2J8PA

Nmr structure of c-terminal domain of human cstf-64
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
HMTPQDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords CLEAVAGE STIMULATION FACTOR 64 KDA SUBUNIT
publication title The C-Terminal Domains of Vertebrate Cstf-64 and its Yeast Orthologue RNA15 Form a New Structure Critical for Mrna 3'-End Processing.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14304 CSTF_C Transcription termination and cleavage factor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.70 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2j8pA00
2J8PA
chains in the Genus database with same CATH superfamily
1P3BD 2AROD 1N1JA 4ZUXB 1T3UA 3AZHB 3AZKC 4LD9B 3AZGA 3KUYB 5GT3C 3MGQA 1U35C 3AZNC 3KWQB 3MVDC 4G91C 4XUJC 4YM6A 4H9NA 5B24A 3R45A 5AV8A 1P3ID 3AZKB 4YM6D 3X1VD 1P3LD 2ZY5A 5GT3B 5CPJA 1U35B 3W96A 3LELA 3AZNB 5CPJD 5AY8B 3REKA 3W96D 3LELD 4G92C 2FJ7B 3AV1A 3MVDB 4G91B 5KDMA 4XUJB 3AV1D 3KFUG 5CP6C 2Y2PA 4CSRA 3MGPA 4KUDA 1ID3D 4KGCC 5B32D 4KUDD 5B40C 3X1UD 4CAYA 3REID 2PYOC 3AZFC 4J8UA 1P3FB 1P3OC 2HUEB 5B1LC 5CP6B 3AZJC 1F66C 3IP4C 4KGCB 5B40B 3WTPE 5G49A 1KX4A 3AZFB 5JA4B 5F99C 1P3OB 1WWIA 4QLCC 5BNVB 3B6FD 5BNXA 4AWLC 2JCHA 3X1TC 4WU9A 1B6WA 2BG1A 1F66B 1BH9B 2RIQA 5AVBA 4WU9D 3MNNC 3AYWA 3AV2C 5C3IB 2BYMA 5B2JC 3LZ1B 3KWQD 1TZYC 1HQ3B 5B0YA 3TU4B 3W99C 4EO5C 2Y2NA 3WTPA 1M1AA 4J8VA 3UTBA 3NQJA 4QLCB 4J8VD 2HIOB 3UTBD 3EG5B 3AZGC 3EPLA 3MNNB 3A1IA 3AZND 3MGQC 3AV2B 1BH8A 5B2JB 5B32G 5DNNB 1TZYB 4E45A 3W99B 1M19A 4XUJD 4EO5B 2G5IC 1M19D 3UTAA 5B24C 5AV8C 1N1JB 3UTAD 3KXBA 3MGQB 4JJNA 5CPJC 3MGSA 3W96C 5B2IA 2JSSA 3LELC 3REKC 3F6TA 5CP6D 4YM6B 4KHAA 4H9NB 3R45B 5AV8B 4DRBA 3MGPC 4KGCD 5BO0A 1R4VA 3AZLA 4NFTA 2XD5A 4HGAC 5CPJB 3W96B 2PYOD 5B1LA 3LELB 3AFAA 3REKB 1P3OD 5B1LD 3AZJA 3AV1B 2JE5A 4J8UC 3AZJD 3REJA 3B0DB 1F66D 5AVCA 4CSRB 5GXQA 1P3PA 1ID3B 5B32B 3X1SA 4KUDB 1P3PD 5B1MA 1KX3A 1M18C 4HGAB 3X1SD 4X23A 5F99A 5FUGA 5B1MD 3REIB 5F99D 3MGRA 4CAYB 4QLCD 2ZY3A 1KX4C 2Y2IA 4J8UB 3X1TD 4WU9C 5B2JD 5AVBC 4WNNB 3AYWC 5B0YC 2VQRA 3W97A 5G49B 1KX4B 3WTPC 1M1AC 4J8VC 3UTBC 3LJAA 3B6FB 2FFFB 2IO5B 3AZGD 1PZRA 3LJAD 4H9RA 5BNXB 1P3GC 3MGQD 4WU9B 4H9QA 5AVBB 3AYWB 3P5JB 1M19C 3AN2A 5B24D 4R8PA 1M1AB 5AV8D 4J8VB 3UTBB 4H9SA 1H3OB 3VH5T 3UTAC 3AN2D 3AL0C 4Z66C 4H9OA 2Y2KA 3KXBC 1BH8B 4JJNC 5CHLB 3MGSC 3REKD 5B2IC 3V9RA 1M19B 4DRAA 5E5AC 3MGPD 3UTAB 3B0CT 3KXBB 4G92B 3AZLC 3WAAA 4JJNB 3REHA 5B2IB 2Y2LA 3WAAD 3FDDA 1KU5A 3AFAC 4J8UD 3REHD 2YFWA 3VH6A 1P3MA 3EPKA 3LZ0A 4Z5TA 2F2AC 3REJC 1M18A 5AVCC 4H9PB 2J8PA 5GXQC 1P3PC 1M18D 5BT1D 3X1SC 3AZIA 3AZLB 5B1MC 5AV9A 1KX3C 3EPJA 2PYOB 2NZDA 3H0MC 4X23C 1EQZC 3AZID 1AOIA 5B1LB 1KX4D 2F8NA 1P3KA 5AV6A 3AFAB 3MGRC 1AOID 3AZJB 3VH6W 4ZBJC 2F8ND 3WA9A 5DNMA 4J8XA 5AV5A 5AVBD 5GXQB 3AYWD 1P3PB 3X1SB 5JRGA 4UPKA 5B1MB 5B0YD 4X23B 5F99B 5FUGB 3WTPD 1M1AD 4J8WA 3MGRB 1P3GA 4AWLB 1KX5A 3W97C 3X1TB 4E44A 4J8WD 3LJAC 5BS7A 1P3GD 1KX5D 3WKJA 1BFMA 2BYKA 3UT9A 4Z66A 3AN2C 3UT9D 4R8PC 3AZGB 4Z66D 3LJAB 4H9SC 