1KX4B

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4B00
4YS3A 3AFAD 4Z66B 5AVCA 2NZDB 5AV9D 3TU4A 4Z66D 3W97B 2NZDD 1B6WA 4G91B 3X1VB 4KUDC 5G49B 3AZLB 3KSYA 5GSUB 4H9NB 3X1VD 3REHD 1P3FC 1P3OA 3W96A 5AV5A 4KHAB 1F66A 3X1UC 1KX4A 3LZ1C 4KUDB 4KUDD 1HTAA 1P3FB 5JA4B 3A6NC 1P3FD 3X1TC 1ZLAC 3WAAA 1P3BC 3AFAA 3X1UB 4Z66A 3X1UD 3AN2C 2NZDA 3MVDC 3LZ1B 5GT0A 5AVBC 5B32G 3X1VA 3MGRC 5G49A 3REHA 2FJ7C 3A6NB 4H9NA 3AZNC 4J8UC 5B32C 3AZEC 3A6ND 3REKD 1JFIB 3UTAA 5CPKA 3X1TB 1Q9CA 1ZLAB 2CV5C 3X1TD 1P3BB 1BH9A 1P3BD 2HIOC 3AN2B 3AV2D 1R4VA 3MVDB 3AN2D 2LY8A 5AVBB 5FUGB 3MGRB 5GT3C 2FJ7B 5AVBD 3AZNB 4J8UB 1P3FA 3AZEB 5JA4A 2FJ7D 4J8UD 5B32D 3AZED 2CV5B 1AOIC 3LZ0C 5KDMA 2HIOB 3X1UA 2NQBC 2HIOD 2YFWA 2YFVB 2IO5C 4UUZB 4H9OA 2F8NB 5GT3B 5JRGC 2F8ND 5GT3D 1M1AC 4J8XC 5B2IC 3A6NA 3REKA 4CSRB 3LJAA 5B40C 3MGPC 1AOIB 1WWIA 4H9SC 1AOID 3LZ0D 3REIC 4Z5TC 2NQBB 3AV2A 2BYKA 5DNNA 2NQBD 2IO5B 4ZBJC 1KX3C 5BT1C 5JRGB 5AVBA 5FUGA 1M1AB 5JRGD 2FJ7A 4J8XB 5B2IB 3AYWC 1M1AD 5B40B 3WA9C 5B32A 1KU5A 5B2ID 3AZEA 5B40D 3MGPD 3RELC 1P3PB 3REJA 3REIB 4JJNA 4Z5TB 3REID 1S32C 2HIOA 4Z5TD 2PYOC 4ZBJB 1KX3B 3KUYC 1KX3D 3KWQC 5BT1D 1U35D 2F8NA 1HQ3D 3O62D 5BNVA 3AYWD 3MGSA 3WA9D 4J8WC 4Z2MG 5C3IC 5B0ZC 3RELB 5F99C 3RELD 3LZ0A 1S32B 4XZQA 3UT9B 1B67A 1S32D 3AZLC 2NQBA 5AV6C 5GSUC 1P3MC 2PYOB 2PYOD 5B0YA 3KUYD 1N1JB 4WZSB 3NQUB 3KWQD 5JRGA 4J8VC 4J8WB 5C3IB 5B0ZB 4J8WD 3MGPA 5F99B 5B0ZD 4E44A 1M19A 4H9SA 3C1CC 4DRAA 1P3LA 3REIA 3B6GA 3W97D 1P3KC 3B0BA 1P3AC 2HUEC 2JSSA 5AV6B 1P3MB 3AZLD 5AV6D 5GSUD 1P3MD 3LELA 1U35A 4J8VB 3AZGC 1HQ3A 3UTBC 3O62A 4J8VD 3AYWA 3WA9A 3WTPE 4LD9C 5B33C 4AWLC 5GXQA 3R45B 2BYMB 4DRBA 3C1CB 3C1CD 1P3KB 3B0DC 3C1BC 2HUEB 1S32A 1P3AB 1KX5C 1P3AD 3AZFC 4H9RA 2PYOA 3KUYA 1H3OB 3AZGB 3KWQA 3UTBB 4KGCA 3AZGD 3UTBD 4H9QA 3W98A 4LD9B 5B33B 4AWLB 5B2JC 4LD9D 5B33D 5AV9A 4NE5A 3W97A 3B0DB 3C1BB 4YM6C 3LZ1D 1KX5B 3C1BD 3AZFB 3AZLA 3X1SC 5AV6A 4EO5C 5GSUA 3VH5W 5E5AC 1P3MA 1KX5D 3B6FC 5B1LC 1BFMA 4J8VA 4KHAA 3W99C 1ZLAD 5B2JB 5BNXB 3R45A 2F8NH 2F8NG 3MVDD 3VH6T 5AV8C 4YM6B 4KUDA 3X1SB 1P3GC 1P3AA 4EO5B 3KXBB 3MGRD 5E5AB 3X1SD 3B6FB 5B1MC 5B1LB 5E5AD 3AZND 3B6FD 5B1LD 3AZKC 3W99B 3W99D 2CV5D 3AZHC 4LD9A 3VH6A 5AV8B 3LZ1A 1M18C 1P3GB 5AV8D 1P3GD 4WNNB 5B1MB 1JFIA 5B1MD 3AZKB 1TZYC 3AZKD 3X1TA 1P3PC 1ZLAA 3VH6W 3AZHB 5BO0B 1P3BA 3WTPB 3AZHD 4CAYB 3AN2A 3MVDA 1M18B 1M18D 3MGRA 1ID3C 5E5AA 3AZNA 4J8XD 4J8UA 3B6FA 3WKJC 1TZYB 4ZUXC 1TZYD 3W99A 2CV5A 1P3PD 5CP6C 4YS3C 5B24C 5AVCC 3UT9C 4R8PC 4H9PB 1P34B 2YFVA 2AROC 4UUZA 5GT3A 3AZIB 5CPJC 1P3GA 1ID3B 1P3OC 1ID3D 5AV5C 3WKJB 4ZUXB 4CSRA 4Z2MH 3WKJD 4ZUXD 3AZKA 5BS7C 1AOIA 5CP6B 4G92C 4NFTA 4YS3B 5AVCB 5B24B 3AZHA 5CP6D 1F66C 5BO0A 4YS3D 3TU4B 5AVCD 5B24D 4R8PB 4CAYA 5DNMC 3UT9D 4R8PD 2AROB 2AROD 5CPJB 5CPJD 1P3OB 1M1AA 5AV5B 4J8XA 5CHLB 5B2IA 1P3OD 5B40A 5AV5D 1TZYA 4NE6A 5F99D 1P3PA 4G92B 1F66B 1F66D 5DNMB 4Z5TA 5DNMD 5GT0C 1KX3A 4WU8C 3AV1C 1A7WA 4WV4B 1ID3A 3UTAC 5CPKC 3VH5T 4ZUXA 3RELA 2L5AA 5CP6A 5B24A 3MNNC 1F1EA 3UT9A 1P3KD 4R8PA 5GT0B 2AROA 5GT0D 3VH5A 3REHB 4WU8B 1N1JA 3AV1B 5CPJA 3NQUA 4WU8D 3NQJB 3AV1D 3UTAB 5CPKB 3UTAD 4J8WA 2RVQC 5CPKD 5B0ZA 4XUJC 5F99A 5BS7A 1BH9B 5CPIC 4M6BA 3MNNB 1P3IC 3MNND 5DNMA 3KXBC 3AZFD 5AY8C 5B31G 3REKC 3LJAC 5B31C 3V9RB 1BH8B 2RVQD 4E45A 5KDMB 5B2JD 4XUJB 2BYMA 5CPIB 4XUJD 4QLCC 3C1CA 3AZJC 5CPID 2YFWB 3AV2C 1P3IB 5DNNC 1P3KA 4YM6D 4X23C 3MGQC 1P3ID 4H9OB 3KXBD 5AY8B 1H3OA 3AZGA 4WU8A 3UTBA 5AY8D 3REKB 3LJAB 3AV1A 3NQJA 3LJAD 5B31B 5B33A 4WU9C 3WTPC 1EQZC 5B31D 4QLCB 3REJC 3AZJB 4JJNC 4NE3A 4QLCD 3AV2B 2BYKB 3AZJD 5DNNB 3MNNA 4X23B 3C1BA 3MGQB 1KX5A 5DNND 4X23D 3MGQD 3AZFA 1TAFB 5B32B 3MGSC 4WU9B 1EQZB 5B2JA 4WU9D 3V9RA 1BH8A 5BNXA 3WTPD 3REJB 4XUJA 1EQZD 4JJNB 1P34C 3REJD 5CPIA 4XZQC 4JJND 4YM6A 1P3IA 3AZIC 3X1SA 3KXBA 5B0YC 5B1LA 5BNVB 5AY8A 3AZMC 3MGSB 3MGSD 5B31A 3TU4C 1M19C 3LZ0B 1P3LC 4QLCA 4XZQB 3B6GC 1P34D 3AZJA 4XZQD 5AV8A 4X23A 3MGQA 5B0YB 3AZID 3LELC 1U35C 4WNNA 3W96C 1HQ3C 5B1MA 5B0YD 1TAFA 3O62C 3AZMB 3AZMD 3MGPB 5GXQC 1KX4C 4WU9A 1M19B 3WTPA 1EQZA 3B0CT 1P3LB 3TU4D 1M19D 3B6GB 1P3LD 1ULYA 3B6GD 4HGAC 1M18A 3LELB 1U35B 3W96B 2F8NK 1HQ3B 4KGCC 3O62B 3LELD 3W96D 1WWSA 3AYWB 3W98C 3WAAC 3WA9B 2CWEA 5GXQB 3AFAC 1KX4B 5AV9C 5GXQD 4Z66C 1KX4D 2NZDC 3W97C 4H9PA 1P34A 4G91C 4HGAB 3X1VC 3REHC 4H9RB 3KUYB 3AZIA 3KWQB 4KGCB 3B0CW 3WKJA 4KGCD 4H9QB 3W98B 3WAAB 3AZMA 3W98D 3WAAD 3AFAB 5AV9B
