 1U35A 5B2JC 3X1VC 5AVCC 3V9RB 3O62A 5CPIB 1M1AB 4ZUXD 3AZKB 3AZMB 5JRGB 5E5AA 3REKA 4NE5A 4LD9A 5B33C 5DNNB 3UTBB 4WU8B 3WAAA 3MGSD 2RVQC 5CPIC 3C1BD 3H0LC 1M1AC 2NQBB 3AZKC 3AZMC 3B0CT 3KWQB 5JRGC 5CPJA 3AV2A 4JJNB 3AV1B 1F66B 5DNNC 3UTBC 1P3GB 5B1LA 5B2JD 3X1VD 2ZY2A 2F8ND 2NQBC 3X1SC 1P3LC 4JJNC 5AV6D 2VQRA 3AV1C 4ZBJC 5DNMB 5B33D 3EPLA 5BT1C 1AOIA 4J8UA 5B24B 2RVQD 5CPID 1M1AD 3AZKD 2W8SA 1HTAA 3UT9B 5JRGD 1P3MC 1S32C 3AZNA 5DNND 3UTBD 3NQUA 4YS3A 3VH6A 5B24C 1P3BA 3AZHA 4XUJB 3X1SD 1P3LD 1M19B 2NQBD 3IP4C 4JJND 2Y2KA 3AV1D 1BFMA 3W97B 1P3KB 5F99B 5BT1D 4H9PA 1P3OB 2CWEA 5B31G 5B2IA 1HQ3A 5AV5B 1M19C 4XUJC 2IO5B 4WNNA 3AZIA 3A1KA 5G49B 1P3MD 4WU9B 4G91C 4UUZB 5CP6B 2XD1A 1S32D 4X23B 4H9SC 5F99C 3VH6T 3W97C 1EQZC 5B24D 3C1CA 3WAAB 3UTAB 5AV5C 1KX5A 3TU4D 2BYMB 2PYOA 2JCHA 4J8XB 4WU9C 5AV8C 4H9QB 3B6GB 3WAAC 3UTAC 1P3IB 1M19D 4XUJD 4KHAB 4J8XC 3W97D 3EG5B 5F99D 3B6GC 3REIB 3X1UA 1EQZD 4Z66C 5AV5D 1P3IC 1KX4B 1M18A 3O62B 3AZLA 4WU9D 5AV8D 3REIC 3VH5A 4H9NA 3A6NA 3WAAD 3KFUG 1P3FA 4J8XD 4R8PA 5B31B 2YFVA 5CPJB 2Y2IA 3AV2B 5CPKC 3EPHA 4J8WA 4Z66D 3REJC 1P3ID 5B1LB 5B31C 2G5HC 3AFAC 2NZDA 4HGAB 4QLCC 3MGRD 3REID 5B1MC 3AV2C 2CV5B 5KDMA 1P3PA 1AOIB 4J8UB 4KGCA 4Z5TA 2Y2JA 2ZM5A 3X1TC 5CPKD 4HGAC 5BNVA 2CV5C 3REJD 4NFTA 1T3UA 4YS3B 3NQUB 4CSRA 1AOIC 4J8UC 3AN2B 1P3BB 5B31D 3AZHB 3LELA 1ZLAC 4CAYA 3AFAD 1Q9CA 3AV2D 4QLCD 2AROD 5B1MD 4YS3C 3EPKA 3KXBA 4H9PB 3AN2C 1P3BC 3AYWA 1HQ3B 4WNNB 3AZIB 1ID3C 3X1TD 3W99A 1TAFA 2CV5D 5AV9A 2F2AC 4H9RA 1AOID 4J8VB 3MNNA 3RELD 3C1CB 3EPJA 1KX5B 3WKJA 1ZLAD 2F8NK 2PYOB 3AZFA 4WU8C 5AVCD 5GXQA 4YS3D 2BYKB 4J8VC 3AN2D 1JFIA 3KWQC 3WTPA 3LJAA 3AZJB 1KX5C 1BH9A 4Z2MH 3AZGA 1F66C 1ID3D 1P3GC 2Y2LA 3H0RC 1P3AA 3LZ0A 1P34A 1F1EA 3X1UB 3AZMD 3AZJC 3MGPA 3P5JB 5DNMC 1B6WA 1N1JA 3AZLB 4WU8D 4KUDA 3X1UC 4J8VD 3UT9C 4H9NB 3A6NB 3KWQD 1KX5D 5BNXA 1F66D 1P3FB 3MGSA 1P3GD 4R8PB 4DQYB 2YFVB 5GT3A 4J8WB 2F8NH 3A6NC 4G92B 5AVBB 3AZJD 2HIOA 1P3KC 5DNMD 5B2JA 1P3FC 3MGQB 1H3OB 4R8PC 2F8NA 1H3OA 1P3OC 3AL0C 2IO5C 4NE6A 3X1UD 5AV6A 3UT9D 4G92C 1P3PB 5BS7C 5AVBC 5CP6C 5B0ZA 2FJ7B 4X23C 4KGCB 4Z5TB 3MGQC 5CPIA 3R45A 1M1AA 3AZKA 5FUGA 5JRGA 3AZEB 5BNVB 5B40B 3A6ND 1P3PC 3UTBA 4CSRB 4KGCC 2Y2HA 2FJ7C 2XD5A 1P3KD 4Z5TC 1P3FD 2G5IC 4R8PD 4AWLB 4M6BA 5B32A 4CAYB 3X1SA 3KUYA 1P3LA 1P3OD 4JJNA 3AZEC 1U35B 3AV1A 5B40C 5AVBD 5GSUA 4E45A 3KXBB 5CP6D 4X23D 5E5AB 3MGQD 3AYWB 4AWLC 3REKB 4LD9B 3UTAD 3W99B 1KX4C 1U35C 1P3MA 1TAFB 3MVDA 5AV9B 1S32A 3O62C 1P3PD 4H9RB 4KGCD 3MNNB 2FJ7D 4Z5TD 5B24A 3B6GD 5E5AC 3WKJB 2ZY5A 3REKC 4LD9C 3W96A 3TU4A 3AZFB 3AZED 5C3IB 5B40D 5GXQB 1BH8A 3MNNC 5GT0A 1JFIB 3WTPB 5CPJC 4E44A 3LJAB 1BH9B 5B0YA 1KX4D 5B1LC 1U35D 5C3IC 5JA4A 3O62D 4H9SA 5F99A 5GXQC 3LZ0B 1P3AB 3KSYA 2Y2MA 1EQZA 5E5AD 3LJAC 5AV5A 3REKD 2RIQA 4LD9D 1WWSA 3AZNB 2UWXA 3W98A 1N1JB 5G49A 5AY8A 5AV8A 4KUDB 3MNND 1W2EA 5CPJD 4XZQA 5BNXB 3AZNC 2BYMA 3MGSB 4J8XA 3H0MC 3B0CW 5B1LD 5B2IB 4YM6A 5GT3B 5GXQD 3AZHC 3B0DB 4KUDC 1WWIA 4Z66A 2Y2QA 3LJAD 2HIOB 1TZYA 5B2JB 4KHAA 5BO0A 2F8NB 3A1IA 3LZ1A 5B2IC
chains in the Genus database with same CATH topology