2Y2OA 3KXBD 2Y2MA 3VH5A 4H9RB 1W2EA 4WV4B 3AZEA 4JJND 3MGSD 4H9QB 5B2ID 5E5AA 5AY8A 5E5AD 5B24B 2F8NK 2W8SA 3AN2B 4R8PB 2F8NG 2CWEA 1Z2CB 1S32A 3AZLD 4H9OB 1S32D 3WAAC 4YS3A 3AFAD 2L5AA 3REHC 5KDMB 4YS3D 3C1BA 3V9RB 4WJ3C 1P3FA 2Y2HA 3MGPB 3REJD 5CPIA 1P3MC 5AVCD 5GXQD 3LZ0C 2CV5A 4Z5TC 3B6GC 2NQBA 5BT1C 1EQZA 1TAFA 3H0LC 1KX3D 2RVQC 4X23D 1EQZD 5CPKC 3AZIC 3WAAB 5AV9C 2NZDC 3MGRD 3REHB 1AOIC 1P3KC 5AV6C 2YFWB 4WU8A 2F8NH 3WA9C 5DNMC 2UWXA 4WU8D 4WZSB 3LZ0B 4Z5TB 4J8XC 1M18B 3A1KA 5AV5C 1P34A 3AZIB 5JRGC 3TU4A 1HQ3A 5AV9B 1P3AA 2NZDB 1AOIB 3W97D 2F8NB 4J8WC 5AV6B 5GT0A 1KX5C 4M6BA 3WA9B 5BS7C 4ZUXC 3AZHC 4J8XB 2BYMB 3KUYC 5GSUA 5B0YB 3RELA 3WKJC 3B0BA 5GSUD 5DNNA 2YFVA 3WTPB 1P3BA 4R8PD 3NQJB 3UT9C 2LY8A 2AROA 4J8WB 1P3GB 5B31A 1KX5B 5B31D 5B0ZA 3AZEC 3WKJB 5B0ZD 2BYKB 5AY8C 1ZLAA 2Y2QA 3UT9B 2FJ7C 1ZLAD 1P3IA 4Z66B 3O62A 3X1VA 3H0RC 1P3LA 3O62D 1B67A 1Q9CA 3MGSB 3AZEB 1S32C 1JFIA 1WWSA 5E5AB 4YS3C 3C1CA 4NE5A 4KHAB 1P3MD 3B6GA 3C1BC 3C1CD 2DQNC 1P3FC 3LZ0D 4Z5TD 2HUEC 5CPIC 5BO0B 3A6NA 3B6GD 5CPKA 3A6ND 2CV5C 1ID3A 2RVQD 5B32A 5CPKD 2NQBC 1S32B 5AV9D 2NZDD 4UUZA 3AZMA 3X1UA 3REIA 4YS3B 1P3KD 5AV6D 3AZMD 3REJB 3C1BB 3WA9D 5DNMD 4NE6A 5AVCB 5B33A 4J8XD 4WU8C 5CPIB 5B33D 5AV5D 5B31G 3NQUA 2CV5B 1KX3B 3W98A 2NQBB 1EQZB 1TAFB 4NE3A 2ZY4A 4XZQA 4WNNA 5JRGD 4DQYB 3W98D 1P34C 5C3IC 3LZ1C 4XZQD 3TU4C 1HQ3C 1P3AC 4ZBJB 4ZUXA 3AZHA 4LD9A 3B6FA 4ZUXD 5GT0C 3KUYA 3AZHD 4WU8B 4LD9D 2HIOC 3KUYD 1ULYA 3WKJD 5GSUC 3KWQA 3RELC 1P34B 5DNNC 3W97B 1P3AB 3AZKA 1P3BC 1HTAA 2AROC 3AZKD 5GT0B 5B31C 1H3OA 5GT3A 1U35A 3AZED 5GT3D 3AZNA 5B0ZC 1U35D 5GSUB 3RELB 5AY8D 2Y2JA 2FJ7A 3MVDA 4XUJA 2YFVB 2FJ7D 1ZLAC 3MVDD 1P3BB 2AROB 3VH5W 1P3IC 5B31B 4YM6C 2Y2GA 3O62C 3X1VC 1P3LC 3EPHA 5B0ZB 3C1BD 3C1CC 1ZLAB 4Z2MG 1P3FD 5CP6A 5CPID 1P3IB 3AV1C 2CV5D 3A6NC 4KGCA 3B0DC 2NQBD 3B0CW 3O62B 3X1VB 5B40A 1P3LB 4H9PA 1ID3C 5B32C 4KUDC 5B40D 1JFIB 2PYOA 3AZFA 3KSYA 5JA4A 3X1UC 3AZMC 2DF4C 3REIC 1P3OA 2ZM5A 1F1EA 1P3MB 3AZFD 5BNVA 3C1CB 3VH6T 2G5HC 3B6GB 1F66A 1BH9A 2ZY2A 5B33C 3A6NB 3LZ1A 5CPKB 3W98C 1P34D 3LZ1D 4XZQC 3TU4D 1HQ3D 1P3AD 4UUZB 1P3KB 3AZMB 3X1UB 4QLCA 2HIOA 4Z2MH 5GT0D 5DNMB 3X1TA 4LD9C 2HIOD 3B6FC 5B33B 5AV5B 3MNNA 2IO5C 3AV2A 5B2JA 3MNND 3NQUB 1TZYA 5JRGB 3RELD 2XD1A 3AV2D 3W98B 3W99A 5DNND 1A7WA 4XZQB 1TZYD 3KWQC 3W99D
chains in the Genus database with same CATH topology
1P3BD 2AROD 1N1JA 4ZUXB 1T3UA 3AZHB 3AZKC 4LD9B 3AZGA 3KUYB 5GT3C 3MGQA 1U35C 3AZNC 3KWQB 3MVDC 4G91C 4XUJC 4YM6A 4H9NA 5B24A 3R45A 5AV8A 1P3ID 3AZKB 4YM6D 3X1VD 1P3LD 2ZY5A 5GT3B 5CPJA 1U35B 3W96A 3LELA 3AZNB 5CPJD 5AY8B 3REKA 3W96D 3LELD 4G92C 2FJ7B 3AV1A 3MVDB 4G91B 5KDMA 4XUJB 3AV1D 3KFUG 5CP6C 2Y2PA 4CSRA 3MGPA 4KUDA 1ID3D 4KGCC 5B32D 4KUDD 5B40C 3X1UD 4CAYA 3REID 2PYOC 3AZFC 4J8UA 1P3FB 1P3OC 2HUEB 5B1LC 5CP6B 3AZJC 1F66C 3IP4C 4KGCB 5B40B 3WTPE 5G49A 1KX4A 3AZFB 5JA4B 5F99C 1P3OB 1WWIA 4QLCC 5BNVB 3B6FD 5BNXA 4AWLC 2JCHA 3X1TC 4WU9A 1B6WA 2BG1A 1F66B 1BH9B 2RIQA 5AVBA 4WU9D 3MNNC 3AYWA 3AV2C 5C3IB 2BYMA 5B2JC 3LZ1B 3KWQD 1TZYC 