chains in the Genus database with same CATH superfamily
4YS3A 3AFAD 4Z66B 5AVCA 2NZDB 5AV9D 3TU4A 4Z66D 3W97B 2NZDD 1B6WA 4G91B 3X1VB 4KUDC 5G49B 3AZLB 3KSYA 5GSUB 4H9NB 3X1VD 3REHD 1P3FC 1P3OA 3W96A 5AV5A 4KHAB 3EPJA 1F66A 3X1UC 1KX4A 3LZ1C 4KUDB 4KUDD 1HTAA 1P3FB 5JA4B 3A6NC 1P3FD 3H0MC 3X1TC 1ZLAC 3WAAA 1P3BC 3AFAA 3X1UB 3X1UD 4Z66A 3AN2C 2NZDA 3MVDC 3LZ1B 5GT0A 5AVBC 5B32G 3X1VA 3MGRC 5G49A 3REHA 2FJ7C 3A6NB 4H9NA 3AZNC 4J8UC 5B32C 3AZEC 3A6ND 3REKD 1JFIB 3UTAA 5CPKA 3X1TB 1Q9CA 1ZLAB 2CV5C 3X1TD 2ZY2A 1P3BB 1BH9A 1P3BD 2HIOC 3H0LC 3AN2B 3A1KA 3AV2D 1R4VA 3MVDB 3AN2D 2LY8A 5AVBB 5FUGB 3P5JB 5GT3C 3MGRB 2FJ7B 5AVBD 2G5HC 3AZNB 4J8UB 1P3FA 3AZEB 5JA4A 2FJ7D 4J8UD 5B32D 3AZED 2CV5B 1AOIC 3LZ0C 5KDMA 2HIOB 2Y2IA 3X1UA 2NQBC 2HIOD 2YFWA 2YFVB 2IO5C 4UUZB 4H9OA 2F8NB 5GT3B 2JCHA 5JRGC 2F8ND 5GT3D 1M1AC 4J8XC 5B2IC 3A6NA 3REKA 4CSRB 3LJAA 5B40C 3MGPC 1AOIB 1WWIA 4H9SC 1AOID 3LZ0D 3REIC 1W2EA 4Z5TC 2NQBB 3AV2A 2BYKA 5DNNA 2NQBD 2IO5B 2XD1A 4ZBJC 1KX3C 5BT1C 5JRGB 5AVBA 5FUGA 1M1AB 5JRGD 2FJ7A 4J8XB 5B2IB 3AYWC 1M1AD 5B40B 3WA9C 5B32A 1KU5A 5B2ID 3AZEA 5B40D 3MGPD 3RELC 1P3PB 3REJA 3REIB 4JJNA 4Z5TB 3REID 1S32C 2HIOA 4Z5TD 2PYOC 3EPLA 4ZBJB 1KX3B 3KUYC 1KX3D 3KWQC 5BT1D 1U35D 2F8NA 1HQ3D 3O62D 5BNVA 3AYWD 3MGSA 3WA9D 4J8WC 4Z2MG 5C3IC 5B0ZC 3RELB 5F99C 3RELD 3LZ0A 1S32B 4XZQA 3UT9B 1B67A 1S32D 3AZLC 2NQBA 5AV6C 5GSUC 1P3MC 2PYOB 2PYOD 5B0YA 3KUYD 1N1JB 4WZSB 3NQUB 3KWQD 5JRGA 4J8VC 2ZY4A 4J8WB 5C3IB 5B0ZB 4J8WD 3MGPA 5F99B 5B0ZD 4E44A 1M19A 4H9SA 3C1CC 4DRAA 1P3LA 3REIA 3B6GA 3W97D 1P3KC 3B0BA 1P3AC 2HUEC 2JSSA 5AV6B 2Y2HA 1P3MB 3AZLD 5AV6D 5GSUD 1P3MD 3LELA 1U35A 4J8VB 3AZGC 1HQ3A 3UTBC 3O62A 4J8VD 3AYWA 3WA9A 3WTPE 4LD9C 5B33C 4AWLC 5GXQA 3R45B 2BYMB 4DRBA 3EPKA 3C1CB 3C1CD 1P3KB 3B0DC 3C1BC 2HUEB 1S32A 1P3AB 1KX5C 1P3AD 3AZFC 4H9RA 2PYOA 3KUYA 1H3OB 3AZGB 3KWQA 3UTBB 4KGCA 3AZGD 3UTBD 4H9QA 3W98A 4LD9B 5B33B 4AWLB 2ZY3A 5B2JC 4LD9D 5B33D 5AV9A 4NE5A 3W97A 2ZM5A 3B0DB 3C1BB 4YM6C 3LZ1D 1KX5B 3C1BD 3AZFB 3AZLA 3X1SC 5AV6A 4EO5C 5GSUA 3VH5W 5E5AC 1P3MA 1KX5D 3B6FC 3EPHA 5B1LC 1BFMA 2BG1A 4J8VA 4KHAA 3W99C 1ZLAD 5B2JB 5BNXB 3R45A 2F8NH 2F8NG 3MVDD 3VH6T 5AV8C 4YM6B 4KUDA 3X1SB 1P3GC 1P3AA 4EO5B 3KXBB 3MGRD 5E5AB 3X1SD 3B6FB 5B1MC 5B1LB 5E5AD 3AZND 3B6FD 5B1LD 3AZKC 3W99B 3W99D 2CV5D 3AZHC 4LD9A 3VH6A 2FFFB 2J8PA 5AV8B 3LZ1A 1M18C 1P3GB 5AV8D 1P3GD 4WNNB 5B1MB 1JFIA 5B1MD 3AZKB 1TZYC 3AZKD 3X1TA 1P3PC 1ZLAA 3VH6W 3AZHB 5BO0B 1P3BA 3WTPB 3AZHD 4CAYB 3H0RC 2VQRA 3AL0C 3AN2A 3MVDA 1M18B 2Y2NA 1M18D 4DQYB 3MGRA 1ID3C 5E5AA 3AZNA 4J8XD 4J8UA 3B6FA 3WKJC 1TZYB 4ZUXC 1TZYD 3W99A 2CV5A 1P3PD 5CP6C 4YS3C 2Y2KA 5B24C 5AVCC 2ZY5A 3UT9C 4R8PC 4H9PB 1P34B 2YFVA 2AROC 4UUZA 3KFUG 5GT3A 3AZIB 5CPJC 1P3GA 1ID3B 1P3OC 1ID3D 5AV5C 3WKJB 4ZUXB 4CSRA 4Z2MH 3WKJD 4ZUXD 3AZKA 5BS7C 1AOIA 5CP6B 4G92C 4NFTA 4YS3B 5AVCB 2JE5A 5B24B 5CP6D 3AZHA 5BO0A 4YS3D 3TU4B 1F66C 5AVCD 5B24D 4R8PB 4CAYA 5DNMC 3UT9D 1T3UA 4R8PD 2AROB 2AROD 5CPJB 5CPJD 1P3OB 1M1AA 5AV5B 4J8XA 5CHLB 5B2IA 1P3OD 5B40A 5AV5D 1TZYA 4NE6A 5F99D 1P3PA 4G92B 2Y2JA 1F66B 1F66D 5DNMB 4Z5TA 5DNMD 5GT0C 1KX3A 4WU8C 3AV1C 1A7WA 4WV4B 2DQNC 1ID3A 3UTAC 5CPKC 3VH5T 4ZUXA 3RELA 3IP4C 2L5AA 5CP6A 5B24A 3MNNC 1F1EA 3UT9A 1P3KD 4R8PA 2F2AC 5GT0B 2AROA 5GT0D 3VH5A 3REHB 4WU8B 1N1JA 3AV1B 5CPJA 3NQUA 4WU8D 3NQJB 3AV1D 3UTAB 5CPKB 3UTAD 4J8WA 2RVQC 5CPKD 5B0ZA 4XUJC 5F99A 5BS7A 1BH9B 2W8SA 5CPIC 4M6BA 3MNNB 1P3IC 3MNND 5DNMA 1Z2CB 3KXBC 3AZFD 5AY8C 5B31G 3REKC 2RIQA 3LJAC 5B31C 3V9RB 1BH8B 2RVQD 4E45A 5KDMB 5B2JD 4XUJB 2BYMA 5CPIB 4XUJD 4QLCC 3C1CA 3AZJC 5CPID 2YFWB 3AV2C 1P3IB 5DNNC 1P3KA 4YM6D 4X23C 3MGQC 1P3ID 4H9OB 3KXBD 2G5IC 5AY8B 1H3OA 3AZGA 4WU8A 3UTBA 5AY8D 3REKB 3LJAB 3AV1A 3NQJA 3LJAD 5B31B 5B33A 4WU9C 3WTPC 1EQZC 5B31D 4QLCB 3REJC 3AZJB 4JJNC 4NE3A 4QLCD 3AV2B 2BYKB 3AZJD 4WJ3C 5DNNB 3MNNA 4X23B 3C1BA 3MGQB 1KX5A 5DNND 4X23D 3MGQD 3AZFA 1TAFB 5B32B 2Y2MA 4UPKA 3MGSC 4WU9B 1EQZB 5B2JA 4WU9D 3V9RA 1BH8A 5BNXA 3WTPD 3REJB 4XUJA 1EQZD 4JJNB 1P34C 3REJD 2UWXA 2XD5A 5CPIA 3F6TA 4XZQC 4JJND 4YM6A 1P3IA 3AZIC 3X1SA 3KXBA 5B0YC 5B1LA 5BNVB 5AY8A 3AZMC 3FDDA 3MGSB 3MGSD 5B31A 3TU4C 1M19C 3LZ0B 1P3LC 4QLCA 2Y2QA 4XZQB 3B6GC 1P34D 3AZJA 4XZQD 5AV8A 4X23A 3MGQA 2Y2GA 5B0YB 3AZID 3LELC 1U35C 4WNNA 3W96C 1HQ3C 5B1MA 5B0YD 1TAFA 3O62C 3AZMB 2Y2PA 3AZMD 2Y2LA 3MGPB 5GXQC 1KX4C 4WU9A 1M19B 3WTPA 1EQZA 3B0CT 1P3LB 3TU4D 1M19D 3B6GB 1P3LD 1ULYA 2Y2OA 3B6GD 4HGAC 1M18A 2DF4C 3LELB 1U35B 3W96B 2F8NK 1HQ3B 4KGCC 3O62B 3LELD 3W96D 1WWSA 3AYWB 3W98C 3WAAC 3WA9B 2CWEA 5GXQB 3AFAC 1KX4B 5AV9C 5GXQD 4Z66C 1KX4D 2NZDC 3W97C 3EG5B 4H9PA 1P34A 4G91C 4HGAB 3X1VC 3REHC 4H9RB 1PZRA 3KUYB 3AZIA 3KWQB 4KGCB 3B0CW 3WKJA 4KGCD 4H9QB 3W98B 3WAAB 3AZMA 3W98D 3WAAD 3AFAB 3A1IA 5AV9B