1HQ3C 5GT3C 3WA9A 3REIA 1Z2CB 3MGRA 5AV6B 4DRAA 2LY8A 3AZIC 1KX3A 2DF4C 2HIOC 5B0ZB 3AZND 2JE5A 3REHA 3R45B 3C1CC 1P3BD 5FUGB 5CPKA 3AZHD 4KUDD 4WV4B 5AV6C 2PYOC 3REJA 5B0ZC 1A7WA 3KUYB 5B31A 5B32B 3X1SB 1P3LB 3AFAA 2FFFB 5B2ID 3B6FA 1HQ3D 5GT3D 4QLCA 2AROA 5B1MA 2J8PA 1M18B 3NQJA 4ZBJB 3AZID 5GSUB 2HIOD 4ZUXA 3KUYC 5B32C 3C1CD 2Y2OA 3X1TA 1P3MB 1M18C 3MVDB 1S32B 3VH6W 2CV5A 2PYOD 5GSUC 3C1BA 3AZLC 5B0ZD 2BG1A 3RELA 3W96B 1ZLAA 3TU4B 1B67A 4H9OA 3MVDC 3X1VA 5AVCA 2NZDB 1BH8B 4EO5B 5GT0B 3AN2A 2YFWA 1ULYA 4J8WC 3KUYD 5B32D 5KDMB 3W96C 5B0YB 3TU4C 5B33A 1ID3A 1M18D 4G91B 5JA4B 3V9RA 5GSUD 3AZLD 2NZDC 4EO5C 3AZMA 1EQZB 4Z2MG 5GT0C 2DQNC 5B0YC 5CHLB 5DNNA 3W98B 4WU8A 5AY8B 3MVDD 5AV8B 3LELB 2NQBA 4J8VA 3KWQA 4XZQB 4J8WD 3B0BA 4J8UD 3W96D 2ZY4A 1F66A 3W98C 1P3GA 1R4VA 5AY8C 4YM6B 3LELC 2NZDD 4NE3A 2BYKA 5GT0D 4Z66B 4XZQC 3AZJA 5B0YD 1TZYB 5DNMA 5BO0B 3KXBC 3VH5W 3LZ1B 2F8NG 4YM6C 3AYWC 3WA9B 2JSSA 3WTPE 3MGRB 3UT9A 1PZRA 1KX3B 3W99C 5AV9C 1TZYC 3W98D 1KU5A 3REHB 4WJ3C 5AY8D 3LZ1C 3WA9C 3WKJC 5CPKB 3LELD 3MGRC 4XUJA 1M19A 3AZGB 3AZFC 1KX3C 3REJB 4XZQD 2Y2GA 3W97A 1P3KA 1P34B 3REHC 3KXBD 1P3OA 3WTPC 3AFAB 3B6FB 5B32G 4YM6D 3AYWD 3MGPB 4QLCB 2AROB 5B1MB 3AZGC 3NQJB 4UPKA 2ZY3A 3W99D 5BS7A 5AVBA 4ZUXB 4WU9A 4UUZA 5CP6A 5AV9D 1TZYD 4X23A 2HUEB 1P3AC 3LZ0C 1P34C 3MGQA 3LZ1D 3F6TA 3B6FC 3UTAA 3VH5T 3WA9D 2Y2NA 3X1TB 3MGPC 3WKJD 2AROC 3AZFD 1KX3D 3C1BB 2L5AA 4ZUXC 2FJ7A 3RELB 2HUEC 2Y2PA 4H9QA 3REHD 3B6GA 1ZLAB 3WTPD 4H9OB 1P3IA 3FDDA 3AZEA 3AZGD 5B40A 3X1VB 5AVCB 3MGSC 3C1BC 4DRBA 3RELC 2YFWB 1P3AD 3B0DC 3LZ0D 1P34D 3B6FD 5B33B 1ID3B 3MGPD 1KX4A 4WZSB 1U35A 5B2JC 3X1VC 5AVCC 3V9RB 3O62A 5CPIB 1M1AB 4ZUXD 3AZKB 3AZMB 5JRGB 5E5AA 3REKA 4NE5A 4LD9A 5B33C 5DNNB 3UTBB 4WU8B 3WAAA 3MGSD 2RVQC 5CPIC 3C1BD 3H0LC 1M1AC 2NQBB 3AZKC 3AZMC 3B0CT 3KWQB 5JRGC 5CPJA 3AV2A 4JJNB 3AV1B 1F66B 5DNNC 3UTBC 1P3GB 5B1LA 5B2JD 3X1VD 2ZY2A 2F8ND 2NQBC 3X1SC 1P3LC 4JJNC 5AV6D 2VQRA 3AV1C 4ZBJC 5DNMB 5B33D 3EPLA 5BT1C 1AOIA 4J8UA 5B24B 2RVQD 5CPID 1M1AD 3AZKD 2W8SA 1HTAA 3UT9B 5JRGD 1P3MC 1S32C 3AZNA 5DNND 3UTBD 3NQUA 4YS3A 3VH6A 5B24C 1P3BA 3AZHA 4XUJB 3X1SD 1P3LD 1M19B 2NQBD 3IP4C 4JJND 2Y2KA 3AV1D 1BFMA 3W97B 1P3KB 5F99B 5BT1D 4H9PA 1P3OB 2CWEA 5B31G 5B2IA 1HQ3A 5AV5B 1M19C 4XUJC 2IO5B 4WNNA 3AZIA 3A1KA 5G49B 1P3MD 4WU9B 4G91C 4UUZB 5CP6B 2XD1A 1S32D 4X23B 4H9SC 5F99C 3VH6T 3W97C 1EQZC 5B24D 3C1CA 3WAAB 3UTAB 5AV5C 1KX5A 3TU4D 2BYMB 2PYOA 2JCHA 4J8XB 4WU9C 5AV8C 4H9QB 3B6GB 3WAAC 3UTAC 1P3IB 1M19D 4XUJD 4KHAB 4J8XC 3W97D 3EG5B 5F99D 3B6GC 3REIB 3X1UA 1EQZD 4Z66C 5AV5D 1P3IC 1KX4B 1M18A 3O62B 3AZLA 4WU9D 5AV8D 3REIC 3VH5A 4H9NA 3A6NA 3WAAD 3KFUG 1P3FA 4J8XD 4R8PA 5B31B 2YFVA 5CPJB 2Y2IA 3AV2B 5CPKC 3EPHA 4J8WA 4Z66D 3REJC 1P3ID 5B1LB 5B31C 2G5HC 3AFAC 2NZDA 4HGAB 4QLCC 3MGRD 3REID 5B1MC 3AV2C 2CV5B 5KDMA 1P3PA 1AOIB 4J8UB 4KGCA 4Z5TA 2Y2JA 2ZM5A 3X1TC 5CPKD 4HGAC 5BNVA 2CV5C 3REJD 4NFTA 1T3UA 4YS3B 3NQUB 4CSRA 1AOIC 4J8UC 3AN2B 1P3BB 5B31D 3AZHB 3LELA 1ZLAC 4CAYA 3AFAD 1Q9CA 3AV2D 4QLCD 2AROD 5B1MD 4YS3C 3EPKA 3KXBA 4H9PB 3AN2C 1P3BC 3AYWA 1HQ3B 4WNNB 3AZIB 1ID3C 3X1TD 3W99A 1TAFA 2CV5D 5AV9A 2F2AC 4H9RA 1AOID 4J8VB 3MNNA 3RELD 3C1CB 3EPJA 1KX5B 3WKJA 1ZLAD 2F8NK 2PYOB 3AZFA 4WU8C 5AVCD 5GXQA 4YS3D 2BYKB 4J8VC 3AN2D 1JFIA 3KWQC 3WTPA 3LJAA 3AZJB 1KX5C 1BH9A 4Z2MH 3AZGA 1F66C 1ID3D 1P3GC 2Y2LA 3H0RC 1P3AA 3LZ0A 1P34A 1F1EA 3X1UB 3AZMD 3AZJC 3MGPA 3P5JB 5DNMC 1B6WA 1N1JA 3AZLB 4WU8D 4KUDA 3X1UC 4J8VD 3UT9C 4H9NB 3A6NB 3KWQD 1KX5D 5BNXA 1F66D 1P3FB 3MGSA 1P3GD 4R8PB 4DQYB 2YFVB 5GT3A 4J8WB 2F8NH 3A6NC 4G92B 5AVBB 3AZJD 2HIOA 1P3KC 5DNMD 5B2JA 1P3FC 3MGQB 1H3OB 4R8PC 2F8NA 1H3OA 1P3OC 3AL0C 2IO5C 4NE6A 3X1UD 5AV6A 3UT9D 4G92C 1P3PB 5BS7C 5AVBC 5CP6C 5B0ZA 2FJ7B 4X23C 4KGCB 4Z5TB 3MGQC 5CPIA 3R45A 1M1AA 3AZKA 5FUGA 5JRGA 3AZEB 5BNVB 5B40B 3A6ND 1P3PC 3UTBA 4CSRB 4KGCC 2Y2HA 2FJ7C 2XD5A 1P3KD 4Z5TC 1P3FD 2G5IC 4R8PD 4AWLB 4M6BA 5B32A 4CAYB 3X1SA 3KUYA 1P3LA 1P3OD 4JJNA 3AZEC 1U35B 3AV1A 5B40C 5AVBD 5GSUA 4E45A 3KXBB 5CP6D 4X23D 5E5AB 3MGQD 3AYWB 