1HQ3B 5B0YA 3TU4B 3W99C 4EO5C 2Y2NA 3WTPA 1M1AA 4J8VA 3UTBA 3NQJA 4QLCB 4J8VD 2HIOB 3UTBD 3EG5B 3AZGC 3EPLA 3MNNB 3A1IA 3AZND 3MGQC 3AV2B 1BH8A 5B2JB 5B32G 5DNNB 1TZYB 4E45A 3W99B 1M19A 4XUJD 4EO5B 2G5IC 1M19D 3UTAA 5B24C 5AV8C 1N1JB 3UTAD 3KXBA 3MGQB 4JJNA 5CPJC 3MGSA 3W96C 5B2IA 2JSSA 3LELC 3REKC 3F6TA 5CP6D 4YM6B 4KHAA 4H9NB 3R45B 5AV8B 4DRBA 3MGPC 4KGCD 5BO0A 1R4VA 3AZLA 4NFTA 2XD5A 4HGAC 5CPJB 3W96B 2PYOD 5B1LA 3LELB 3AFAA 3REKB 1P3OD 5B1LD 3AZJA 3AV1B 2JE5A 4J8UC 3AZJD 3REJA 3B0DB 1F66D 5AVCA 4CSRB 5GXQA 1P3PA 1ID3B 5B32B 3X1SA 4KUDB 1P3PD 5B1MA 1KX3A 1M18C 4HGAB 3X1SD 4X23A 5F99A 5FUGA 5B1MD 3REIB 5F99D 3MGRA 4CAYB 4QLCD 2ZY3A 1KX4C 2Y2IA 4J8UB 3X1TD 4WU9C 5B2JD 5AVBC 4WNNB 3AYWC 5B0YC 2VQRA 3W97A 5G49B 1KX4B 3WTPC 1M1AC 4J8VC 3UTBC 3LJAA 3B6FB 2FFFB 2IO5B 3AZGD 1PZRA 3LJAD 4H9RA 5BNXB 1P3GC 3MGQD 4WU9B 4H9QA 5AVBB 3AYWB 3P5JB 1M19C 3AN2A 5B24D 4R8PA 1M1AB 5AV8D 4J8VB 3UTBB 4H9SA 1H3OB 3VH5T 3UTAC 3AN2D 3AL0C 4Z66C 4H9OA 2Y2KA 3KXBC 1BH8B 4JJNC 5CHLB 3MGSC 3REKD 5B2IC 3V9RA 1M19B 4DRAA 5E5AC 3MGPD 3UTAB 3B0CT 3KXBB 4G92B 3AZLC 3WAAA 4JJNB 3REHA 5B2IB 2Y2LA 3WAAD 3FDDA 1KU5A 3AFAC 4J8UD 3REHD 2YFWA 3VH6A 1P3MA 3EPKA 3LZ0A 4Z5TA 2F2AC 3REJC 1M18A 5AVCC 4H9PB 2J8PA 5GXQC 1P3PC 1M18D 5BT1D 3X1SC 3AZIA 3AZLB 5B1MC 5AV9A 1KX3C 3EPJA 2PYOB 2NZDA 3H0MC 4X23C 1EQZC 3AZID 1AOIA 5B1LB 1KX4D 2F8NA 1P3KA 5AV6A 3AFAB 3MGRC 1AOID 3AZJB 3VH6W 4ZBJC 2F8ND 3WA9A 5DNMA 4J8XA 5AV5A 5AVBD 5GXQB 3AYWD 1P3PB 3X1SB 5JRGA 4UPKA 5B1MB 5B0YD 4X23B 5F99B 5FUGB 3WTPD 1M1AD 4J8WA 3MGRB 1P3GA 4AWLB 1KX5A 3W97C 3X1TB 4E44A 4J8WD 3LJAC 5BS7A 1P3GD 1KX5D 3WKJA 1BFMA 2BYKA 3UT9A 4Z66A 3AN2C 3UT9D 4R8PC 3AZGB 4Z66D 3LJAB 4H9SC 2Y2OA 3KXBD 2Y2MA 3VH5A 4H9RB 1W2EA 4WV4B 3AZEA 4JJND 3MGSD 4H9QB 5B2ID 5E5AA 5AY8A 5E5AD 5B24B 2F8NK 2W8SA 3AN2B 4R8PB 2F8NG 2CWEA 1Z2CB 1S32A 3AZLD 4H9OB 1S32D 3WAAC 4YS3A 3AFAD 2L5AA 3REHC 5KDMB 4YS3D 3C1BA 3V9RB 4WJ3C 1P3FA 2Y2HA 3MGPB 3REJD 5CPIA 1P3MC 5AVCD 5GXQD 3LZ0C 2CV5A 4Z5TC 3B6GC 2NQBA 5BT1C 1EQZA 1TAFA 3H0LC 1KX3D 2RVQC 4X23D 1EQZD 5CPKC 3AZIC 3WAAB 5AV9C 2NZDC 3MGRD 3REHB 1AOIC 1P3KC 5AV6C 2YFWB 4WU8A 2F8NH 3WA9C 5DNMC 2UWXA 4WU8D 4WZSB 3LZ0B 4Z5TB 4J8XC 1M18B 3A1KA 5AV5C 1P34A 3AZIB 5JRGC 3TU4A 1HQ3A 5AV9B 1P3AA 2NZDB 1AOIB 3W97D 2F8NB 4J8WC 5AV6B 5GT0A 1KX5C 4M6BA 3WA9B 5BS7C 4ZUXC 3AZHC 4J8XB 2BYMB 3KUYC 5GSUA 5B0YB 3RELA 3WKJC 3B0BA 5GSUD 5DNNA 2YFVA 3WTPB 1P3BA 4R8PD 3NQJB 3UT9C 2LY8A 2AROA 4J8WB 1P3GB 5B31A 1KX5B 5B31D 5B0ZA 3AZEC 3WKJB 5B0ZD 2BYKB 5AY8C 1ZLAA 2Y2QA 3UT9B 2FJ7C 1ZLAD 1P3IA 4Z66B 3O62A 3X1VA 3H0RC 1P3LA 3O62D 1B67A 1Q9CA 3MGSB 3AZEB 1S32C 1JFIA 1WWSA 5E5AB 4YS3C 3C1CA 4NE5A 4KHAB 1P3MD 3B6GA 3C1BC 3C1CD 2DQNC 1P3FC 3LZ0D 4Z5TD 2HUEC 5CPIC 5BO0B 3A6NA 3B6GD 5CPKA 3A6ND 2CV5C 1ID3A 2RVQD 5B32A 5CPKD 2NQBC 1S32B 5AV9D 2NZDD 4UUZA 3AZMA 3X1UA 3REIA 4YS3B 1P3KD 5AV6D 3AZMD 3REJB 3C1BB 3WA9D 5DNMD 4NE6A 5AVCB 5B33A 4J8XD 4WU8C 5CPIB 5B33D 5AV5D 5B31G 3NQUA 2CV5B 1KX3B 3W98A 2NQBB 1EQZB 1TAFB 4NE3A 2ZY4A 4XZQA 4WNNA 5JRGD 4DQYB 3W98D 1P34C 5C3IC 3LZ1C 