chains in the Genus database with same CATH topology
4YS3A 3AFAD 4Z66B 5AVCA 2NZDB 5AV9D 3TU4A 4Z66D 3W97B 2NZDD 1B6WA 4G91B 3X1VB 4KUDC 5G49B 3AZLB 3KSYA 5GSUB 4H9NB 3X1VD 3REHD 1P3FC 1P3OA 3W96A 5AV5A 4KHAB 3EPJA 1F66A 3X1UC 1KX4A 3LZ1C 4KUDB 4KUDD 1HTAA 1P3FB 5JA4B 3A6NC 1P3FD 3H0MC 3X1TC 1ZLAC 3WAAA 1P3BC 3AFAA 3X1UB 3X1UD 4Z66A 3AN2C 2NZDA 3MVDC 3LZ1B 5GT0A 5AVBC 5B32G 3X1VA 3MGRC 5G49A 3REHA 2FJ7C 3A6NB 4H9NA 3AZNC 4J8UC 5B32C 3AZEC 3A6ND 3REKD 1JFIB 3UTAA 5CPKA 3X1TB 1Q9CA 1ZLAB 2CV5C 3X1TD 2ZY2A 1P3BB 1BH9A 1P3BD 2HIOC 3H0LC 3AN2B 3A1KA 3AV2D 1R4VA 3MVDB 3AN2D 2LY8A 5AVBB 5FUGB 3P5JB 5GT3C 3MGRB 2FJ7B 5AVBD 2G5HC 3AZNB 4J8UB 1P3FA 3AZEB 5JA4A 2FJ7D 4J8UD 5B32D 3AZED 2CV5B 1AOIC 3LZ0C 5KDMA 2HIOB 2Y2IA 3X1UA 2NQBC 2HIOD 2YFWA 2YFVB 2IO5C 4UUZB 4H9OA 2F8NB 5GT3B 2JCHA 5JRGC 2F8ND 5GT3D 1M1AC 4J8XC 5B2IC 3A6NA 3REKA 4CSRB 3LJAA 5B40C 3MGPC 1AOIB 1WWIA 4H9SC 1AOID 3LZ0D 3REIC 1W2EA 4Z5TC 2NQBB 3AV2A 2BYKA 5DNNA 2NQBD 2IO5B 2XD1A 4ZBJC 1KX3C 5BT1C 5JRGB 5AVBA 5FUGA 1M1AB 5JRGD 2FJ7A 4J8XB 5B2IB 3AYWC 1M1AD 5B40B 3WA9C 5B32A 1KU5A 5B2ID 3AZEA 5B40D 3MGPD 3RELC 1P3PB 3REJA 3REIB 4JJNA 4Z5TB 3REID 1S32C 2HIOA 4Z5TD 2PYOC 3EPLA 4ZBJB 1KX3B 3KUYC 1KX3D 3KWQC 5BT1D 1U35D 2F8NA 1HQ3D 3O62D 5BNVA 3AYWD 3MGSA 3WA9D 4J8WC 4Z2MG 5C3IC 5B0ZC 3RELB 5F99C 3RELD 3LZ0A 1S32B 4XZQA 3UT9B 1B67A 1S32D 3AZLC 2NQBA 5AV6C 5GSUC 1P3MC 2PYOB 2PYOD 5B0YA 3KUYD 1N1JB 4WZSB 3NQUB 3KWQD 5JRGA 4J8VC 2ZY4A 4J8WB 5C3IB 5B0ZB 4J8WD 3MGPA 5F99B 5B0ZD 4E44A 1M19A 4H9SA 3C1CC 4DRAA 1P3LA 3REIA 3B6GA 3W97D 1P3KC 3B0BA 1P3AC 2HUEC 2JSSA 5AV6B 2Y2HA 1P3MB 3AZLD 5AV6D 5GSUD 1P3MD 3LELA 1U35A 4J8VB 3AZGC 1HQ3A 3UTBC 3O62A 4J8VD 3AYWA 3WA9A 3WTPE 4LD9C 5B33C 4AWLC 5GXQA 3R45B 2BYMB 4DRBA 3EPKA 3C1CB 3C1CD 1P3KB 3B0DC 3C1BC 2HUEB 1S32A 1P3AB 1KX5C 1P3AD 3AZFC 4H9RA 2PYOA 3KUYA 1H3OB 3AZGB 3KWQA 3UTBB 4KGCA 3AZGD 3UTBD 4H9QA 3W98A 4LD9B 5B33B 4AWLB 2ZY3A 5B2JC 4LD9D 5B33D 5AV9A 4NE5A 3W97A 2ZM5A 3B0DB 3C1BB 4YM6C 3LZ1D 1KX5B 3C1BD 3AZFB 3AZLA 3X1SC 5AV6A 4EO5C 5GSUA 3VH5W 5E5AC 1P3MA 1KX5D 3B6FC 3EPHA 5B1LC 1BFMA 2BG1A 4J8VA 4KHAA 3W99C 1ZLAD 5B2JB 5BNXB 3R45A 2F8NH 2F8NG 3MVDD 3VH6T 5AV8C 4YM6B 4KUDA 3X1SB 1P3GC 1P3AA 4EO5B 3KXBB 3MGRD 5E5AB 3X1SD 3B6FB 5B1MC 5B1LB 5E5AD 3AZND 3B6FD 5B1LD 3AZKC 3W99B 3W99D 2CV5D 3AZHC 4LD9A 3VH6A 2FFFB 2J8PA 5AV8B 3LZ1A 1M18C 1P3GB 5AV8D 1P3GD 4WNNB 5B1MB 1JFIA 5B1MD 3AZKB 1TZYC 3AZKD 3X1TA 1P3PC 1ZLAA 3VH6W 3AZHB 5BO0B 1P3BA 3WTPB 3AZHD 4CAYB 3H0RC 2VQRA 3AL0C 3AN2A 3MVDA 1M18B 2Y2NA 1M18D 4DQYB 3MGRA 1ID3C 5E5AA 3AZNA 4J8XD 4J8UA 3B6FA 3WKJC 1TZYB 4ZUXC 1TZYD 3W99A 2CV5A 1P3PD 5CP6C 4YS3C 2Y2KA 5B24C 5AVCC 2ZY5A 3UT9C 4R8PC 4H9PB 1P34B 2YFVA 2AROC 4UUZA 3KFUG 5GT3A 3AZIB 5CPJC 1P3GA 1ID3B 1P3OC 1ID3D 5AV5C 3WKJB 4ZUXB 4CSRA 4Z2MH 3WKJD 4ZUXD 3AZKA 5BS7C 1AOIA 5CP6B 4G92C 4NFTA 4YS3B 5AVCB 2JE5A 5B24B 5CP6D 3AZHA 5BO0A 4YS3D 3TU4B 1F66C 5AVCD 5B24D 4R8PB 4CAYA 5DNMC 3UT9D 1T3UA 4R8PD 2AROB 2AROD 5CPJB 5CPJD 1P3OB 1M1AA 5AV5B 4J8XA 5CHLB 5B2IA 1P3OD 5B40A 5AV5D 1TZYA 4NE6A 5F99D 1P3PA 4G92B 2Y2JA 1F66B 1F66D 5DNMB 4Z5TA 5DNMD 5GT0C 1KX3A 4WU8C 3AV1C 1A7WA 4WV4B 2DQNC 1ID3A 3UTAC 5CPKC 3VH5T 4ZUXA 3RELA 3IP4C 2L5AA 5CP6A 5B24A 3MNNC 1F1EA 3UT9A 1P3KD 4R8PA 2F2AC 5GT0B 2AROA 5GT0D 3VH5A 3REHB 4WU8B 1N1JA 3AV1B 5CPJA 3NQUA 4WU8D 3NQJB 3AV1D 3UTAB 5CPKB 3UTAD 4J8WA 2RVQC 5CPKD 5B0ZA 4XUJC 5F99A 5BS7A 1BH9B 2W8SA 5CPIC 4M6BA 3MNNB 1P3IC 3MNND 5DNMA 1Z2CB 3KXBC 3AZFD 5AY8C 5B31G 3REKC 2RIQA 3LJAC 5B31C 3V9RB 1BH8B 2RVQD 4E45A 5KDMB 5B2JD 4XUJB 2BYMA 5CPIB 4XUJD 4QLCC 3C1CA 3AZJC 5CPID 2YFWB 3AV2C 1P3IB 5DNNC 1P3KA 4YM6D 4X23C 3MGQC 1P3ID 4H9OB 3KXBD 2G5IC 5AY8B 1H3OA 3AZGA 4WU8A 3UTBA 5AY8D 3REKB 3LJAB 3AV1A 3NQJA 3LJAD 5B31B 5B33A 4WU9C 3WTPC 1EQZC 5B31D 4QLCB 3REJC 3AZJB 4JJNC 4NE3A 4QLCD 3AV2B 2BYKB 3AZJD 4WJ3C 5DNNB 3MNNA 4X23B 3C1BA 3MGQB 