4AWLC 3REKB 4LD9B 3UTAD 3W99B 1KX4C 1U35C 1P3MA 1TAFB 3MVDA 5AV9B 1S32A 3O62C 1P3PD 4H9RB 4KGCD 3MNNB 2FJ7D 4Z5TD 5B24A 3B6GD 5E5AC 3WKJB 2ZY5A 3REKC 4LD9C 3W96A 3TU4A 3AZFB 3AZED 5C3IB 5B40D 5GXQB 1BH8A 3MNNC 5GT0A 1JFIB 3WTPB 5CPJC 4E44A 3LJAB 1BH9B 5B0YA 1KX4D 5B1LC 1U35D 5C3IC 5JA4A 3O62D 4H9SA 5F99A 5GXQC 3LZ0B 1P3AB 3KSYA 2Y2MA 1EQZA 5E5AD 3LJAC 5AV5A 3REKD 2RIQA 4LD9D 1WWSA 3AZNB 2UWXA 3W98A 1N1JB 5G49A 5AY8A 5AV8A 4KUDB 3MNND 1W2EA 5CPJD 4XZQA 5BNXB 3AZNC 2BYMA 3MGSB 4J8XA 3H0MC 3B0CW 5B1LD 5B2IB 4YM6A 5GT3B 5GXQD 3AZHC 3B0DB 4KUDC 1WWIA 4Z66A 2Y2QA 3LJAD 2HIOB 1TZYA 5B2JB 4KHAA 5BO0A 2F8NB 3A1IA 3LZ1A 5B2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 C;  5GT3 C;  3WA9 A;  3REI A;  3MGR A;  5AV6 B;  4DRA A;  2LY8 A;  3AZI C;  1KX3 A;  2HIO C;  5B0Z B;  3AZN D;  3REH A;  3R45 B;  3C1C C;  1P3B D;  5FUG B;  5CPK A;  3AZH D;  4KUD D;  4WV4 B;  5AV6 C;  2PYO C;  3REJ A;  5B0Z C;  1A7W A;  3KUY B;  5B31 A;  5B32 B;  3X1S B;  1P3L B;  3AFA A;  5B2I D;  3B6F A;  1HQ3 D;  5GT3 D;  4QLC A;  2ARO A;  5B1M A;  1M18 B;  3NQJ A;  4ZBJ B;  3AZI D;  5GSU B;  2HIO D;  4ZUX A;  3KUY C;  5B32 C;  3C1C D;  3X1T A;  1P3M B;  1M18 C;  3MVD B;  1S32 B;  3VH6 W;  2CV5 A;  2PYO D;  5GSU C;  3C1B A;  3AZL C;  5B0Z D;  3REL A;  3W96 B;  1ZLA A;  3TU4 B;  1B67 A;  4H9O A;  3MVD C;  3X1V A;  5AVC A;  2NZD B;  1BH8 B;  4EO5 B;  5GT0 B;  3AN2 A;  2YFW A;  1ULY A;  4J8W C;  3KUY D;  5B32 D;  5KDM B;  3W96 C;  5B0Y B;  3TU4 C;  5B33 A;  1ID3 A;  1M18 D;  4G91 B;  5JA4 B;  3V9R A;  5GSU D;  3AZL D;  2NZD C;  4EO5 C;  3AZM A;  1EQZ B;  4Z2M G;  5GT0 C;  5B0Y C;  5CHL B;  5DNN A;  3W98 B;  4WU8 A;  5AY8 B;  3MVD D;  5AV8 B;  3LEL B;  2NQB A;  4J8V A;  3KWQ A;  4XZQ B;  4J8W D;  3B0B A;  4J8U D;  3W96 D;  1F66 A;  3W98 C;  1P3G A;  1R4V A;  5AY8 C;  4YM6 B;  3LEL C;  2NZD D;  4NE3 A;  2BYK A;  5GT0 D;  4Z66 B;  4XZQ C;  3AZJ A;  5B0Y D;  1TZY B;  5DNM A;  5BO0 B;  3KXB C;  3VH5 W;  3LZ1 B;  2F8N G;  4YM6 C;  3AYW C;  3WA9 B;  2JSS A;  3WTP E;  3MGR B;  3UT9 A;  1KX3 B;  3W99 C;  5AV9 C;  1TZY C;  3W98 D;  1KU5 A;  3REH B;  5AY8 D;  3LZ1 C;  3WA9 C;  3WKJ C;  5CPK B;  3LEL D;  3MGR C;  4XUJ A;  1M19 A;  3AZG B;  3AZF C;  1KX3 C;  3REJ B;  4XZQ D;  3W97 A;  1P3K A;  1P34 B;  3REH C;  3KXB D;  1P3O A;  3WTP C;  3AFA B;  3B6F B;  5B32 G;  4YM6 D;  3AYW D;  3MGP B;  4QLC B;  2ARO B;  5B1M B;  3AZG C;  3NQJ B;  3W99 D;  5BS7 A;  5AVB A;  4ZUX B;  4WU9 A;  4UUZ A;  5CP6 A;  5AV9 D;  1TZY D;  4X23 A;  2HUE B;  1P3A C;  3LZ0 C;  1P34 C;  3MGQ A;  3LZ1 D;  3B6F C;  3WAA A;  3UTA A;  3VH5 T;  3WA9 D;  3X1T B;  3WKJ D;  3MGP C;  2ARO C;  3AZF D;  1KX3 D;  3C1B B;  2L5A A;  4ZUX C;  2FJ7 A;  3REL B;  2HUE C;  4H9Q A;  3B6G A;  3REH D;  1ZLA B;  3WTP D;  4H9O B;  1P3I A;  3AZE A;  3AZG D;  5B40 A;  3X1V B;  5AVC B;  3MGS C;  3C1B C;  4DRB A;  3REL C;  2YFW B;  1P3A D;  3B0D C;  3LZ0 D;  1P34 D;  3B6F D;  5B33 B;  1ID3 B;  3MGP D;  1KX4 A;  4WZS B;  1U35 A;  5B2J C;  3X1V C;  5AVC C;  3V9R B;  3O62 A;  5CPI B;  1M1A B;  4ZUX D;  3AZK B;  3AZM B;  5JRG B;  5E5A A;  3REK A;  4NE5 A;  4LD9 A;  5B33 C;  5DNN B;  3UTB B;  4WU8 B;  3MGS D;  2RVQ C;  5CPI C;  3C1B D;  2NQB B;  1M1A C;  3AZK C;  3AZM C;  3B0C T;  3KWQ B;  5JRG C;  5CPJ A;  3AV2 A;  4JJN B;  3AV1 B;  1F66 B;  5DNN C;  3UTB C;  1P3G B;  5B1L A;  5B2J D;  3X1V D;  2F8N D;  2NQB C;  3X1S C;  1P3L C;  4JJN C;  5AV6 D;  3AV1 C;  4ZBJ C;  5DNM B;  5B33 D;  5BT1 C;  1AOI A;  4J8U A;  5B24 B;  2RVQ D;  5CPI D;  1M1A D;  3AZK D;  1HTA A;  3UT9 B;  5JRG