4XZQD 3TU4C 1HQ3C 1P3AC 4ZBJB 4ZUXA 3AZHA 4LD9A 3B6FA 4ZUXD 5GT0C 3KUYA 3AZHD 4WU8B 4LD9D 2HIOC 3KUYD 1ULYA 3WKJD 5GSUC 3KWQA 3RELC 1P34B 5DNNC 3W97B 1P3AB 3AZKA 1P3BC 1HTAA 2AROC 3AZKD 5GT0B 5B31C 1H3OA 5GT3A 1U35A 3AZED 5GT3D 3AZNA 5B0ZC 1U35D 5GSUB 3RELB 5AY8D 2Y2JA 2FJ7A 3MVDA 4XUJA 2YFVB 2FJ7D 1ZLAC 3MVDD 1P3BB 2AROB 3VH5W 1P3IC 5B31B 4YM6C 2Y2GA 3O62C 3X1VC 1P3LC 3EPHA 5B0ZB 3C1BD 3C1CC 1ZLAB 4Z2MG 1P3FD 5CP6A 5CPID 1P3IB 3AV1C 2CV5D 3A6NC 4KGCA 3B0DC 2NQBD 3B0CW 3O62B 3X1VB 5B40A 1P3LB 4H9PA 1ID3C 5B32C 4KUDC 5B40D 1JFIB 2PYOA 3AZFA 3KSYA 5JA4A 3X1UC 3AZMC 2DF4C 3REIC 1P3OA 2ZM5A 1F1EA 1P3MB 3AZFD 5BNVA 3C1CB 3VH6T 2G5HC 3B6GB 1F66A 1BH9A 2ZY2A 5B33C 3A6NB 3LZ1A 5CPKB 3W98C 1P34D 3LZ1D 4XZQC 3TU4D 1HQ3D 1P3AD 4UUZB 1P3KB 3AZMB 3X1UB 4QLCA 2HIOA 4Z2MH 5GT0D 5DNMB 3X1TA 4LD9C 2HIOD 3B6FC 5B33B 5AV5B 3MNNA 2IO5C 3AV2A 5B2JA 3MNND 3NQUB 1TZYA 5JRGB 3RELD 2XD1A 3AV2D 3W98B 3W99A 5DNND 1A7WA 4XZQB 1TZYD 3KWQC 3W99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8P A; 
#chains in the Genus database with same CATH topology
 1P3B D;  2ARO D;  1N1J A;  4ZUX B;  1T3U A;  3AZH B;  3AZK C;  4LD9 B;  3AZG A;  3KUY B;  5GT3 C;  3MGQ A;  1U35 C;  3AZN C;  3KWQ B;  3MVD C;  4G91 C;  4XUJ C;  4YM6 A;  4H9N A;  5B24 A;  3R45 A;  5AV8 A;  1P3I D;  3AZK B;  4YM6 D;  3X1V D;  1P3L D;  2ZY5 A;  5GT3 B;  5CPJ A;  1U35 B;  3W96 A;  3LEL A;  3AZN B;  5CPJ D;  5AY8 B;  3REK A;  3W96 D;  3LEL D;  4G92 C;  2FJ7 B;  3AV1 A;  3MVD B;  4G91 B;  5KDM A;  4XUJ B;  3AV1 D;  3KFU G;  5CP6 C;  2Y2P A;  4CSR A;  3MGP A;  4KUD A;  1ID3 D;  4KGC C;  5B32 D;  4KUD D;  5B40 C;  3X1U D;  4CAY A;  3REI D;  2PYO C;  3AZF C;  4J8U A;  1P3F B;  1P3O C;  2HUE B;  5B1L C;  5CP6 B;  3AZJ C;  1F66 C;  3IP4 C;  4KGC B;  5B40 B;  3WTP E;  5G49 A;  1KX4 A;  3AZF B;  5JA4 B;  5F99 C;  1P3O B;  1WWI A;  4QLC C;  5BNV B;  3B6F D;  5BNX A;  4AWL C;  2JCH A;  3X1T C;  4WU9 A;  1B6W A;  2BG1 A;  1F66 B;  1BH9 B;  2RIQ A;  5AVB A;  4WU9 D;  3MNN C;  3AYW A;  3AV2 C;  5C3I B;  2BYM A;  5B2J C;  3LZ1 B;  3KWQ D;  1TZY C;  1HQ3 B;  5B0Y A;  3TU4 B;  3W99 C;  4EO5 C;  2Y2N A;  3WTP A;  1M1A A;  4J8V A;  3UTB A;  3NQJ A;  4QLC B;  4J8V D;  2HIO B;  3UTB D;  3EG5 B;  3AZG C;  3EPL A;  3MNN B;  3A1I A;  3AZN D;  3MGQ C;  3AV2 B;  1BH8 A;  5B2J B;  5B32 G;  5DNN B;  1TZY B;  4E45 A;  3W99 B;  1M19 A;  4XUJ D;  4EO5 B;  2G5I C;  1M19 D;  3UTA A;  5B24 C;  5AV8 C;  1N1J B;  3UTA D;  3KXB A;  3MGQ B;  4JJN A;  5CPJ C;  3MGS A;  3W96 C;  5B2I A;  2JSS A;  3LEL C;  3REK C;  3F6T A;  5CP6 D;  4YM6 B;  4KHA A;  4H9N B;  3R45 B;  5AV8 B;  4DRB A;  3MGP C;  4KGC D;  5BO0 A;  1R4V A;  3AZL A;  4NFT A;  2XD5 A;  4HGA C;  5CPJ B;  3W96 B;  2PYO D;  5B1L A;  3LEL B;  3AFA A;  3REK B;  1P3O D;  5B1L D;  3AZJ A;  3AV1 B;  2JE5 A;  4J8U C;  3AZJ D;  3REJ A;  3B0D B;  1F66 D;  5AVC A;  4CSR B;  5GXQ A;  1P3P A;  1ID3 B;  5B32 B;  3X1S A;  4KUD B;  1P3P D;  5B1M A;  1KX3 A;  1M18 C;  4HGA B;  3X1S D;  4X23 A;  5F99 A;  5FUG A;  5B1M D;  3REI B;  5F99 D;  