1KX5A 5DNND 4X23D 3MGQD 3AZFA 1TAFB 5B32B 2Y2MA 4UPKA 3MGSC 4WU9B 1EQZB 5B2JA 4WU9D 3V9RA 1BH8A 5BNXA 3WTPD 3REJB 4XUJA 1EQZD 4JJNB 1P34C 3REJD 2UWXA 2XD5A 5CPIA 3F6TA 4XZQC 4JJND 4YM6A 1P3IA 3AZIC 3X1SA 3KXBA 5B0YC 5B1LA 5BNVB 5AY8A 3AZMC 3FDDA 3MGSB 3MGSD 5B31A 3TU4C 1M19C 3LZ0B 1P3LC 4QLCA 2Y2QA 4XZQB 3B6GC 1P34D 3AZJA 4XZQD 5AV8A 4X23A 3MGQA 2Y2GA 5B0YB 3AZID 3LELC 1U35C 4WNNA 3W96C 1HQ3C 5B1MA 5B0YD 1TAFA 3O62C 3AZMB 2Y2PA 3AZMD 2Y2LA 3MGPB 5GXQC 1KX4C 4WU9A 1M19B 3WTPA 1EQZA 3B0CT 1P3LB 3TU4D 1M19D 3B6GB 1P3LD 1ULYA 2Y2OA 3B6GD 4HGAC 1M18A 2DF4C 3LELB 1U35B 3W96B 2F8NK 1HQ3B 4KGCC 3O62B 3LELD 3W96D 1WWSA 3AYWB 3W98C 3WAAC 3WA9B 2CWEA 5GXQB 3AFAC 1KX4B 5AV9C 5GXQD 4Z66C 1KX4D 2NZDC 3W97C 3EG5B 4H9PA 1P34A 4G91C 4HGAB 3X1VC 3REHC 4H9RB 1PZRA 3KUYB 3AZIA 3KWQB 4KGCB 3B0CW 3WKJA 4KGCD 4H9QB 3W98B 3WAAB 3AZMA 3W98D 3WAAD 3AFAB 3A1IA 5AV9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS3 A;  3AFA D;  4Z66 B;  5AVC A;  2NZD B;  5AV9 D;  3TU4 A;  4Z66 D;  3W97 B;  2NZD D;  1B6W A;  4G91 B;  3X1V B;  4KUD C;  5G49 B;  3AZL B;  3KSY A;  5GSU B;  4H9N B;  3X1V D;  3REH D;  1P3F C;  1P3O A;  3W96 A;  5AV5 A;  4KHA B;  1F66 A;  3X1U C;  1KX4 A;  3LZ1 C;  4KUD B;  4KUD D;  1HTA A;  1P3F B;  5JA4 B;  3A6N C;  1P3F D;  3X1T C;  1ZLA C;  3WAA A;  1P3B C;  3AFA A;  3X1U B;  4Z66 A;  3X1U D;  3AN2 C;  2NZD A;  3MVD C;  3LZ1 B;  5GT0 A;  5AVB C;  5B32 G;  3X1V A;  3MGR C;  5G49 A;  3REH A;  2FJ7 C;  3A6N B;  4H9N A;  3AZN C;  4J8U C;  5B32 C;  3AZE C;  3A6N D;  3REK D;  1JFI B;  3UTA A;  5CPK A;  3X1T B;  1Q9C A;  1ZLA B;  2CV5 C;  3X1T D;  1P3B B;  1BH9 A;  1P3B D;  2HIO C;  3AN2 B;  3AV2 D;  1R4V A;  3MVD B;  3AN2 D;  2LY8 A;  5AVB B;  5FUG B;  3MGR B;  5GT3 C;  2FJ7 B;  5AVB D;  3AZN B;  4J8U B;  1P3F A;  3AZE B;  5JA4 A;  2FJ7 D;  4J8U D;  5B32 D;  3AZE D;  2CV5 B;  1AOI C;  3LZ0 C;  5KDM A;  2HIO B;  3X1U A;  2NQB C;  2HIO D;  2YFW A;  2YFV B;  2IO5 C;  4UUZ B;  4H9O A;  2F8N B;  5GT3 B;  5JRG C;  2F8N D;  5GT3 D;  1M1A C;  4J8X C;  5B2I C;  3A6N A;  3REK A;  4CSR B;  3LJA A;  5B40 C;  3MGP C;  1AOI B;  1WWI A;  4H9S C;  1AOI D;  3LZ0 D;  3REI C;  4Z5T C;  2NQB B;  3AV2 A;  2BYK A;  5DNN A;  2NQB D;  2IO5 B;  4ZBJ C;  1KX3 C;  5BT1 C;  5JRG B;  5AVB A;  5FUG A;  1M1A B;  5JRG D;  2FJ7 A;  4J8X B;  5B2I B;  3AYW C;  1M1A D;  5B40 B;  3WA9 C;  5B32 A;  1KU5 A;  5B2I D;  3AZE A;  5B40 D;  3MGP D;  3REL C;  1P3P B;  3REJ A;  3REI B;  4JJN A;  4Z5T B;  3REI D;  1S32 C;  2HIO A;  4Z5T D;  2PYO C;  4ZBJ B;  1KX3 B;  3KUY C;  1KX3 D;  3KWQ C;  5BT1 D;  1U35 D;  2F8N A;  1HQ3 D;  3O62 D;  5BNV A;  3AYW D;  3MGS A;  3WA9 D;  4J8W C;  4Z2M G;  5C3I C;  5B0Z C;  3REL B;  5F99 C;  3REL D;  3LZ0 A;  1S32 B;  4XZQ A;  3UT9 B;  1B67 A;  1S32 D;  3AZL C;  2NQB A;  5AV6 C;  5GSU C;  1P3M C;  2PYO B;  2PYO D;  5B0Y A;  3KUY D;  1N1J B;  4WZS B;  3NQU B;  3KWQ D;  5JRG A;  4J8V C;  4J8W B;  5C3I B;  5B0Z B;  4J8W D;  3MGP A;  5F99 B;  5B0Z D;  4E44 A;  1M19 A;  4H9S A;  3C1C C;  4DRA A;  1P3L A;  3REI A;  3B6G A;  3W97 D;  1P3K C;  3B0B A;  1P3A C;  2HUE C;  2JSS A;  5AV6 B;  1P3M B;  3AZL D;  5AV6 D;  5GSU D;  1P3M D;  3LEL A;  1U35 A;  4J8V B;  3AZG C;  1HQ3 A;  3UTB C;  3O62 A;  4J8V D;  3AYW A;  3WA9 A;  3WTP E;  4LD9 C;  5B33 C;  4AWL C;  5GXQ A;  3R45 B;  2BYM B;  4DRB A;  3C1C B;  3C1C D;  1P3K B;  3B0D C;  3C1B C;  2HUE B;  1S32 A;  1P3A B;  1KX5 C;  1P3A D;  3AZF C;  4H9R A;  2PYO A;  3KUY A;  1H3O B;  3AZG B;  3KWQ A;  3UTB B;  4KGC A;  3AZG D;  3UTB D;  4H9Q A;  3W98 A;  4LD9 B;  5B33 B;  4AWL B;  5B2J C;  4LD9 D;  5B33 D;  5AV9 A;  4NE5 A;  3W97 A;  3B0D B;  3C1B B;  4YM6 C;  3LZ1 D;  1KX5 B;  3C1B D;  3AZF B;  3AZL A;  3X1S C;  5AV6 A;  4EO5 C;  5GSU A;  3VH5 W;  5E5A C;  1P3M A;  1KX5 D;  3B6F C;  5B1L C;  1BFM A;  4J8V A;  4KHA A;  3W99 C;  1ZLA D;  5B2J B;  5BNX B;  3R45 A;  2F8N H;  2F8N G;  3MVD D;  3VH6 T;  5AV8 C;  4YM6 B;  4KUD A;  3X1S B;  1P3G C;  1P3A A;  4EO5 B;  3KXB B;  3MGR D;  5E5A B;  3X1S D;  3B6F B;  5B1M C;  5B1L B;  5E5A D;  3AZN D;  3B6F D;  5B1L D;  3AZK C;  3W99 B;  3W99 D;  2CV5 D;  3AZH C;  4LD9 A;  3VH6 A;  5AV8 B;  3LZ1 A;  1M18 C;  1P3G B;  5AV8 D;  1P3G D;  4WNN B;  5B1M B;  1JFI A;  5B1M D;  3AZK B;  1TZY C;  3AZK D;  3X1T A;  1P3P C;  1ZLA A;  3VH6 W;  3AZH B;  5BO0 