D;  1P3M C;  1S32 C;  3AZN A;  5DNN D;  3UTB D;  3NQU A;  4YS3 A;  3VH6 A;  5B24 C;  1P3B A;  3AZH A;  4XUJ B;  3X1S D;  1P3L D;  1M19 B;  2NQB D;  4JJN D;  3AV1 D;  1BFM A;  3W97 B;  1P3K B;  5F99 B;  5BT1 D;  4H9P A;  1P3O B;  2CWE A;  5B31 G;  5B2I A;  1HQ3 A;  5AV5 B;  1M19 C;  4XUJ C;  2IO5 B;  4WNN A;  3AZI A;  5G49 B;  1P3M D;  4WU9 B;  4G91 C;  4UUZ B;  5CP6 B;  1S32 D;  3W97 C;  4X23 B;  4H9S C;  5F99 C;  3VH6 T;  1EQZ C;  5B24 D;  3C1C A;  3WAA B;  3UTA B;  5AV5 C;  1KX5 A;  3TU4 D;  2BYM B;  2PYO A;  4J8X B;  4WU9 C;  5AV8 C;  4H9Q B;  3B6G B;  3WAA C;  3UTA C;  1P3I B;  1M19 D;  4XUJ D;  4KHA B;  4J8X C;  3W97 D;  5F99 D;  3B6G C;  3REI B;  3X1U A;  1EQZ D;  4Z66 C;  5AV5 D;  1P3I C;  1KX4 B;  1M18 A;  3O62 B;  3AZL A;  4WU9 D;  5AV8 D;  3REI C;  3VH5 A;  4H9N A;  3A6N A;  3WAA D;  1P3F A;  4J8X D;  4R8P A;  5B31 B;  2YFV A;  5CPJ B;  5CPK C;  3AV2 B;  4J8W A;  4Z66 D;  3REJ C;  1P3I D;  5B1L B;  5B31 C;  2NZD A;  3AFA C;  4HGA B;  4QLC C;  3MGR D;  3REI D;  5B1M C;  3AV2 C;  2CV5 B;  5KDM A;  1P3P A;  1AOI B;  4J8U B;  4KGC A;  4Z5T A;  3X1T C;  5CPK D;  4HGA C;  5BNV A;  2CV5 C;  3REJ D;  4NFT A;  4YS3 B;  3NQU B;  4CSR A;  1AOI C;  4J8U C;  3AN2 B;  1P3B B;  5B31 D;  3AZH B;  3LEL A;  1ZLA C;  4CAY A;  3AFA D;  1Q9C A;  3AV2 D;  4QLC D;  2ARO D;  5B1M D;  4YS3 C;  3KXB A;  4H9P B;  3AN2 C;  1P3B C;  3AYW A;  1HQ3 B;  4WNN B;  3AZI B;  1ID3 C;  3X1T D;  3W99 A;  1TAF A;  2CV5 D;  5AV9 A;  4H9R A;  1AOI D;  4J8V B;  3MNN A;  3REL D;  3C1C B;  1KX5 B;  3WKJ A;  1ZLA D;  2F8N K;  2PYO B;  3AZF A;  4WU8 C;  5AVC D;  5GXQ A;  4YS3 D;  2BYK B;  4J8V C;  3AN2 D;  1JFI A;  3KWQ C;  3WTP A;  3LJA A;  3AZJ B;  1KX5 C;  1BH9 A;  4Z2M H;  3AZG A;  1F66 C;  1ID3 D;  1P3G C;  1P3A A;  3LZ0 A;  1P34 A;  1F1E A;  3X1U B;  3AZM D;  3AZJ C;  3MGP A;  5DNM C;  1B6W A;  1N1J A;  3AZL B;  4WU8 D;  4KUD A;  3X1U C;  4J8V D;  3UT9 C;  4H9N B;  3A6N B;  3KWQ D;  1KX5 D;  5BNX A;  1F66 D;  1P3F B;  3MGS A;  1P3G D;  4R8P B;  2YFV B;  5GT3 A;  4J8W B;  2F8N H;  3A6N C;  4G92 B;  5AVB B;  3AZJ D;  2HIO A;  1P3K C;  5DNM D;  5B2J A;  1P3F C;  3MGQ B;  4R8P C;  2F8N A;  1H3O A;  1P3O C;  2IO5 C;  4NE6 A;  3X1U D;  5AV6 A;  3UT9 D;  4G92 C;  1P3P B;  5BS7 C;  5AVB C;  5CP6 C;  5B0Z A;  2FJ7 B;  4X23 C;  4KGC B;  4Z5T B;  3MGQ C;  5CPI A;  3R45 A;  1M1A A;  3AZK A;  5FUG A;  5JRG A;  3AZE B;  5BNV B;  5B40 B;  3A6N D;  1P3P C;  3UTB A;  4CSR B;  4KGC C;  2FJ7 C;  1P3K D;  4Z5T C;  1P3F D;  4R8P D;  4AWL B;  4M6B A;  5B32 A;  4CAY B;  3X1S A;  3KUY A;  1P3L A;  1P3O D;  4JJN A;  3AZE C;  1U35 B;  3AV1 A;  5B40 C;  5AVB D;  5GSU A;  4E45 A;  3KXB B;  5CP6 D;  4X23 D;  5E5A B;  3MGQ D;  3AYW B;  4AWL C;  3REK B;  4LD9 B;  3UTA D;  3W99 B;  1KX4 C;  1U35 C;  1P3M A;  1TAF B;  3MVD A;  5AV9 B;  1S32 A;  3O62 C;  1P3P D;  4H9R B;  4KGC D;  3MNN B;  2FJ7 D;  4Z5T D;  5B24 A;  3B6G D;  5E5A C;  3WKJ B;  3REK C;  4LD9 C;  3W96 A;  3TU4 A;  3AZF B;  3AZE D;  5C3I B;  5B40 D;  5GXQ B;  1BH8 A;  3MNN C;  5GT0 A;  1JFI B;  3WTP B;  5CPJ C;  4E44 A;  3LJA B;  1BH9 B;  5B0Y A;  1KX4 D;  5B1L C;  1U35 D;  5C3I C;  5JA4 A;  3O62 D;  4H9S A;  5F99 A;  5GXQ C;  3LZ0 B;  1P3A B;  3KSY A;  1EQZ A;  5E5A D;  3LJA C;  5AV5 A;  3REK D;  4LD9 D;  1WWS A;  3AZN B;  3W98 A;  1N1J B;  5G49 A;  5AY8 A;  5AV8 A;  4KUD B;  3MNN D;  5CPJ D;  4XZQ A;  5BNX B;  3AZN C;  2BYM A;  3MGS B;  4J8X A;  5B1L D;  3B0C W;  5B2I B;  4YM6 A;  5GT3 B;  5GXQ D;  3AZH C;  3B0D B;  4KUD C;  1WWI A;  4Z66 A;  3LJA D;  2HIO B;  1TZY A;  5B2J B;  4KHA A;  5BO0 A;  2F8N B;  1H3O B;  3LZ1 A;  5B2I C; 