3MGR A;  4CAY B;  4QLC D;  2ZY3 A;  1KX4 C;  2Y2I A;  4J8U B;  3X1T D;  4WU9 C;  5B2J D;  5AVB C;  4WNN B;  3AYW C;  5B0Y C;  2VQR A;  3W97 A;  5G49 B;  1KX4 B;  3WTP C;  1M1A C;  4J8V C;  3UTB C;  3LJA A;  3B6F B;  2FFF B;  2IO5 B;  3AZG D;  1PZR A;  3LJA D;  4H9R A;  5BNX B;  1P3G C;  3MGQ D;  4WU9 B;  4H9Q A;  5AVB B;  3AYW B;  3P5J B;  1M19 C;  3AN2 A;  5B24 D;  4R8P A;  1M1A B;  5AV8 D;  4J8V B;  3UTB B;  4H9S A;  1H3O B;  3VH5 T;  3UTA C;  3AN2 D;  3AL0 C;  4Z66 C;  4H9O A;  2Y2K A;  3KXB C;  1BH8 B;  4JJN C;  5CHL B;  3MGS C;  3REK D;  5B2I C;  3V9R A;  1M19 B;  4DRA A;  5E5A C;  3MGP D;  3UTA B;  3B0C T;  3KXB B;  4G92 B;  3AZL C;  3WAA A;  4JJN B;  3REH A;  5B2I B;  2Y2L A;  3WAA D;  3FDD A;  1KU5 A;  3AFA C;  4J8U D;  3REH D;  2YFW A;  3VH6 A;  1P3M A;  3EPK A;  3LZ0 A;  4Z5T A;  2F2A C;  3REJ C;  1M18 A;  5AVC C;  4H9P B;  2J8P A;  5GXQ C;  1P3P C;  1M18 D;  5BT1 D;  3X1S C;  3AZI A;  3AZL B;  5B1M C;  5AV9 A;  1KX3 C;  3EPJ A;  2PYO B;  2NZD A;  3H0M C;  4X23 C;  1EQZ C;  3AZI D;  1AOI A;  5B1L B;  1KX4 D;  2F8N A;  1P3K A;  5AV6 A;  3AFA B;  3MGR C;  1AOI D;  3AZJ B;  3VH6 W;  4ZBJ C;  2F8N D;  3WA9 A;  5DNM A;  4J8X A;  5AV5 A;  5AVB D;  5GXQ B;  3AYW D;  1P3P B;  3X1S B;  5JRG A;  4UPK A;  5B1M B;  5B0Y D;  4X23 B;  5F99 B;  5FUG B;  3WTP D;  1M1A D;  4J8W A;  3MGR B;  1P3G A;  4AWL B;  1KX5 A;  3W97 C;  3X1T B;  4E44 A;  4J8W D;  3LJA C;  5BS7 A;  1P3G D;  1KX5 D;  3WKJ A;  1BFM A;  2BYK A;  3UT9 A;  4Z66 A;  3AN2 C;  3UT9 D;  4R8P C;  3AZG B;  4Z66 D;  3LJA B;  4H9S C;  2Y2O A;  3KXB D;  2Y2M A;  3VH5 A;  4H9R B;  1W2E A;  4WV4 B;  3AZE A;  4JJN D;  3MGS D;  4H9Q B;  5B2I D;  5E5A A;  5AY8 A;  5E5A D;  5B24 B;  2F8N K;  2W8S A;  3AN2 B;  4R8P B;  2F8N G;  2CWE A;  1Z2C B;  1S32 A;  3AZL D;  4H9O B;  1S32 D;  3WAA C;  4YS3 A;  3AFA D;  2L5A A;  3REH C;  5KDM B;  4YS3 D;  3C1B A;  3V9R B;  4WJ3 C;  1P3F A;  2Y2H A;  3MGP B;  3REJ D;  5CPI A;  1P3M C;  5AVC D;  5GXQ D;  3LZ0 C;  2CV5 A;  4Z5T C;  3B6G C;  2NQB A;  5BT1 C;  1EQZ A;  1TAF A;  3H0L C;  1KX3 D;  2RVQ C;  4X23 D;  1EQZ D;  5CPK C;  3AZI C;  3WAA B;  5AV9 C;  2NZD C;  3MGR D;  3REH B;  1AOI C;  1P3K C;  5AV6 C;  2YFW B;  4WU8 A;  2F8N H;  3WA9 C;  5DNM C;  2UWX A;  4WU8 D;  4WZS B;  3LZ0 B;  4Z5T B;  4J8X C;  1M18 B;  3A1K A;  5AV5 C;  1P34 A;  3AZI B;  5JRG C;  3TU4 A;  1HQ3 A;  5AV9 B;  1P3A A;  2NZD B;  1AOI B;  3W97 D;  2F8N B;  4J8W C;  5AV6 B;  5GT0 A;  1KX5 C;  4M6B A;  3WA9 B;  5BS7 C;  4ZUX C;  3AZH C;  4J8X B;  2BYM B;  3KUY C;  5GSU A;  5B0Y B;  3REL A;  3WKJ C;  3B0B A;  5GSU D;  5DNN A;  2YFV A;  3WTP B;  1P3B A;  4R8P D;  3NQJ B;  3UT9 C;  2LY8 A;  2ARO A;  4J8W B;  1P3G B;  5B31 A;  1KX5 B;  5B31 D;  5B0Z A;  3AZE C;  3WKJ B;  5B0Z D;  2BYK B;  5AY8 C;  1ZLA A;  2Y2Q A;  3UT9 B;  2FJ7 C;  1ZLA D;  1P3I A;  4Z66 B;  3O62 A;  3X1V A;  3H0R C;  1P3L A;  3O62 D;  1B67 A;  1Q9C A;  3MGS B;  3AZE B;  1S32 C;  1JFI A;  1WWS A;  5E5A B;  4YS3 C;  3C1C A;  4NE5 A;  4KHA B;  1P3M D;  3B6G A;  3C1B