B;  1P3B A;  3WTP B;  3AZH D;  4CAY B;  3AN2 A;  3MVD A;  1M18 B;  1M18 D;  3MGR A;  1ID3 C;  5E5A A;  3AZN A;  4J8X D;  4J8U A;  3B6F A;  3WKJ C;  1TZY B;  4ZUX C;  1TZY D;  3W99 A;  2CV5 A;  1P3P D;  5CP6 C;  4YS3 C;  5B24 C;  5AVC C;  3UT9 C;  4R8P C;  4H9P B;  1P34 B;  2YFV A;  2ARO C;  4UUZ A;  5GT3 A;  3AZI B;  5CPJ C;  1P3G A;  1ID3 B;  1P3O C;  1ID3 D;  5AV5 C;  3WKJ B;  4ZUX B;  4CSR A;  4Z2M H;  3WKJ D;  4ZUX D;  3AZK A;  5BS7 C;  1AOI A;  5CP6 B;  4G92 C;  4NFT A;  4YS3 B;  5AVC B;  5B24 B;  3AZH A;  5CP6 D;  1F66 C;  5BO0 A;  4YS3 D;  3TU4 B;  5AVC D;  5B24 D;  4R8P B;  4CAY A;  5DNM C;  3UT9 D;  4R8P D;  2ARO B;  2ARO D;  5CPJ B;  5CPJ D;  1P3O B;  1M1A A;  5AV5 B;  4J8X A;  5CHL B;  5B2I A;  1P3O D;  5B40 A;  5AV5 D;  1TZY A;  4NE6 A;  5F99 D;  1P3P A;  4G92 B;  1F66 B;  1F66 D;  5DNM B;  4Z5T A;  5DNM D;  5GT0 C;  1KX3 A;  4WU8 C;  3AV1 C;  1A7W A;  4WV4 B;  1ID3 A;  3UTA C;  5CPK C;  3VH5 T;  4ZUX A;  3REL A;  2L5A A;  5CP6 A;  5B24 A;  3MNN C;  1F1E A;  3UT9 A;  1P3K D;  4R8P A;  5GT0 B;  2ARO A;  5GT0 D;  3VH5 A;  3REH B;  4WU8 B;  1N1J A;  3AV1 B;  5CPJ A;  3NQU A;  4WU8 D;  3NQJ B;  3AV1 D;  3UTA B;  5CPK B;  3UTA D;  4J8W A;  2RVQ C;  5CPK D;  5B0Z A;  4XUJ C;  5F99 A;  5BS7 A;  1BH9 B;  5CPI C;  4M6B A;  3MNN B;  1P3I C;  3MNN D;  5DNM A;  3KXB C;  3AZF D;  5AY8 C;  5B31 G;  3REK C;  3LJA C;  5B31 C;  3V9R B;  1BH8 B;  2RVQ D;  4E45 A;  5KDM B;  5B2J D;  4XUJ B;  2BYM A;  5CPI B;  4XUJ D;  4QLC C;  3C1C A;  3AZJ C;  5CPI D;  2YFW B;  3AV2 C;  1P3I B;  5DNN C;  1P3K A;  4YM6 D;  4X23 C;  3MGQ C;  1P3I D;  4H9O B;  3KXB D;  5AY8 B;  1H3O A;  3AZG A;  4WU8 A;  3UTB A;  5AY8 D;  3REK B;  3LJA B;  3AV1 A;  3NQJ A;  3LJA D;  5B31 B;  5B33 A;  4WU9 C;  3WTP C;  1EQZ C;  5B31 D;  4QLC B;  3REJ C;  3AZJ B;  4JJN C;  4NE3 A;  4QLC D;  3AV2 B;  2BYK B;  3AZJ D;  5DNN B;  3MNN A;  4X23 B;  3C1B A;  3MGQ B;  1KX5 A;  5DNN D;  4X23 D;  3MGQ D;  3AZF A;  1TAF B;  5B32 B;  3MGS C;  4WU9 B;  1EQZ B;  5B2J A;  4WU9 D;  3V9R A;  1BH8 A;  5BNX A;  3WTP D;  3REJ B;  4XUJ A;  1EQZ D;  4JJN B;  1P34 C;  3REJ D;  5CPI A;  4XZQ C;  4JJN D;  4YM6 A;  1P3I A;  3AZI C;  3X1S A;  3KXB A;  5B0Y C;  5B1L A;  5BNV B;  5AY8 A;  3AZM C;  3MGS B;  3MGS D;  5B31 A;  3TU4 C;  1M19 C;  3LZ0 B;  1P3L C;  4QLC A;  4XZQ B;  3B6G C;  1P34 D;  3AZJ A;  4XZQ D;  5AV8 A;  4X23 A;  3MGQ A;  5B0Y B;  3AZI D;  3LEL C;  1U35 C;  4WNN A;  3W96 C;  1HQ3 C;  5B1M A;  5B0Y D;  1TAF A;  3O62 C;  3AZM B;  3AZM D;  3MGP B;  5GXQ C;  1KX4 C;  4WU9 A;  1M19 B;  3WTP A;  1EQZ A;  3B0C T;  1P3L B;  3TU4 D;  1M19 D;  3B6G B;  1P3L D;  1ULY A;  3B6G D;  4HGA C;  1M18 A;  3LEL B;  1U35 B;  3W96 B;  2F8N K;  1HQ3 B;  4KGC C;  3O62 B;  3LEL D;  3W96 D;  1WWS A;  3AYW B;  3W98 C;  3WAA C;  3WA9 B;  2CWE A;  5GXQ B;  3AFA C;  1KX4 B;  5AV9 C;  5GXQ D;  4Z66 C;  1KX4 D;  2NZD C;  3W97 C;  4H9P A;  1P34 A;  4G91 C;  4HGA B;  3X1V C;  3REH C;  4H9R B;  3KUY B;  3AZI A;  3KWQ B;  4KGC B;  3B0C W;  3WKJ A;  4KGC D;  4H9Q B;  3W98 B;  3WAA B;  3AZM A;  3W98 D;  3WAA D;  3AFA B;  5AV9 B; 
#chains in the Genus database with same CATH topology
 4YS3 A;  3AFA D;  4Z66 B;  5AVC A;  2NZD B;  5AV9 D;  3TU4 A;  4Z66 D;  3W97 B;  2NZD D;  1B6W A;  4G91 B;  3X1V B;  4KUD C;  5G49 B;  3AZL B;  3KSY A;  5GSU B;  4H9N B;  3X1V D;  3REH D;  1P3F C;  1P3O A;  3W96 A;  5AV5 A;  4KHA B;  3EPJ A;  1F66 A;  3X1U C;  1KX4 A;  3LZ1 C;  4KUD B;  4KUD D;  1HTA A;  1P3F B;  5JA4 B;  3A6N C;  1P3F D;  3H0M C;  3X1T C;  1ZLA C;  3WAA A;  1P3B C;  3AFA A;  3X1U B;  3X1U D;  4Z66 A;  3AN2 C;  2NZD A;  3MVD C;  3LZ1 B;  5GT0 A;  5AVB C;  5B32 G;  3X1V A;  3MGR C;  5G49 A;  3REH A;  2FJ7 C;  3A6N B;  4H9N A;  3AZN C;  4J8U C;  5B32 C;  3AZE C;  3A6N D;  3REK D;  1JFI B;  3UTA A;  5CPK A;  3X1T B;  1Q9C A;  1ZLA B;  2CV5 C;  3X1T D;  2ZY2 A;  1P3B B;  1BH9 A;  1P3B D;  2HIO C;  3H0L C;  3AN2 B;  3A1K A;  3AV2 D;  1R4V A;  3MVD B;  3AN2 D;  2LY8 A;  5AVB B;  5FUG B;  3P5J B;  5GT3 C;  3MGR B;  2FJ7 B;  5AVB D;  2G5H C;  3AZN B;  4J8U B;  1P3F A;  3AZE B;  5JA4 A;  2FJ7 D;  4J8U D;  5B32 D;  3AZE D;  2CV5 B;  1AOI C;  3LZ0 C;  5KDM A;  2HIO B;  2Y2I A;  3X1U A;  2NQB C;  2HIO D;  2YFW A;  2YFV B;  2IO5 C;  4UUZ B;  4H9O A;  2F8N B;  5GT3 B;  2JCH A;  5JRG C;  2F8N D;  