#chains in the Genus database with same CATH topology
 1HQ3 C;  5GT3 C;  3WA9 A;  3REI A;  1Z2C B;  3MGR A;  5AV6 B;  4DRA A;  2LY8 A;  3AZI C;  1KX3 A;  2DF4 C;  2HIO C;  5B0Z B;  3AZN D;  2JE5 A;  3REH A;  3R45 B;  3C1C C;  1P3B D;  5FUG B;  5CPK A;  3AZH D;  4KUD D;  4WV4 B;  5AV6 C;  2PYO C;  3REJ A;  5B0Z C;  1A7W A;  3KUY B;  5B31 A;  5B32 B;  3X1S B;  1P3L B;  3AFA A;  2FFF B;  5B2I D;  3B6F A;  1HQ3 D;  5GT3 D;  4QLC A;  2ARO A;  5B1M A;  2J8P A;  1M18 B;  3NQJ A;  4ZBJ B;  3AZI D;  5GSU B;  2HIO D;  4ZUX A;  3KUY C;  5B32 C;  3C1C D;  2Y2O A;  3X1T A;  1P3M B;  1M18 C;  3MVD B;  1S32 B;  3VH6 W;  2CV5 A;  2PYO D;  5GSU C;  3C1B A;  3AZL C;  5B0Z D;  2BG1 A;  3REL A;  3W96 B;  1ZLA A;  3TU4 B;  1B67 A;  4H9O A;  3MVD C;  3X1V A;  5AVC A;  2NZD B;  1BH8 B;  4EO5 B;  5GT0 B;  3AN2 A;  2YFW A;  1ULY A;  4J8W C;  3KUY D;  5B32 D;  5KDM B;  3W96 C;  5B0Y B;  3TU4 C;  5B33 A;  1ID3 A;  1M18 D;  4G91 B;  5JA4 B;  3V9R A;  5GSU D;  3AZL D;  2NZD C;  4EO5 C;  3AZM A;  1EQZ B;  4Z2M G;  5GT0 C;  2DQN C;  5B0Y C;  5CHL B;  5DNN A;  3W98 B;  4WU8 A;  5AY8 B;  3MVD D;  5AV8 B;  3LEL B;  2NQB A;  4J8V A;  3KWQ A;  4XZQ B;  4J8W D;  3B0B A;  4J8U D;  3W96 D;  2ZY4 A;  1F66 A;  3W98 C;  1P3G A;  1R4V A;  5AY8 C;  4YM6 B;  3LEL C;  2NZD D;  4NE3 A;  2BYK A;  5GT0 D;  4Z66 B;  4XZQ C;  3AZJ A;  5B0Y D;  1TZY B;  5DNM A;  5BO0 B;  3KXB C;  3VH5 W;  3LZ1 B;  2F8N G;  4YM6 C;  3AYW C;  3WA9 B;  2JSS A;  3WTP E;  3MGR B;  3UT9 A;  1PZR A;  1KX3 B;  3W99 C;  5AV9 C;  1TZY C;  3W98 D;  1KU5 A;  3REH B;  4WJ3 C;  5AY8 D;  3LZ1 C;  3WA9 C;  3WKJ C;  5CPK B;  3LEL D;  3MGR C;  4XUJ A;  1M19 A;  3AZG B;  3AZF C;  1KX3 C;  3REJ B;  4XZQ D;  2Y2G A;  3W97 A;  1P3K A;  1P34 B;  3REH C;  3KXB D;  1P3O A;  3WTP C;  3AFA B;  3B6F B;  5B32 G;  4YM6 D;  3AYW D;  3MGP B;  4QLC B;  2ARO B;  5B1M B;  3AZG C;  3NQJ B;  4UPK A;  2ZY3 A;  3W99 D;  5BS7 A;  5AVB A;  4ZUX B;  4WU9 A;  4UUZ A;  5CP6 A;  5AV9 D;  1TZY D;  4X23 A;  2HUE B;  1P3A C;  3LZ0 C;  1P34 C;  3MGQ A;  3LZ1 D;  3F6T A;  3B6F C;  3UTA A;  3VH5 T;  3WA9 D;  2Y2N A;  3X1T B;  3MGP C;  3WKJ D;  2ARO C;  3AZF D;  1KX3 D;  3C1B B;  2L5A A;  4ZUX C;  2FJ7 A;  3REL B;  2HUE C;  2Y2P A;  4H9Q A;  3REH D;  3B6G A;  1ZLA B;  3WTP D;  4H9O B;  1P3I A;  3FDD A;  3AZE A;  3AZG D;  5B40 A;  3X1V B;  5AVC B;  3MGS C;  3C1B C;  4DRB A;  3REL C;  2YFW B;  1P3A D;  3B0D C;  3LZ0 D;  1P34 D;  3B6F D;  5B33 B;  1ID3 B;  3MGP D;  1KX4 A;  4WZS B;  1U35 A;  5B2J C;  3X1V C;  5AVC C;  3V9R B;  3O62 A;  5CPI B;  1M1A B;  4ZUX D;  3AZK B;  3AZM B;  5JRG B;  5E5A A;  3REK A;  4NE5 A;  4LD9 A;  5B33 C;  5DNN B;  3UTB B;  4WU8 B;  3WAA A;  3MGS D;  2RVQ C;  5CPI C;  3C1B D;  3H0L C;  1M1A C;  2NQB B;  3AZK C;  3AZM C;  3B0C T;  3KWQ B;  5JRG C;  5CPJ A;  3AV2 A;  4JJN B;  3AV1 B;  1F66 B;  5DNN C;  3UTB C;  1P3G B;  5B1L A;  5B2J D;  3X1V D;  2ZY2 A;  2F8N D;  2NQB C;  3X1S C;  1P3L C;  4JJN C;  5AV6 D;  2VQR A;  3AV1 C;  4ZBJ C;  5DNM B;  5B33 D;  3EPL A;  5BT1 C;  1AOI A;  4J8U A;  5B24 B;  2RVQ D;  5CPI D;  1M1A D;  3AZK D;  2W8S A;  1HTA A;  3UT9 B;  5JRG D;  1P3M C;  1S32 C;  3AZN A;  5DNN D;  3UTB D;  3NQU A;  4YS3 A;  3VH6 A;  5B24 C;  1P3B A;  3AZH A;  4XUJ B;  3X1S D;  1P3L D;  1M19 B;  2NQB D;  3IP4 C;  4JJN D;  2Y2K A;  3AV1 D;  1BFM A;  3W97 B;  1P3K B;  5F99 B;  5BT1 D;  4H9P A;  1P3O B;  2CWE A;  5B31 G;  5B2I A;  1HQ3 A;  5AV5 B;  1M19 C;  4XUJ C;  2IO5 B;  4WNN A;  3AZI A;  3A1K A;  