C;  3C1C D;  2DQN C;  1P3F C;  3LZ0 D;  4Z5T D;  2HUE C;  5CPI C;  5BO0 B;  3A6N A;  3B6G D;  5CPK A;  3A6N D;  2CV5 C;  1ID3 A;  2RVQ D;  5B32 A;  5CPK D;  2NQB C;  1S32 B;  5AV9 D;  2NZD D;  4UUZ A;  3AZM A;  3X1U A;  3REI A;  4YS3 B;  1P3K D;  5AV6 D;  3AZM D;  3REJ B;  3C1B B;  3WA9 D;  5DNM D;  4NE6 A;  5AVC B;  5B33 A;  4J8X D;  4WU8 C;  5CPI B;  5B33 D;  5AV5 D;  5B31 G;  3NQU A;  2CV5 B;  1KX3 B;  3W98 A;  2NQB B;  1EQZ B;  1TAF B;  4NE3 A;  2ZY4 A;  4XZQ A;  4WNN A;  5JRG D;  4DQY B;  3W98 D;  1P34 C;  5C3I C;  3LZ1 C;  4XZQ D;  3TU4 C;  1HQ3 C;  1P3A C;  4ZBJ B;  4ZUX A;  3AZH A;  4LD9 A;  3B6F A;  4ZUX D;  5GT0 C;  3KUY A;  3AZH D;  4WU8 B;  4LD9 D;  2HIO C;  3KUY D;  1ULY A;  3WKJ D;  5GSU C;  3KWQ A;  3REL C;  1P34 B;  5DNN C;  3W97 B;  1P3A B;  3AZK A;  1P3B C;  1HTA A;  2ARO C;  3AZK D;  5GT0 B;  5B31 C;  1H3O A;  5GT3 A;  1U35 A;  3AZE D;  5GT3 D;  3AZN A;  5B0Z C;  1U35 D;  5GSU B;  3REL B;  5AY8 D;  2Y2J A;  2FJ7 A;  3MVD A;  4XUJ A;  2YFV B;  2FJ7 D;  1ZLA C;  3MVD D;  1P3B B;  2ARO B;  3VH5 W;  1P3I C;  5B31 B;  4YM6 C;  2Y2G A;  3O62 C;  3X1V C;  1P3L C;  3EPH A;  5B0Z B;  3C1B D;  3C1C C;  1ZLA B;  4Z2M G;  1P3F D;  5CP6 A;  5CPI D;  1P3I B;  3AV1 C;  2CV5 D;  3A6N C;  4KGC A;  3B0D C;  2NQB D;  3B0C W;  3O62 B;  3X1V B;  5B40 A;  1P3L B;  4H9P A;  1ID3 C;  5B32 C;  4KUD C;  5B40 D;  1JFI B;  2PYO A;  3AZF A;  3KSY A;  5JA4 A;  3X1U C;  3AZM C;  2DF4 C;  3REI C;  1P3O A;  2ZM5 A;  1F1E A;  1P3M B;  3AZF D;  5BNV A;  3C1C B;  3VH6 T;  2G5H C;  3B6G B;  1F66 A;  1BH9 A;  2ZY2 A;  5B33 C;  3A6N B;  3LZ1 A;  5CPK B;  3W98 C;  1P34 D;  3LZ1 D;  4XZQ C;  3TU4 D;  1HQ3 D;  1P3A D;  4UUZ B;  1P3K B;  3AZM B;  3X1U B;  4QLC A;  2HIO A;  4Z2M H;  5GT0 D;  5DNM B;  3X1T A;  4LD9 C;  2HIO D;  3B6F C;  5B33 B;  5AV5 B;  3MNN A;  2IO5 C;  3AV2 A;  5B2J A;  3MNN D;  3NQU B;  1TZY A;  5JRG B;  3REL D;  2XD1 A;  3AV2 D;  3W98 B;  3W99 A;  5DNN D;  1A7W A;  4XZQ B;  1TZY D;  3KWQ C;  3W99 D; 
#chains in the Genus database with same CATH homology
 1P3B D;  2ARO D;  1N1J A;  4ZUX B;  1T3U A;  3AZH B;  3AZK C;  4LD9 B;  3AZG A;  3KUY B;  5GT3 C;  3MGQ A;  1U35 C;  3AZN C;  3KWQ B;  3MVD C;  4G91 C;  4XUJ C;  4YM6 A;  4H9N A;  5B24 A;  3R45 A;  5AV8 A;  1P3I D;  3AZK B;  4YM6 D;  3X1V D;  1P3L D;  2ZY5 A;  5GT3 B;  5CPJ A;  1U35 B;  3W96 A;  3LEL A;  3AZN B;  5CPJ D;  5AY8 B;  3REK A;  3W96 D;  3LEL D;  4G92 C;  2FJ7 B;  3AV1 A;  3MVD B;  4G91 B;  5KDM A;  4XUJ B;  3AV1 D;  3KFU G;  5CP6 C;  2Y2P A;  4CSR A;  3MGP A;  4KUD A;  1ID3 D;  4KGC C;  5B32 D;  4KUD D;  5B40 C;  3X1U D;  4CAY A;  3REI D;  2PYO C;  3AZF C;  4J8U A;  1P3F B;  1P3O C;  2HUE B;  5B1L C;  5CP6 B;  3AZJ C;  1F66 C;  3IP4 C;  4KGC B;  5B40 B;  3WTP E;  5G49 A;  1KX4 A;  3AZF B;  5JA4 B;  5F99 C;  1P3O B;  1WWI A;  4QLC C;  5BNV B;  3B6F D;  5BNX A;  4AWL C;  2JCH A;  3X1T C;  4WU9 A;  1B6W A;  2BG1 A;  1F66 B;  1BH9 B;  2RIQ A;  5AVB A;  4WU9 D;  3MNN C;  3AYW A;  3AV2 C;  5C3I B;  2BYM A;  5B2J C;  3LZ1 