2J8PA

Nmr structure of c-terminal domain of human cstf-64
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
HMTPQDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CLEAVAGE STIMULATION FACTOR 64 KDA SUBUNIT
publication title The C-Terminal Domains of Vertebrate Cstf-64 and its Yeast Orthologue RNA15 Form a New Structure Critical for Mrna 3'-End Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14304 CSTF_C Transcription termination and cleavage factor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.70 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2j8pA00
2J8PA
chains in the Genus database with same CATH superfamily
4H9QA 3REJD 3AZLB 3AZFB 1U35D 3LZ1B 2NZDC 4E44A 5GXQB 5B1MD 3REHA 3X1TD 2AROC 2CV5B 5G49B 1JFIA 4H9QB 4X23A 2FJ7D 3H0MC 3W96B 3MGQB 5B31C 3X1VD 1TZYC 3REHB 4J8VB 1P3IA 3WKJC 3X1UA 1M19D 4X23B 5B33A 4NE6A 5JRGC 5AV6C 3LELD 1ID3D 4H9OB 1TAFB 3REKC 3AZEA 1P3OD 2DF4C 4HGAC 4YM6D 3AZJA 3LJAB 3AZEB 3EG5B 3KSYA 5B2ID 4E45A 2L5AA 2F8NG 1KX4B 1R4VA 1P3FD 5GT0B 3O62A 3AZNA 4H9PB 3KXBD 2Y2PA 1KX5D 2W8SA 2FFFB 4J8XB 4R8PA 3RELC 3UTBB 3AZKA 1ZLAD 3WAAD 5CP6A 4ZUXB 2NZDA 4G92C 5AVBB 2BYKA 2Y2HA 2PYOD 5B1LC 3VH6A 4XZQC 3AFAD 3REIC 2UWXA 1P34A 2NZDB 5B31A 5CPIC 1P3AC 3MNND 2AROB 3AZHC 3AZJD 4JJNC 1AOID 5B31B 4WU8C 3H0RC 4M6BA 1TZYB 3B0BA 1P3PC 3WKJB 1F1EA 3O62D 5JRGB 1M18C 5AV6B 3B0DC 1T3UA 3LZ0A 2NQBA 4R8PD 3REKB 2BG1A 2F8ND 3R45B 4HGAB 3X1SC 3FDDA 4WNNB 5AV8D 1B6WA 3KWQB 4ZBJC 1PZRA 3AV1D 5GT3A 3WTPA 3RELB 1P3GD 5B0YC 3W97A 2ZY5A 1P3LC 5B1LB 4XZQB 3REIB 2Y2LA 4QLCC 4WU8A 5CPIB 1P3AB 1P3PA 3AZHB 4JJNB 3WA9C 4WU8B 1P3PB 3B6FA 1M18B 4Z5TC 3B0DB 5GT3D 3AZID 3WTPD 3NQUA 3NQJB 3W99D 1HQ3D 5AVCD 5AV5D 4NE3A 1S32A 4DRAA 3KUYC 3X1SB 5AY8C 4Z66C 3AN2D 3VH5T 1F66C 4H9NA 4ZBJB 2HIOC 3B6FD 3C1CC 5B0YB 4G91C 4QLCA 5DNMD 3REJC 1P3LB 5F99A 5B32A 3A6ND 5B1MC 2ZY4A 1KX3C 4QLCB 3X1TC 3WA9A 1H3OB 3VH6W 4CAYA 5JA4B 3MGPA 