5G49 B;  1P3M D;  4WU9 B;  4G91 C;  4UUZ B;  5CP6 B;  2XD1 A;  1S32 D;  4X23 B;  4H9S C;  5F99 C;  3VH6 T;  3W97 C;  1EQZ C;  5B24 D;  3C1C A;  3WAA B;  3UTA B;  5AV5 C;  1KX5 A;  3TU4 D;  2BYM B;  2PYO A;  2JCH A;  4J8X B;  4WU9 C;  5AV8 C;  4H9Q B;  3B6G B;  3WAA C;  3UTA C;  1P3I B;  1M19 D;  4XUJ D;  4KHA B;  4J8X C;  3W97 D;  3EG5 B;  5F99 D;  3B6G C;  3REI B;  3X1U A;  1EQZ D;  4Z66 C;  5AV5 D;  1P3I C;  1KX4 B;  1M18 A;  3O62 B;  3AZL A;  4WU9 D;  5AV8 D;  3REI C;  3VH5 A;  4H9N A;  3A6N A;  3WAA D;  3KFU G;  1P3F A;  4J8X D;  4R8P A;  5B31 B;  2YFV A;  5CPJ B;  2Y2I A;  3AV2 B;  5CPK C;  3EPH A;  4J8W A;  4Z66 D;  3REJ C;  1P3I D;  5B1L B;  5B31 C;  2G5H C;  3AFA C;  2NZD A;  4HGA B;  4QLC C;  3MGR D;  3REI D;  5B1M C;  3AV2 C;  2CV5 B;  5KDM A;  1P3P A;  1AOI B;  4J8U B;  4KGC A;  4Z5T A;  2Y2J A;  2ZM5 A;  3X1T C;  5CPK D;  4HGA C;  5BNV A;  2CV5 C;  3REJ D;  4NFT A;  1T3U A;  4YS3 B;  3NQU B;  4CSR A;  1AOI C;  4J8U C;  3AN2 B;  1P3B B;  5B31 D;  3AZH B;  3LEL A;  1ZLA C;  4CAY A;  3AFA D;  1Q9C A;  3AV2 D;  4QLC D;  2ARO D;  5B1M D;  4YS3 C;  3EPK A;  3KXB A;  4H9P B;  3AN2 C;  1P3B C;  3AYW A;  1HQ3 B;  4WNN B;  3AZI B;  1ID3 C;  3X1T D;  3W99 A;  1TAF A;  2CV5 D;  5AV9 A;  2F2A C;  4H9R A;  1AOI D;  4J8V B;  3MNN A;  3REL D;  3C1C B;  3EPJ A;  1KX5 B;  3WKJ A;  1ZLA D;  2F8N K;  2PYO B;  3AZF A;  4WU8 C;  5AVC D;  5GXQ A;  4YS3 D;  2BYK B;  4J8V C;  3AN2 D;  1JFI A;  3KWQ C;  3WTP A;  3LJA A;  3AZJ B;  1KX5 C;  1BH9 A;  4Z2M H;  3AZG A;  1F66 C;  1ID3 D;  1P3G C;  2Y2L A;  3H0R C;  1P3A A;  3LZ0 A;  1P34 A;  1F1E A;  3X1U B;  3AZM D;  3AZJ C;  3MGP A;  3P5J B;  5DNM C;  1B6W A;  1N1J A;  3AZL B;  4WU8 D;  4KUD A;  3X1U C;  4J8V D;  3UT9 C;  4H9N B;  3A6N B;  3KWQ D;  1KX5 D;  5BNX A;  1F66 D;  1P3F B;  3MGS A;  1P3G D;  4R8P B;  4DQY B;  2YFV B;  5GT3 A;  4J8W B;  2F8N H;  3A6N C;  4G92 B;  5AVB B;  3AZJ D;  2HIO A;  1P3K C;  5DNM D;  5B2J A;  1P3F C;  3MGQ B;  1H3O B;  4R8P C;  2F8N A;  1H3O A;  1P3O C;  3AL0 C;  2IO5 C;  4NE6 A;  3X1U D;  5AV6 A;  3UT9 D;  4G92 C;  1P3P B;  5BS7 C;  5AVB C;  5CP6 C;  5B0Z A;  2FJ7 B;  4X23 C;  4KGC B;  4Z5T B;  3MGQ C;  5CPI A;  3R45 A;  1M1A A;  3AZK A;  5FUG A;  5JRG A;  3AZE B;  5BNV B;  5B40 B;  3A6N D;  1P3P C;  3UTB A;  4CSR B;  4KGC C;  2Y2H A;  2FJ7 C;  2XD5 A;  1P3K D;  4Z5T C;  1P3F D;  2G5I C;  4R8P D;  4AWL B;  4M6B A;  5B32 A;  4CAY B;  3X1S A;  3KUY A;  1P3L A;  1P3O D;  4JJN A;  3AZE C;  1U35 B;  3AV1 A;  5B40 C;  5AVB D;  5GSU A;  4E45 A;  3KXB B;  5CP6 D;  4X23 D;  5E5A B;  3MGQ D;  3AYW B;  4AWL C;  3REK B;  4LD9 B;  3UTA D;  3W99 B;  1KX4 C;  1U35 C;  1P3M A;  1TAF B;  3MVD A;  5AV9 B;  1S32 A;  3O62 C;  1P3P D;  4H9R B;  4KGC D;  3MNN B;  2FJ7 D;  4Z5T D;  5B24 A;  3B6G D;  5E5A C;  3WKJ B;  2ZY5 A;  3REK C;  4LD9 C;  3W96 A;  3TU4 A;  3AZF B;  3AZE D;  5C3I B;  5B40 D;  5GXQ B;  1BH8 A;  3MNN C;  5GT0 A;  1JFI B;  3WTP B;  5CPJ C;  4E44 A;  3LJA B;  1BH9 B;  5B0Y A;  1KX4 D;  5B1L C;  1U35 D;  5C3I C;  5JA4 A;  3O62 D;  4H9S A;  5F99 A;  5GXQ C;  3LZ0 B;  1P3A B;  3KSY A;  2Y2M A;  1EQZ A;  5E5A D;  3LJA C;  5AV5 A;  3REK D;  2RIQ A;  4LD9 D;  1WWS A;  3AZN B;  2UWX A;  3W98 A;  1N1J B;  5G49 A;  5AY8 A;  5AV8 A;  4KUD B;  3MNN D;  1W2E A;  5CPJ D;  4XZQ A;  5BNX B;  3AZN C;  2BYM A;  3MGS B;  4J8X A;  3H0M C;  3B0C W;  5B1L D;  5B2I B;  4YM6 A;  5GT3 B;  5GXQ D;  3AZH C;  3B0D B;  4KUD C;  1WWI A;  4Z66 A;  2Y2Q A;  3LJA D;  2HIO B;  1TZY A;  5B2J B;  4KHA A;  5BO0 A;  2F8N B;  3A1I A;  3LZ1 A;  5B2I C; 