5GT3 D;  1M1A C;  4J8X C;  5B2I C;  3A6N A;  3REK A;  4CSR B;  3LJA A;  5B40 C;  3MGP C;  1AOI B;  1WWI A;  4H9S C;  1AOI D;  3LZ0 D;  3REI C;  1W2E A;  4Z5T C;  2NQB B;  3AV2 A;  2BYK A;  5DNN A;  2NQB D;  2IO5 B;  2XD1 A;  4ZBJ C;  1KX3 C;  5BT1 C;  5JRG B;  5AVB A;  5FUG A;  1M1A B;  5JRG D;  2FJ7 A;  4J8X B;  5B2I B;  3AYW C;  1M1A D;  5B40 B;  3WA9 C;  5B32 A;  1KU5 A;  5B2I D;  3AZE A;  5B40 D;  3MGP D;  3REL C;  1P3P B;  3REJ A;  3REI B;  4JJN A;  4Z5T B;  3REI D;  1S32 C;  2HIO A;  4Z5T D;  2PYO C;  3EPL A;  4ZBJ B;  1KX3 B;  3KUY C;  1KX3 D;  3KWQ C;  5BT1 D;  1U35 D;  2F8N A;  1HQ3 D;  3O62 D;  5BNV A;  3AYW D;  3MGS A;  3WA9 D;  4J8W C;  4Z2M G;  5C3I C;  5B0Z C;  3REL B;  5F99 C;  3REL D;  3LZ0 A;  1S32 B;  4XZQ A;  3UT9 B;  1B67 A;  1S32 D;  3AZL C;  2NQB A;  5AV6 C;  5GSU C;  1P3M C;  2PYO B;  2PYO D;  5B0Y A;  3KUY D;  1N1J B;  4WZS B;  3NQU B;  3KWQ D;  5JRG A;  4J8V C;  2ZY4 A;  4J8W B;  5C3I B;  5B0Z B;  4J8W D;  3MGP A;  5F99 B;  5B0Z D;  4E44 A;  1M19 A;  4H9S A;  3C1C C;  4DRA A;  1P3L A;  3REI A;  3B6G A;  3W97 D;  1P3K C;  3B0B A;  1P3A C;  2HUE C;  2JSS A;  5AV6 B;  2Y2H A;  1P3M B;  3AZL D;  5AV6 D;  5GSU D;  1P3M D;  3LEL A;  1U35 A;  4J8V B;  3AZG C;  1HQ3 A;  3UTB C;  3O62 A;  4J8V D;  3AYW A;  3WA9 A;  3WTP E;  4LD9 C;  5B33 C;  4AWL C;  5GXQ A;  3R45 B;  2BYM B;  4DRB A;  3EPK A;  3C1C B;  3C1C D;  1P3K B;  3B0D C;  3C1B C;  2HUE B;  1S32 A;  1P3A B;  1KX5 C;  1P3A D;  3AZF C;  4H9R A;  2PYO A;  3KUY A;  1H3O B;  3AZG B;  3KWQ A;  3UTB B;  4KGC A;  3AZG D;  3UTB D;  4H9Q A;  3W98 A;  4LD9 B;  5B33 B;  4AWL B;  2ZY3 A;  5B2J C;  4LD9 D;  5B33 D;  5AV9 A;  4NE5 A;  3W97 A;  2ZM5 A;  3B0D B;  3C1B B;  4YM6 C;  3LZ1 D;  1KX5 B;  3C1B D;  3AZF B;  3AZL A;  3X1S C;  5AV6 A;  4EO5 C;  5GSU A;  3VH5 W;  5E5A C;  1P3M A;  1KX5 D;  3B6F C;  3EPH A;  5B1L C;  1BFM A;  2BG1 A;  4J8V A;  4KHA A;  3W99 C;  1ZLA D;  5B2J B;  5BNX B;  3R45 A;  2F8N H;  2F8N G;  3MVD D;  3VH6 T;  5AV8 C;  4YM6 B;  4KUD A;  3X1S B;  1P3G C;  1P3A A;  4EO5 B;  3KXB B;  3MGR D;  5E5A B;  3X1S D;  3B6F B;  5B1M C;  5B1L B;  5E5A D;  3AZN D;  3B6F D;  5B1L D;  3AZK C;  3W99 B;  3W99 D;  2CV5 D;  3AZH C;  4LD9 A;  3VH6 A;  2FFF B;  2J8P A;  5AV8 B;  3LZ1 A;  1M18 C;  1P3G B;  5AV8 D;  1P3G D;  4WNN B;  5B1M B;  1JFI A;  5B1M D;  3AZK B;  1TZY C;  3AZK D;  3X1T A;  1P3P C;  1ZLA A;  3VH6 W;  3AZH B;  5BO0 B;  1P3B A;  3WTP B;  3AZH D;  4CAY B;  3H0R C;  2VQR A;  3AL0 C;  3AN2 A;  3MVD A;  1M18 B;  2Y2N A;  1M18 D;  4DQY B;  3MGR A;  1ID3 C;  5E5A A;  3AZN A;  4J8X D;  4J8U A;  3B6F A;  3WKJ C;  1TZY B;  4ZUX C;  1TZY D;  3W99 A;  2CV5 A;  1P3P D;  5CP6 C;  4YS3 C;  2Y2K A;  5B24 C;  5AVC C;  2ZY5 A;  3UT9 C;  4R8P C;  4H9P B;  1P34 B;  2YFV A;  2ARO C;  4UUZ A;  3KFU G;  5GT3 A;  3AZI B;  5CPJ C;  1P3G A;  1ID3 B;  1P3O C;  1ID3 D;  5AV5 C;  3WKJ B;  4ZUX B;  4CSR A;  4Z2M H;  3WKJ D;  4ZUX D;  3AZK A;  5BS7 C;  1AOI A;  5CP6 B;  4G92 C;  4NFT A;  4YS3 B;  5AVC B;  2JE5 A;  5B24 B;  5CP6 D;  3AZH A;  5BO0 A;  4YS3 D;  3TU4 B;  1F66 C;  5AVC D;  5B24 D;  4R8P B;  4CAY A;  5DNM C;  3UT9 D;  1T3U A;  4R8P D;  2ARO B;  2ARO D;  5CPJ B;  5CPJ D;  1P3O B;  1M1A A;  5AV5 B;  4J8X A;  5CHL B;  5B2I A;  1P3O D;  5B40 A;  5AV5 D;  1TZY A;  4NE6 A;  5F99 D;  1P3P A;  4G92 B;  2Y2J A;  1F66 B;  1F66 D;  5DNM B;  4Z5T A;  5DNM D;  5GT0 C;  1KX3 A;  4WU8 C;  3AV1 C;  1A7W A;  4WV4 B;  2DQN C;  1ID3 A;  3UTA C;  5CPK C;  3VH5 T;  4ZUX A;  3REL A;  3IP4 C;  2L5A A;  5CP6 A;  5B24 A;  3MNN C;  1F1E A;  3UT9 A;  1P3K D;  4R8P A;  2F2A C;  5GT0 B;  2ARO A;  5GT0 D;  3VH5 A;  3REH B;  4WU8 B;  1N1J A;  3AV1 B;  5CPJ A;  3NQU A;  4WU8 D;  3NQJ B;  3AV1 D;  3UTA B;  5CPK B;  3UTA D;  4J8W A;  2RVQ C;  5CPK D;  5B0Z A;  4XUJ C;  5F99 A;  5BS7 A;  1BH9 B;  2W8S A;  5CPI C;  4M6B A;  3MNN B;  1P3I C;  3MNN D;  5DNM A;  1Z2C B;  3KXB C;  3AZF D;  5AY8 C;  5B31 G;  3REK C;  2RIQ A;  3LJA C;  5B31 C;  3V9R B;  1BH8 B;  2RVQ D;  4E45 A;  5KDM B;  5B2J D;  4XUJ B;  2BYM A;  5CPI B;  4XUJ D;  4QLC C;  3C1C A;  3AZJ C;  5CPI D;  2YFW B;  3AV2 C;  1P3I B;  5DNN C;  1P3K A;  4YM6 D;  4X23 C;  3MGQ C;  1P3I D;  4H9O B;  3KXB D;  2G5I C;  5AY8 B;  1H3O A;  3AZG A;  4WU8 A;  3UTB A;  5AY8 D;  3REK B;  3LJA B;  3AV1 A;  3NQJ A;  3LJA