2F8NH 3C1BD 3WA9B 5KDMB 5GSUD 3W98C 4KGCC 3MVDA 3LELC 1ID3C 4J8UC 1Z2CB 4Z5TB 4UUZB 5E5AD 5BNXA 4XUJC 1M1AD 3AV2A 4LD9C 5F99D 5BO0B 5B32D 2YFVB 3A1IA 4Z66B 5AY8B 3KUYB 5B0ZD 2Y2MA 5CPKD 1EQZC 2JSSA 3AZMD 3AZLA 3AZFA 1P3FC 3LZ1A 1F66B 2XD5A 5GXQA 3UTAD 2Y2JA 5B40C 2CWEA 3KXBC 2CV5A 5G49A 5B24D 3MGPD 1KX5C 1ZLAC 3W96A 2HIOB 3MGQA 4J8VA 5CPJD 3C1CB 5AV9C 4G91B 1P3BC 3MGSD 2F8NK 3REJB 5BNVB 5B1MB 4H9OA 3MNNC 1TAFA 4AWLC 3UT9D 3X1TB 1P3MD 1KX3B 3LJAA 3AYWC 3LZ1D 3W98B 4KGCB 1KX4A 4XUJA 4WU9D 2CV5D 1ID3B 3LELB 4J8UB 5GT0A 3MGQD 1KU5A 4H9PA 4XUJB 3REHD 4J8XA 4DRBA 3KWQC 5CHLB 2YFWB 4X23D 3UTBA 4ZUXA 5AVBA 3AZGC 4LD9B 5AV8C 1P3ID 2RVQC 3X1UD 1EQZB 1P3FB 5B33D 4YS3C 1WWIA 4UPKA 5B40B 3KXBB 2AROA 3AV1C 1KX5B 1ZLAB 3AZED 1P3GC 1TZYA 3WKJA 5AV9B 1P3BB 5JRGA 5AV6A 3MNNB 4KHAB 4AWLB 3REKA 1HTAA 3H0LC 4KUDC 2F2AC 3R45A 3AZND 3AZKD 3F6TA 1BFMA 5C3IC 5CP6D 3MGRC 3AYWB 4WNNA 2NZDD 3KWQA 3AZIC 1P34D 3W99C 5B31D 3AZGA 2F8NB 5AV5C 5BS7C 5FUGB 3RELA 2JE5A 2ZM5A 4YS3A 3AZGB 5AV8B 3B0CW 5JRGD 5B1LA 4XZQA 3REIA 1P3KC 3B6GC 4J8WC 4YS3B 5CPIA 1P3AA 3AL0C 3TU4C 3AZHA 3LZ0D 3AV1B 2NQBD 4JJNA 1P3GB 5B2JC 5DNMC 4CSRB 3EPLA 1M18A 3NQJA 4KUDB 3C1BC 3P5JB 1ULYA 3X1SA 2Y2IA 5C3IB 3MGRB 3REID 3W97D 5CPID 3AZHD 3AZIB 3W99B 1M1AC 4WU8D 5AV5B 1P3PD 5B32G 1AOIC 5B0YA 5CPKC 1M18D 1P3LA 2Y2NA 1P3KB 3B6GB 4J8WB 5DNNC 2XD1A 5B24C 1H3OA 3TU4B 1U35C 5JA4A 5CPJC 5B2JB 2Y2OA 5DNMB 2FJ7C 5KDMA 1S32D 4NE5A 1BH8B 4EO5C 3X1VC 1BH9B 4H9SC 1M19C 5BT1D 4Z5TA 4UUZA 1P3MC 1Q9CA 3C1BB 1P3LD 5BO0A 3KUYA 2YFVA 2G5HC 5AY8A 4Z66A 1P3OC 4QLCD 4WU9C 4YM6C 1F66A 5B2IC 1A7WA 1M1AB 3WA9D 2VQRA 2HIOA 2G5IC 1AOIB 3C1CA 5CPKB 3WAAC 1P3IC 3X1UC 3REJA 5B33C 1U35A 5BNVA 2DQNC 5B1MA 1KX3A 3X1TA 3V9RB 5DNNB 3MVDD 5B24B 2ZY3A 2PYOC 3EPKA 2FJ7A 3AFAC 1U35B 3X1VA 5CPJB 3AZJC 1WWSA 2Y2KA 3AV2D 2FJ7B 3X1VB 4EO5B 3W98A 4KGCA 1B67A 1ID3A 3LELA 1M19B 4J8UA 3AZLD 3AZFD 4WZSB 1P3MB 3O62C 5GXQD 1P3OA 3AZNC 