#chains in the Genus database with same CATH homology
 1HQ3 C;  5GT3 C;  3WA9 A;  3REI A;  1Z2C B;  3MGR A;  5AV6 B;  4DRA A;  2LY8 A;  3AZI C;  1KX3 A;  2DF4 C;  2HIO C;  5B0Z B;  3AZN D;  2JE5 A;  3REH A;  3R45 B;  3C1C C;  1P3B D;  5FUG B;  5CPK A;  3AZH D;  4KUD D;  4WV4 B;  5AV6 C;  2PYO C;  3REJ A;  5B0Z C;  1A7W A;  3KUY B;  5B31 A;  5B32 B;  3X1S B;  1P3L B;  3AFA A;  2FFF B;  5B2I D;  3B6F A;  1HQ3 D;  5GT3 D;  4QLC A;  2ARO A;  5B1M A;  2J8P A;  1M18 B;  3NQJ A;  4ZBJ B;  3AZI D;  5GSU B;  2HIO D;  4ZUX A;  3KUY C;  5B32 C;  3C1C D;  2Y2O A;  3X1T A;  1P3M B;  1M18 C;  3MVD B;  1S32 B;  3VH6 W;  2CV5 A;  2PYO D;  5GSU C;  3C1B A;  3AZL C;  5B0Z D;  2BG1 A;  3REL A;  3W96 B;  1ZLA A;  3TU4 B;  1B67 A;  4H9O A;  3MVD C;  3X1V A;  5AVC A;  2NZD B;  1BH8 B;  4EO5 B;  5GT0 B;  3AN2 A;  2YFW A;  1ULY A;  4J8W C;  3KUY D;  5B32 D;  5KDM B;  3W96 C;  5B0Y B;  3TU4 C;  5B33 A;  1ID3 A;  1M18 D;  4G91 B;  5JA4 B;  3V9R A;  5GSU D;  3AZL D;  2NZD C;  4EO5 C;  3AZM A;  1EQZ B;  4Z2M G;  5GT0 C;  2DQN C;  5B0Y C;  5CHL B;  5DNN A;  3W98 B;  4WU8 A;  5AY8 B;  3MVD D;  5AV8 B;  3LEL B;  2NQB A;  4J8V A;  3KWQ A;  4XZQ B;  4J8W D;  3B0B A;  4J8U D;  3W96 D;  2ZY4 A;  1F66 A;  3W98 C;  1P3G A;  1R4V A;  5AY8 C;  4YM6 B;  3LEL C;  2NZD D;  4NE3 A;  2BYK A;  5GT0 D;  4Z66 B;  4XZQ C;  3AZJ A;  5B0Y D;  1TZY B;  5DNM A;  5BO0 B;  3KXB C;  3VH5 W;  3LZ1 B;  2F8N G;  4YM6 C;  3AYW C;  3WA9 B;  2JSS A;  3WTP E;  3MGR B;  3UT9 A;  1PZR A;  1KX3 B;  3W99 C;  5AV9 C;  1TZY C;  3W98 D;  1KU5 A;  3REH B;  4WJ3 C;  5AY8 D;  3LZ1 C;  3WA9 C;  3WKJ C;  5CPK B;  3LEL D;  3MGR C;  4XUJ A;  1M19 A;  3AZG B;  3AZF C;  1KX3 C;  3REJ B;  4XZQ D;  2Y2G A;  3W97 A;  1P3K A;  1P34 B;  3REH C;  3KXB D;  1P3O A;  3WTP C;  3AFA B;  3B6F B;  5B32 G;  4YM6 D;  3AYW D;  3MGP B;  4QLC B;  2ARO B;  5B1M B;  3AZG C;  3NQJ B;  4UPK A;  2ZY3 A;  3W99 D;  5BS7 A;  5AVB A;  4ZUX B;  4WU9 A;  4UUZ A;  5CP6 A;  5AV9 D;  1TZY D;  4X23 A;  2HUE B;  1P3A C;  3LZ0 C;  1P34 C;  3MGQ A;  3LZ1 D;  3F6T A;  3B6F C;  3UTA A;  3VH5 T;  3WA9 D;  2Y2N A;  3X1T B;  3MGP C;  3WKJ D;  2ARO C;  3AZF D;  1KX3 D;  3C1B B;  2L5A A;  4ZUX C;  2FJ7 A;  3REL B;  2HUE C;  2Y2P A;  4H9Q A;  3REH D;  3B6G A;  1ZLA B;  3WTP D;  4H9O B;  1P3I A;  3FDD A;  3AZE A;  3AZG D;  5B40 A;  3X1V B;  5AVC B;  3MGS C;  3C1B C;  4DRB A;  3REL C;  2YFW B;  1P3A D;  3B0D C;  3LZ0 D;  1P34 D;  3B6F D;  5B33 B;  1ID3 B;  3MGP D;  1KX4 A;  4WZS B;  1U35 A;  5B2J C;  3X1V C;  5AVC C;  3V9R B;  3O62 A;  5CPI B;  1M1A B;  4ZUX D;  3AZK B;  3AZM B;  5JRG B;  5E5A A;  3REK A;  4NE5 A;  4LD9 A;  5B33 C;  5DNN B;  3UTB B;  4WU8 B;  3WAA A;  3MGS D;  2RVQ C;  5CPI C;  3C1B D;  3H0L C;  1M1A C;  2NQB B;  3AZK C;  3AZM C;  3B0C T;  3KWQ B;  5JRG C;  5CPJ A;  3AV2 A;  4JJN B;  3AV1 B;  1F66 B;  5DNN C;  3UTB C;  1P3G B;  5B1L A;  5B2J D;  3X1V D;  2ZY2 A;  2F8N D;  2NQB C;  3X1S C;  1P3L C;  4JJN C;  5AV6 D;  2VQR A;  3AV1 C;  4ZBJ C;  5DNM B;  5B33 D;  3EPL A;  5BT1 C;  1AOI A;  4J8U A;  5B24 B;  2RVQ D;  5CPI D;  1M1A D;  3AZK D;  2W8S A;  1HTA A;  3UT9 B;  5JRG D;  1P3M C;  1S32 C;  3AZN A;  5DNN D;  3UTB D;  3NQU A;  4YS3 A;  3VH6 A;  5B24 C;  1P3B A;  3AZH A;  4XUJ B;  3X1S D;  1P3L D;  1M19 B;  2NQB D;  3IP4 C;  4JJN D;  2Y2K A;  3AV1 D;  1BFM A;  3W97 B;  1P3K B;  5F99 B;  5BT1 D;  4H9P A;  1P3O B;  2CWE A;  5B31 G;  5B2I A;  1HQ3 A;  5AV5 B;  1M19 C;  4XUJ C;  2IO5 B;  4WNN A;  3AZI A;  3A1K A;  5G49 B;  1P3M D;  4WU9 B;  4G91 C;  4UUZ B;  5CP6 B;  2XD1 