D;  5B31 B;  5B33 A;  4WU9 C;  3WTP C;  1EQZ C;  5B31 D;  4QLC B;  3REJ C;  3AZJ B;  4JJN C;  4NE3 A;  4QLC D;  3AV2 B;  2BYK B;  3AZJ D;  4WJ3 C;  5DNN B;  3MNN A;  4X23 B;  3C1B A;  3MGQ B;  1KX5 A;  5DNN D;  4X23 D;  3MGQ D;  3AZF A;  1TAF B;  5B32 B;  2Y2M A;  4UPK A;  3MGS C;  4WU9 B;  1EQZ B;  5B2J A;  4WU9 D;  3V9R A;  1BH8 A;  5BNX A;  3WTP D;  3REJ B;  4XUJ A;  1EQZ D;  4JJN B;  1P34 C;  3REJ D;  2UWX A;  2XD5 A;  5CPI A;  3F6T A;  4XZQ C;  4JJN D;  4YM6 A;  1P3I A;  3AZI C;  3X1S A;  3KXB A;  5B0Y C;  5B1L A;  5BNV B;  5AY8 A;  3AZM C;  3FDD A;  3MGS B;  3MGS D;  5B31 A;  3TU4 C;  1M19 C;  3LZ0 B;  1P3L C;  4QLC A;  2Y2Q A;  4XZQ B;  3B6G C;  1P34 D;  3AZJ A;  4XZQ D;  5AV8 A;  4X23 A;  3MGQ A;  2Y2G A;  5B0Y B;  3AZI D;  3LEL C;  1U35 C;  4WNN A;  3W96 C;  1HQ3 C;  5B1M A;  5B0Y D;  1TAF A;  3O62 C;  3AZM B;  2Y2P A;  3AZM D;  2Y2L A;  3MGP B;  5GXQ C;  1KX4 C;  4WU9 A;  1M19 B;  3WTP A;  1EQZ A;  3B0C T;  1P3L B;  3TU4 D;  1M19 D;  3B6G B;  1P3L D;  1ULY A;  2Y2O A;  3B6G D;  4HGA C;  1M18 A;  2DF4 C;  3LEL B;  1U35 B;  3W96 B;  2F8N K;  1HQ3 B;  4KGC C;  3O62 B;  3LEL D;  3W96 D;  1WWS A;  3AYW B;  3W98 C;  3WAA C;  3WA9 B;  2CWE A;  5GXQ B;  3AFA C;  1KX4 B;  5AV9 C;  5GXQ D;  4Z66 C;  1KX4 D;  2NZD C;  3W97 C;  3EG5 B;  4H9P A;  1P34 A;  4G91 C;  4HGA B;  3X1V C;  3REH C;  4H9R B;  1PZR A;  3KUY B;  3AZI A;  3KWQ B;  4KGC B;  3B0C W;  3WKJ A;  4KGC D;  4H9Q B;  3W98 B;  3WAA B;  3AZM A;  3W98 D;  3WAA D;  3AFA B;  3A1I A;  5AV9 B; 
#chains in the Genus database with same CATH homology
 4YS3 A;  3AFA D;  4Z66 B;  5AVC A;  2NZD B;  5AV9 D;  3TU4 A;  4Z66 D;  3W97 B;  2NZD D;  1B6W A;  4G91 B;  3X1V B;  4KUD C;  5G49 B;  3AZL B;  3KSY A;  5GSU B;  4H9N B;  3X1V D;  3REH D;  1P3F C;  1P3O A;  3W96 A;  5AV5 A;  4KHA B;  3EPJ A;  1F66 A;  3X1U C;  1KX4 A;  3LZ1 C;  4KUD B;  4KUD D;  1HTA A;  1P3F B;  5JA4 B;  3A6N C;  1P3F D;  3H0M C;  3X1T C;  1ZLA C;  3WAA A;  1P3B C;  3AFA A;  3X1U B;  3X1U D;  4Z66 A;  3AN2 C;  2NZD A;  3MVD C;  3LZ1 B;  5GT0 A;  5AVB C;  5B32 G;  3X1V A;  3MGR C;  5G49 A;  3REH A;  2FJ7 C;  3A6N B;  4H9N A;  3AZN C;  4J8U C;  5B32 C;  3AZE C;  3A6N D;  3REK D;  1JFI B;  3UTA A;  5CPK A;  3X1T B;  1Q9C A;  1ZLA B;  2CV5 C;  3X1T D;  2ZY2 A;  1P3B B;  1BH9 A;  1P3B D;  2HIO C;  3H0L C;  3AN2 B;  3A1K A;  3AV2 D;  1R4V A;  3MVD B;  3AN2 D;  2LY8 A;  5AVB B;  5FUG B;  3P5J B;  5GT3 C;  3MGR B;  2FJ7 B;  5AVB D;  2G5H C;  3AZN B;  4J8U B;  1P3F A;  3AZE B;  5JA4 A;  2FJ7 D;  4J8U D;  5B32 D;  3AZE D;  2CV5 B;  1AOI C;  3LZ0 C;  5KDM A;  2HIO B;  2Y2I A;  3X1U A;  2NQB C;  2HIO D;  2YFW A;  2YFV B;  2IO5 C;  4UUZ B;  4H9O A;  2F8N B;  5GT3 B;  2JCH A;  5JRG C;  2F8N D;  5GT3 D;  1M1A C;  4J8X C;  5B2I C;  3A6N A;  3REK A;  4CSR B;  3LJA A;  5B40 C;  3MGP C;  1AOI B;  1WWI A;  4H9S C;  1AOI D;  3LZ0 D;  3REI C;  1W2E A;  4Z5T C;  2NQB B;  3AV2 A;  2BYK A;  5DNN A;  2NQB D;  2IO5 B;  2XD1 A;  4ZBJ C;  1KX3 C;  5BT1 C;  5JRG B;  5AVB A;  5FUG A;  1M1A B;  5JRG D;  2FJ7 A;  4J8X B;  5B2I B;  3AYW C;  1M1A D;  5B40 B;  3WA9 C;  5B32 A;  1KU5 A;  5B2I D;  3AZE A;  5B40 D;  3MGP D;  3REL C;  1P3P B;  3REJ A;  3REI B;  4JJN A;  4Z5T B;  3REI D;  1S32 C;  2HIO A;  4Z5T D;  2PYO C;  3EPL A;  4ZBJ B;  1KX3 B;  3KUY C;  1KX3 D;  3KWQ C;  5BT1 D;  1U35 D;  2F8N A;  1HQ3 D;  3O62 D;  5BNV A;  3AYW D;  3MGS A;  3WA9 D;  4J8W C;  4Z2M G;  5C3I C;  5B0Z C;  3REL B;  5F99 C;  3REL D;  3LZ0 A;  1S32 B;  4XZQ A;  3UT9 B;  1B67 A;  1S32 D;  3AZL C;  2NQB A;  5AV6 C;  5GSU C;  1P3M C;  2PYO B;  2PYO D;  5B0Y A;  3KUY D;  1N1J B;  4WZS B;  3NQU B;  3KWQ D;  5JRG A;  4J8V C;  2ZY4 A;  4J8W B;  5C3I B;  5B0Z B;  4J8W D;  3MGP A;  5F99 B;  5B0Z D;  4E44 A;  1M19 A;  4H9S A;  3C1C C;  4DRA A;  1P3L A;  3REI A;  3B6G A;  3W97 D;  1P3K C;  3B0B A;  1P3A C;  2HUE C;  2JSS A;  5AV6 B;  2Y2H A;  1P3M B;  3AZL D;  5AV6 D;  5GSU D;  1P3M D;  3LEL A;  1U35 A;  4J8V B;  3AZG C;  1HQ3 A;  3UTB C;  3O62 A;  4J8V D;  3AYW A;  3WA9 A;  3WTP E;  4LD9 C;  5B33 C;  4AWL C;  5GXQ A;  3R45 B;  2BYM B;  4DRB A;  3EPK A;  3C1C B;  3C1C D;  1P3K B;  3B0D C;  3C1B C;  2HUE B;  1S32 A;  1P3A B;  1KX5 C;  1P3A D;  3AZF C;  4H9R A;  2PYO A;  3KUY A;  1H3O B;  3AZG B;  3KWQ A;  3UTB B;  4KGC A;  3AZG D;  3UTB D;  