2YFWA 4YM6A 4R8PC 3AZKC 3W96D 5CP6C 4LD9A 4WJ3C 5B2IA 3IP4C 1P3OB 4J8VD 1KX3D 1EQZA 2BYMB 4YM6B 4WU9B 1P3FA 1P34C 3B0CT 2IO5C 5B2IB 5B40A 5B31G 3KXBA 1KX5A 1ZLAA 1JFIB 3WAAA 3W98D 4KGCD 5AV9A 1P3IB 1P3BA 3LJAD 3WAAB 3X1UB 4J8UD 2PYOA 5B33B 3AFAA 1KX4D 4XUJD 3MNNA 4KHAA 3LZ0C 2PYOB 2NQBC 5GT0D 3AFAB 4LD9D 4J8XD 2ZY2A 3UTBD 1EQZD 3AYWA 3AZJB 4ZUXD 5AVBD 5B40D 3O62B 2F8NA 3AZNB 2AROD 5FUGA 5AV9D 5GT3C 1P3BD 3WTPC 4R8PB 3AZKB 3KFUG 5CP6B 1HQ3C 3W97C 5AV8A 1TZYD 5AVCC 3WKJD 2BYKB 3AN2C 1P34B 2IO5B 5AV6D 3AV1A 3REKD 3AYWD 1P3GA 4CSRA 3B6FC 3VH6T 3KWQD 1N1JA 3LZ0B 3A6NC 2NQBB 3EPJA 4KUDA 3VH5A 3AZGD 3RELD 2RVQD 1N1JB 1S32C 3MGRA 4YS3D 4WU9A 3EPHA 5BT1C 3AZIA 5B1LD 5GSUC 4XZQD 2LY8A 3W99A 1HQ3A 1P3AD 4Z2MH 4G92B 5AVCA 5AV5A 5BS7A 5E5AC 5GT3B 3WTPB 4JJND 2HUEC 3AN2A 1HQ3B 3W97B 5AVCB 1P3KA 5F99C 5B32C 3B6GA 3AN2B 4J8WA 5B0ZC 4KUDD 3AZMC 4DQYB 3TU4A 2Y2GA 3UTAC 3MGRD 5B2JA 3MGPC 5DNMA 1BH8A 4NFTA 3X1SD 3A6NA 3B6FB 1BH9A 3MVDC 2Y2QA 3MGSC 3A6NB 1W2EA 3NQUB 3UT9C 3C1BA 3AV2C 1S32B 1P3KD 5GSUA 3B6GD 5B0YD 4J8WD 3AZLC 3AZFC 3TU4D 3LZ1C 2JCHA 5E5AA 5GSUB 5GXQC 4H9NB 1M1AA 2CV5C 5B2JD 3W96C 3MGQC 5E5AB 1AOIA 2HUEB 3REHC 4J8VC 5CPKA 5B0ZA 4WV4B 4X23C 3AZMA 5F99B 5B32B 3UTAA 4Z2MG 3V9RA 4H9RA 5DNNA 5B0ZB 5B24A 3AZMB 4Z5TD 2RIQA 4CAYB 3UTAB 5CPJA 4H9RB 3MGPB 3LJAC 3MGSA 3AZEC 3KUYD 4Z66D 5AY8D 4H9SA 1KX4C 1M19A 3UT9A 3MVDB 3MGSB 1P3MA 1F66D 5GT0C 2J8PA 5BNXB 4J8XC 3UT9B 3UTBC 3A1KA 2HIOD 3AV2B 4ZUXC 5AVBC 3VH5W 3C1CD 2BYMA 5DNND 3WTPE
chains in the Genus database with same CATH topology
4H9QA 3REJD 3AZLB 3AZFB 1U35D 3LZ1B 2NZDC 4E44A 5GXQB 5B1MD 3REHA 3X1TD 2AROC 2CV5B 5G49B 1JFIA 4H9QB 4X23A 2FJ7D 3H0MC 3W96B 3MGQB 5B31C 3X1VD 1TZYC 3REHB 4J8VB 1P3IA 3WKJC 3X1UA 1M19D 4X23B 5B33A 4NE6A 5JRGC 5AV6C 3LELD 1ID3D 4H9OB 1TAFB 3REKC 3AZEA 1P3OD 2DF4C 4HGAC 4YM6D 3AZJA 3LJAB 3AZEB 3EG5B 3KSYA 5B2ID 4E45A 2L5AA 2F8NG 1KX4B 1R4VA 1P3FD 5GT0B 3O62A 