A;  1S32 D;  4X23 B;  4H9S C;  5F99 C;  3VH6 T;  3W97 C;  1EQZ C;  5B24 D;  3C1C A;  3WAA B;  3UTA B;  5AV5 C;  1KX5 A;  3TU4 D;  2BYM B;  2PYO A;  2JCH A;  4J8X B;  4WU9 C;  5AV8 C;  4H9Q B;  3B6G B;  3WAA C;  3UTA C;  1P3I B;  1M19 D;  4XUJ D;  4KHA B;  4J8X C;  3W97 D;  3EG5 B;  5F99 D;  3B6G C;  3REI B;  3X1U A;  1EQZ D;  4Z66 C;  5AV5 D;  1P3I C;  1KX4 B;  1M18 A;  3O62 B;  3AZL A;  4WU9 D;  5AV8 D;  3REI C;  3VH5 A;  4H9N A;  3A6N A;  3WAA D;  3KFU G;  1P3F A;  4J8X D;  4R8P A;  5B31 B;  2YFV A;  5CPJ B;  2Y2I A;  3AV2 B;  5CPK C;  3EPH A;  4J8W A;  4Z66 D;  3REJ C;  1P3I D;  5B1L B;  5B31 C;  2G5H C;  3AFA C;  2NZD A;  4HGA B;  4QLC C;  3MGR D;  3REI D;  5B1M C;  3AV2 C;  2CV5 B;  5KDM A;  1P3P A;  1AOI B;  4J8U B;  4KGC A;  4Z5T A;  2Y2J A;  2ZM5 A;  3X1T C;  5CPK D;  4HGA C;  5BNV A;  2CV5 C;  3REJ D;  4NFT A;  1T3U A;  4YS3 B;  3NQU B;  4CSR A;  1AOI C;  4J8U C;  3AN2 B;  1P3B B;  5B31 D;  3AZH B;  3LEL A;  1ZLA C;  4CAY A;  3AFA D;  1Q9C A;  3AV2 D;  4QLC D;  2ARO D;  5B1M D;  4YS3 C;  3EPK A;  3KXB A;  4H9P B;  3AN2 C;  1P3B C;  3AYW A;  1HQ3 B;  4WNN B;  3AZI B;  1ID3 C;  3X1T D;  3W99 A;  1TAF A;  2CV5 D;  5AV9 A;  2F2A C;  4H9R A;  1AOI D;  4J8V B;  3MNN A;  3REL D;  3C1C B;  3EPJ A;  1KX5 B;  3WKJ A;  1ZLA D;  2F8N K;  2PYO B;  3AZF A;  4WU8 C;  5AVC D;  5GXQ A;  4YS3 D;  2BYK B;  4J8V C;  3AN2 D;  1JFI A;  3KWQ C;  3WTP A;  3LJA A;  3AZJ B;  1KX5 C;  1BH9 A;  4Z2M H;  3AZG A;  1F66 C;  1ID3 D;  1P3G C;  2Y2L A;  3H0R C;  1P3A A;  3LZ0 A;  1P34 A;  1F1E A;  3X1U B;  3AZM D;  3AZJ C;  3MGP A;  3P5J B;  5DNM C;  1B6W A;  1N1J A;  3AZL B;  4WU8 D;  4KUD A;  3X1U C;  4J8V D;  3UT9 C;  4H9N B;  3A6N B;  3KWQ D;  1KX5 D;  5BNX A;  1F66 D;  1P3F B;  3MGS A;  1P3G D;  4R8P B;  4DQY B;  2YFV B;  5GT3 A;  4J8W B;  2F8N H;  3A6N C;  4G92 B;  5AVB B;  3AZJ D;  2HIO A;  1P3K C;  5DNM D;  5B2J A;  1P3F C;  3MGQ B;  1H3O B;  4R8P C;  2F8N A;  1H3O A;  1P3O C;  3AL0 C;  2IO5 C;  4NE6 A;  3X1U D;  5AV6 A;  3UT9 D;  4G92 C;  1P3P B;  5BS7 C;  5AVB C;  5CP6 C;  5B0Z A;  2FJ7 B;  4X23 C;  4KGC B;  4Z5T B;  3MGQ C;  5CPI A;  3R45 A;  1M1A A;  3AZK A;  5FUG A;  5JRG A;  3AZE B;  5BNV B;  5B40 B;  3A6N D;  1P3P C;  3UTB A;  4CSR B;  4KGC C;  2Y2H A;  2FJ7 C;  2XD5 A;  1P3K D;  4Z5T C;  1P3F D;  2G5I C;  4R8P D;  4AWL B;  4M6B A;  5B32 A;  4CAY B;  3X1S A;  3KUY A;  1P3L A;  1P3O D;  4JJN A;  3AZE C;  1U35 B;  3AV1 A;  5B40 C;  5AVB D;  5GSU A;  4E45 A;  3KXB B;  5CP6 D;  4X23 D;  5E5A B;  3MGQ D;  3AYW B;  4AWL C;  3REK B;  4LD9 B;  3UTA D;  3W99 B;  1KX4 C;  1U35 C;  1P3M A;  1TAF B;  3MVD A;  5AV9 B;  1S32 A;  3O62 C;  1P3P D;  4H9R B;  4KGC D;  3MNN B;  2FJ7 D;  4Z5T D;  5B24 A;  3B6G D;  5E5A C;  3WKJ B;  2ZY5 A;  3REK C;  4LD9 C;  3W96 A;  3TU4 A;  3AZF B;  3AZE D;  5C3I B;  5B40 D;  5GXQ B;  1BH8 A;  3MNN C;  5GT0 A;  1JFI B;  3WTP B;  5CPJ C;  4E44 A;  3LJA B;  1BH9 B;  5B0Y A;  1KX4 D;  5B1L C;  1U35 D;  5C3I C;  5JA4 A;  3O62 D;  4H9S A;  5F99 A;  5GXQ C;  3LZ0 B;  1P3A B;  3KSY A;  2Y2M A;  1EQZ A;  5E5A D;  3LJA C;  5AV5 A;  3REK D;  2RIQ A;  4LD9 D;  1WWS A;  3AZN B;  2UWX A;  3W98 A;  1N1J B;  5G49 A;  5AY8 A;  5AV8 A;  4KUD B;  3MNN D;  1W2E A;  5CPJ D;  4XZQ A;  5BNX B;  3AZN C;  2BYM A;  3MGS B;  4J8X A;  3H0M C;  3B0C W;  5B1L D;  5B2I B;  4YM6 A;  5GT3 B;  5GXQ D;  3AZH C;  3B0D B;  4KUD C;  1WWI A;  4Z66 A;  2Y2Q A;  3LJA D;  2HIO B;  1TZY A;  5B2J B;  4KHA A;  5BO0 A;  2F8N B;  3A1I A;  3LZ1 A;  5B2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...