4H9Q A;  3W98 A;  4LD9 B;  5B33 B;  4AWL B;  2ZY3 A;  5B2J C;  4LD9 D;  5B33 D;  5AV9 A;  4NE5 A;  3W97 A;  2ZM5 A;  3B0D B;  3C1B B;  4YM6 C;  3LZ1 D;  1KX5 B;  3C1B D;  3AZF B;  3AZL A;  3X1S C;  5AV6 A;  4EO5 C;  5GSU A;  3VH5 W;  5E5A C;  1P3M A;  1KX5 D;  3B6F C;  3EPH A;  5B1L C;  1BFM A;  2BG1 A;  4J8V A;  4KHA A;  3W99 C;  1ZLA D;  5B2J B;  5BNX B;  3R45 A;  2F8N H;  2F8N G;  3MVD D;  3VH6 T;  5AV8 C;  4YM6 B;  4KUD A;  3X1S B;  1P3G C;  1P3A A;  4EO5 B;  3KXB B;  3MGR D;  5E5A B;  3X1S D;  3B6F B;  5B1M C;  5B1L B;  5E5A D;  3AZN D;  3B6F D;  5B1L D;  3AZK C;  3W99 B;  3W99 D;  2CV5 D;  3AZH C;  4LD9 A;  3VH6 A;  2FFF B;  2J8P A;  5AV8 B;  3LZ1 A;  1M18 C;  1P3G B;  5AV8 D;  1P3G D;  4WNN B;  5B1M B;  1JFI A;  5B1M D;  3AZK B;  1TZY C;  3AZK D;  3X1T A;  1P3P C;  1ZLA A;  3VH6 W;  3AZH B;  5BO0 B;  1P3B A;  3WTP B;  3AZH D;  4CAY B;  3H0R C;  2VQR A;  3AL0 C;  3AN2 A;  3MVD A;  1M18 B;  2Y2N A;  1M18 D;  4DQY B;  3MGR A;  1ID3 C;  5E5A A;  3AZN A;  4J8X D;  4J8U A;  3B6F A;  3WKJ C;  1TZY B;  4ZUX C;  1TZY D;  3W99 A;  2CV5 A;  1P3P D;  5CP6 C;  4YS3 C;  2Y2K A;  5B24 C;  5AVC C;  2ZY5 A;  3UT9 C;  4R8P C;  4H9P B;  1P34 B;  2YFV A;  2ARO C;  4UUZ A;  3KFU G;  5GT3 A;  3AZI B;  5CPJ C;  1P3G A;  1ID3 B;  1P3O C;  1ID3 D;  5AV5 C;  3WKJ B;  4ZUX B;  4CSR A;  4Z2M H;  3WKJ D;  4ZUX D;  3AZK A;  5BS7 C;  1AOI A;  5CP6 B;  4G92 C;  4NFT A;  4YS3 B;  5AVC B;  2JE5 A;  5B24 B;  5CP6 D;  3AZH A;  5BO0 A;  4YS3 D;  3TU4 B;  1F66 C;  5AVC D;  5B24 D;  4R8P B;  4CAY A;  5DNM C;  3UT9 D;  1T3U A;  4R8P D;  2ARO B;  2ARO D;  5CPJ B;  5CPJ D;  1P3O B;  1M1A A;  5AV5 B;  4J8X A;  5CHL B;  5B2I A;  1P3O D;  5B40 A;  5AV5 D;  1TZY A;  4NE6 A;  5F99 D;  1P3P A;  4G92 B;  2Y2J A;  1F66 B;  1F66 D;  5DNM B;  4Z5T A;  5DNM D;  5GT0 C;  1KX3 A;  4WU8 C;  3AV1 C;  1A7W A;  4WV4 B;  2DQN C;  1ID3 A;  3UTA C;  5CPK C;  3VH5 T;  4ZUX A;  3REL A;  3IP4 C;  2L5A A;  5CP6 A;  5B24 A;  3MNN C;  1F1E A;  3UT9 A;  1P3K D;  4R8P A;  2F2A C;  5GT0 B;  2ARO A;  5GT0 D;  3VH5 A;  3REH B;  4WU8 B;  1N1J A;  3AV1 B;  5CPJ A;  3NQU A;  4WU8 D;  3NQJ B;  3AV1 D;  3UTA B;  5CPK B;  3UTA D;  4J8W A;  2RVQ C;  5CPK D;  5B0Z A;  4XUJ C;  5F99 A;  5BS7 A;  1BH9 B;  2W8S A;  5CPI C;  4M6B A;  3MNN B;  1P3I C;  3MNN D;  5DNM A;  1Z2C B;  3KXB C;  3AZF D;  5AY8 C;  5B31 G;  3REK C;  2RIQ A;  3LJA C;  5B31 C;  3V9R B;  1BH8 B;  2RVQ D;  4E45 A;  5KDM B;  5B2J D;  4XUJ B;  2BYM A;  5CPI B;  4XUJ D;  4QLC C;  3C1C A;  3AZJ C;  5CPI D;  2YFW B;  3AV2 C;  1P3I B;  5DNN C;  1P3K A;  4YM6 D;  4X23 C;  3MGQ C;  1P3I D;  4H9O B;  3KXB D;  2G5I C;  5AY8 B;  1H3O A;  3AZG A;  4WU8 A;  3UTB A;  5AY8 D;  3REK B;  3LJA B;  3AV1 A;  3NQJ A;  3LJA D;  5B31 B;  5B33 A;  4WU9 C;  3WTP C;  1EQZ C;  5B31 D;  4QLC B;  3REJ C;  3AZJ B;  4JJN C;  4NE3 A;  4QLC D;  3AV2 B;  2BYK B;  3AZJ D;  4WJ3 C;  5DNN B;  3MNN A;  4X23 B;  3C1B A;  3MGQ B;  1KX5 A;  5DNN D;  4X23 D;  3MGQ D;  3AZF A;  1TAF B;  5B32 B;  2Y2M A;  4UPK A;  3MGS C;  4WU9 B;  1EQZ B;  5B2J A;  4WU9 D;  3V9R A;  1BH8 A;  5BNX A;  3WTP D;  3REJ B;  4XUJ A;  1EQZ D;  4JJN B;  1P34 C;  3REJ D;  2UWX A;  2XD5 A;  5CPI A;  3F6T A;  4XZQ C;  4JJN D;  4YM6 A;  1P3I A;  3AZI C;  3X1S A;  3KXB A;  5B0Y C;  5B1L A;  5BNV B;  5AY8 A;  3AZM C;  3FDD A;  3MGS B;  3MGS D;  5B31 A;  3TU4 C;  1M19 C;  3LZ0 B;  1P3L C;  4QLC A;  2Y2Q A;  4XZQ B;  3B6G C;  1P34 D;  3AZJ A;  4XZQ D;  5AV8 A;  4X23 A;  3MGQ A;  2Y2G A;  5B0Y B;  3AZI D;  3LEL C;  1U35 C;  4WNN A;  3W96 C;  1HQ3 C;  5B1M A;  5B0Y D;  1TAF A;  3O62 C;  3AZM B;  2Y2P A;  3AZM D;  2Y2L A;  3MGP B;  5GXQ C;  1KX4 C;  4WU9 A;  1M19 B;  3WTP A;  1EQZ A;  3B0C T;  1P3L B;  3TU4 D;  1M19 D;  3B6G B;  1P3L D;  1ULY A;  2Y2O A;  3B6G D;  4HGA C;  1M18 A;  2DF4 C;  3LEL B;  1U35 B;  3W96 B;  2F8N K;  1HQ3 B;  4KGC C;  3O62 B;  3LEL D;  3W96 D;  1WWS A;  3AYW B;  3W98 C;  3WAA C;  3WA9 B;  2CWE A;  5GXQ B;  3AFA C;  1KX4 B;  5AV9 C;  5GXQ D;  4Z66 C;  1KX4 D;  2NZD C;  3W97 C;  3EG5 B;  4H9P A;  1P34 A;  4G91 C;  4HGA B;  3X1V C;  3REH C;  4H9R B;  1PZR A;  3KUY B;  3AZI A;  3KWQ B;  4KGC B;  3B0C W;  3WKJ A;  4KGC D;  4H9Q B;  3W98 B;  3WAA B;  3AZM A;  3W98 D;  3WAA D;  3AFA B;  3A1I A;  5AV9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...