B;  3KWQ D;  1TZY C;  1HQ3 B;  5B0Y A;  3TU4 B;  3W99 C;  4EO5 C;  2Y2N A;  3WTP A;  1M1A A;  4J8V A;  3UTB A;  3NQJ A;  4QLC B;  4J8V D;  2HIO B;  3UTB D;  3EG5 B;  3AZG C;  3EPL A;  3MNN B;  3A1I A;  3AZN D;  3MGQ C;  3AV2 B;  1BH8 A;  5B2J B;  5B32 G;  5DNN B;  1TZY B;  4E45 A;  3W99 B;  1M19 A;  4XUJ D;  4EO5 B;  2G5I C;  1M19 D;  3UTA A;  5B24 C;  5AV8 C;  1N1J B;  3UTA D;  3KXB A;  3MGQ B;  4JJN A;  5CPJ C;  3MGS A;  3W96 C;  5B2I A;  2JSS A;  3LEL C;  3REK C;  3F6T A;  5CP6 D;  4YM6 B;  4KHA A;  4H9N B;  3R45 B;  5AV8 B;  4DRB A;  3MGP C;  4KGC D;  5BO0 A;  1R4V A;  3AZL A;  4NFT A;  2XD5 A;  4HGA C;  5CPJ B;  3W96 B;  2PYO D;  5B1L A;  3LEL B;  3AFA A;  3REK B;  1P3O D;  5B1L D;  3AZJ A;  3AV1 B;  2JE5 A;  4J8U C;  3AZJ D;  3REJ A;  3B0D B;  1F66 D;  5AVC A;  4CSR B;  5GXQ A;  1P3P A;  1ID3 B;  5B32 B;  3X1S A;  4KUD B;  1P3P D;  5B1M A;  1KX3 A;  1M18 C;  4HGA B;  3X1S D;  4X23 A;  5F99 A;  5FUG A;  5B1M D;  3REI B;  5F99 D;  3MGR A;  4CAY B;  4QLC D;  2ZY3 A;  1KX4 C;  2Y2I A;  4J8U B;  3X1T D;  4WU9 C;  5B2J D;  5AVB C;  4WNN B;  3AYW C;  5B0Y C;  2VQR A;  3W97 A;  5G49 B;  1KX4 B;  3WTP C;  1M1A C;  4J8V C;  3UTB C;  3LJA A;  3B6F B;  2FFF B;  2IO5 B;  3AZG D;  1PZR A;  3LJA D;  4H9R A;  5BNX B;  1P3G C;  3MGQ D;  4WU9 B;  4H9Q A;  5AVB B;  3AYW B;  3P5J B;  1M19 C;  3AN2 A;  5B24 D;  4R8P A;  1M1A B;  5AV8 D;  4J8V B;  3UTB B;  4H9S A;  1H3O B;  3VH5 T;  3UTA C;  3AN2 D;  3AL0 C;  4Z66 C;  4H9O A;  2Y2K A;  3KXB C;  1BH8 B;  4JJN C;  5CHL B;  3MGS C;  3REK D;  5B2I C;  3V9R A;  1M19 B;  4DRA A;  5E5A C;  3MGP D;  3UTA B;  3B0C T;  3KXB B;  4G92 B;  3AZL C;  3WAA A;  4JJN B;  3REH A;  5B2I B;  2Y2L A;  3WAA D;  3FDD A;  1KU5 A;  3AFA C;  4J8U D;  3REH D;  2YFW A;  3VH6 A;  1P3M A;  3EPK A;  3LZ0 A;  4Z5T A;  2F2A C;  3REJ C;  1M18 A;  5AVC C;  4H9P B;  2J8P A;  5GXQ C;  1P3P C;  1M18 D;  5BT1 D;  3X1S C;  3AZI A;  3AZL B;  5B1M C;  5AV9 A;  1KX3 C;  3EPJ A;  2PYO B;  2NZD A;  3H0M C;  4X23 C;  1EQZ C;  3AZI D;  1AOI A;  5B1L B;  1KX4 D;  2F8N A;  1P3K A;  5AV6 A;  3AFA B;  3MGR C;  1AOI D;  3AZJ B;  3VH6 W;  4ZBJ C;  2F8N D;  3WA9 A;  5DNM A;  4J8X A;  5AV5 A;  5AVB D;  5GXQ B;  3AYW D;  1P3P B;  3X1S B;  5JRG A;  4UPK A;  5B1M B;  5B0Y D;  4X23 B;  5F99 B;  5FUG B;  3WTP D;  1M1A D;  4J8W A;  3MGR B;  1P3G A;  4AWL B;  1KX5 A;  3W97 C;  3X1T B;  4E44 A;  4J8W D;  3LJA C;  5BS7 A;  1P3G D;  1KX5 D;  3WKJ A;  1BFM A;  2BYK A;  3UT9 A;  4Z66 A;  3AN2 C;  3UT9 D;  4R8P C;  3AZG B;  4Z66 D;  3LJA B;  4H9S C;  2Y2O A;  3KXB D;  2Y2M A;  3VH5 A;  4H9R B;  1W2E A;  4WV4 B;  3AZE A;  4JJN D;  3MGS D;  4H9Q B;  5B2I D;  5E5A A;  5AY8 A;  5E5A D;  5B24 B;  2F8N K;  2W8S A;  3AN2 B;  4R8P B;  2F8N G;  2CWE A;  1Z2C B;  1S32 A;  3AZL D;  4H9O B;  1S32 D;  3WAA C;  4YS3 A;  3AFA D;  2L5A A;  3REH C;  5KDM B;  4YS3 D;  3C1B A;  3V9R B;  4WJ3 C;  1P3F A;  2Y2H A;  3MGP B;  3REJ D;  5CPI A;  1P3M C;  5AVC D;  5GXQ D;  3LZ0 C;  2CV5 A;  4Z5T C;  3B6G C;  2NQB A;  5BT1 C;  1EQZ A;  1TAF A;  3H0L C;  1KX3 D;  2RVQ C;  4X23 D;  1EQZ D;  5CPK C;  3AZI C;  3WAA B;  5AV9 C;  2NZD C;  3MGR D;  3REH B;  1AOI C;  1P3K C;  5AV6 C;  2YFW B;  4WU8 A;  2F8N H;  3WA9 C;  5DNM C;  2UWX A;  4WU8 D;  4WZS B;  3LZ0 B;  4Z5T B;  4J8X C;  1M18 B;  3A1K A;  5AV5 C;  1P34 A;  3AZI B;  5JRG C;  3TU4 A;  1HQ3 A;  5AV9 B;  1P3A A;  2NZD B;  1AOI B;  3W97 D;  2F8N B;  4J8W C;  5AV6 B;  5GT0 A;  1KX5 C;  4M6B A;  3WA9 B;  5BS7 C;  4ZUX C;  3AZH C;  4J8X B;  2BYM B;  3KUY C;  5GSU A;  5B0Y B;  3REL A;  3WKJ C;  3B0B A;  5GSU D;  5DNN A;  2YFV A;  3WTP B;  1P3B A;  4R8P D;  3NQJ B;  3UT9 C;  2LY8 A;  2ARO A;  4J8W B;  1P3G B;  5B31 A;  1KX5 B;  5B31 D;  5B0Z A;  3AZE C;  3WKJ B;  5B0Z D;  2BYK B;  5AY8 C;  1ZLA A;  2Y2Q A;  3UT9 B;  2FJ7 C;  1ZLA D;  1P3I A;  4Z66 B;  3O62 A;  3X1V A;  3H0R C;  1P3L A;  3O62 D;  1B67 A;  1Q9C A;  3MGS B;  3AZE B;  1S32 C;  1JFI A;  1WWS A;  5E5A B;  4YS3 C;  3C1C A;  4NE5 A;  4KHA B;  1P3M D;  3B6G A;  3C1B C;  3C1C D;  2DQN C;  1P3F C;  3LZ0 D;  4Z5T D;  2HUE C;  5CPI C;  5BO0 B;  3A6N A;  3B6G D;  5CPK A;  3A6N D;  2CV5 C;  1ID3 A;  2RVQ D;  5B32 A;  5CPK D;  2NQB C;  1S32 B;  5AV9 D;  2NZD D;  4UUZ A;  3AZM A;  3X1U A;  3REI A;  4YS3 B;  1P3K D;  5AV6 D;  3AZM D;  3REJ B;  3C1B B;  3WA9 D;  5DNM D;  4NE6 A;  5AVC B;  5B33 A;  4J8X D;  4WU8 C;  5CPI B;  5B33 D;  5AV5 D;  5B31 G;  3NQU A;  2CV5 B;  1KX3 B;  3W98 A;  2NQB B;  1EQZ B;  1TAF B;  4NE3 A;  2ZY4 A;  4XZQ A;  4WNN A;  5JRG D;  4DQY B;  3W98 D;  1P34 C;  5C3I C;  3LZ1 C;  4XZQ D;  3TU4 C;  1HQ3 C;  1P3A C;  4ZBJ B;  4ZUX A;  3AZH A;  4LD9 A;  3B6F A;  4ZUX D;  5GT0 C;  3KUY A;  3AZH D;  4WU8 B;  4LD9 D;  2HIO C;  3KUY D;  1ULY A;  3WKJ D;  5GSU C;  3KWQ A;  3REL C;  1P34 B;  5DNN C;  3W97 B;  1P3A B;  3AZK A;  1P3B C;  1HTA A;  2ARO C;  3AZK D;  5GT0 B;  5B31 C;  1H3O A;  5GT3 A;  1U35 A;  3AZE D;  5GT3 D;  3AZN A;  5B0Z C;  1U35 D;  5GSU B;  3REL B;  5AY8 D;  2Y2J A;  2FJ7 A;  3MVD A;  4XUJ A;  2YFV B;  2FJ7 D;  1ZLA C;  3MVD D;  1P3B B;  2ARO B;  3VH5 W;  1P3I C;  5B31 B;  4YM6 C;  2Y2G A;  3O62 C;  3X1V C;  1P3L C;  3EPH A;  5B0Z B;  3C1B D;  3C1C C;  1ZLA B;  4Z2M G;  1P3F D;  5CP6 A;  5CPI D;  1P3I B;  3AV1 C;  2CV5 D;  3A6N C;  4KGC A;  3B0D C;  2NQB D;  3B0C W;  3O62 B;  3X1V B;  5B40 A;  1P3L B;  4H9P A;  1ID3 C;  5B32 C;  4KUD C;  5B40 D;  1JFI B;  2PYO A;  3AZF A;  3KSY A;  5JA4 A;  3X1U C;  3AZM C;  2DF4 C;  3REI C;  1P3O A;  2ZM5 A;  1F1E A;  1P3M B;  3AZF D;  5BNV A;  3C1C B;  3VH6 T;  2G5H C;  3B6G B;  1F66 A;  1BH9 A;  2ZY2 A;  5B33 C;  3A6N B;  3LZ1 A;  5CPK B;  3W98 C;  1P34 D;  3LZ1 D;  4XZQ C;  3TU4 D;  1HQ3 D;  1P3A D;  4UUZ B;  1P3K B;  3AZM B;  3X1U B;  4QLC A;  2HIO A;  4Z2M H;  5GT0 D;  5DNM B;  3X1T A;  4LD9 C;  2HIO D;  3B6F C;  5B33 B;  5AV5 B;  3MNN A;  2IO5 C;  3AV2 A;  5B2J A;  3MNN D;  3NQU B;  1TZY A;  5JRG B;  3REL D;  2XD1 A;  3AV2 D;  3W98 B;  3W99 A;  5DNN D;  1A7W A;  4XZQ B;  1TZY D;  3KWQ C;  3W99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...