3AZNA 4H9PB 3KXBD 2Y2PA 1KX5D 2W8SA 2FFFB 4J8XB 4R8PA 3RELC 3UTBB 3AZKA 1ZLAD 3WAAD 5CP6A 4ZUXB 2NZDA 4G92C 5AVBB 2BYKA 2Y2HA 2PYOD 5B1LC 3VH6A 4XZQC 3AFAD 3REIC 2UWXA 1P34A 2NZDB 5B31A 5CPIC 1P3AC 3MNND 2AROB 3AZHC 3AZJD 4JJNC 1AOID 5B31B 4WU8C 3H0RC 4M6BA 1TZYB 3B0BA 1P3PC 3WKJB 1F1EA 3O62D 5JRGB 1M18C 5AV6B 3B0DC 1T3UA 3LZ0A 2NQBA 4R8PD 3REKB 2BG1A 2F8ND 3R45B 4HGAB 3X1SC 3FDDA 4WNNB 5AV8D 1B6WA 3KWQB 4ZBJC 1PZRA 3AV1D 5GT3A 3WTPA 3RELB 1P3GD 5B0YC 3W97A 2ZY5A 1P3LC 5B1LB 4XZQB 3REIB 2Y2LA 4QLCC 4WU8A 5CPIB 1P3AB 1P3PA 3AZHB 4JJNB 3WA9C 4WU8B 1P3PB 3B6FA 1M18B 4Z5TC 3B0DB 5GT3D 3AZID 3WTPD 3NQUA 3NQJB 3W99D 1HQ3D 5AVCD 5AV5D 4NE3A 1S32A 4DRAA 3KUYC 3X1SB 5AY8C 4Z66C 3AN2D 3VH5T 1F66C 4H9NA 4ZBJB 2HIOC 3B6FD 3C1CC 5B0YB 4G91C 4QLCA 5DNMD 3REJC 1P3LB 5F99A 5B32A 3A6ND 5B1MC 2ZY4A 1KX3C 4QLCB 3X1TC 3WA9A 1H3OB 3VH6W 4CAYA 5JA4B 3MGPA 2F8NH 3C1BD 3WA9B 5KDMB 5GSUD 3W98C 4KGCC 3MVDA 3LELC 1ID3C 4J8UC 1Z2CB 4Z5TB 4UUZB 5E5AD 5BNXA 4XUJC 1M1AD 3AV2A 4LD9C 5F99D 5BO0B 5B32D 2YFVB 3A1IA 4Z66B 5AY8B 3KUYB 5B0ZD 2Y2MA 5CPKD 1EQZC 2JSSA 3AZMD 3AZLA 3AZFA 1P3FC 3LZ1A 1F66B 2XD5A 5GXQA 3UTAD 2Y2JA 5B40C 2CWEA 3KXBC 2CV5A 5G49A 5B24D 3MGPD 1KX5C 1ZLAC 3W96A 2HIOB 3MGQA 4J8VA 5CPJD 3C1CB 5AV9C 4G91B 1P3BC 3MGSD 2F8NK 3REJB 5BNVB 5B1MB 4H9OA 3MNNC 1TAFA 4AWLC 3UT9D 3X1TB 1P3MD 1KX3B 3LJAA 3AYWC 3LZ1D 3W98B 4KGCB 1KX4A 4XUJA 4WU9D 2CV5D 1ID3B 3LELB 4J8UB 5GT0A 3MGQD 1KU5A 4H9PA 4XUJB 3REHD 4J8XA 4DRBA 3KWQC 5CHLB 2YFWB 4X23D 3UTBA 4ZUXA 5AVBA 3AZGC 4LD9B 5AV8C 1P3ID 2RVQC 3X1UD 1EQZB 1P3FB 5B33D 4YS3C 1WWIA 4UPKA 5B40B 3KXBB 2AROA 3AV1C 1KX5B 1ZLAB 3AZED 1P3GC 1TZYA 3WKJA 5AV9B 1P3BB 5JRGA 5AV6A 3MNNB 4KHAB 4AWLB 3REKA 1HTAA 3H0LC 4KUDC 2F2AC 3R45A 3AZND 3AZKD 3F6TA 1BFMA 5C3IC 5CP6D 3MGRC 3AYWB 4WNNA 2NZDD 3KWQA 3AZIC 1P34D 3W99C 5B31D 3AZGA 2F8NB 5AV5C 5BS7C 5FUGB 3RELA 2JE5A 2ZM5A 4YS3A 3AZGB 5AV8B 3B0CW 5JRGD 5B1LA 4XZQA 3REIA 1P3KC 3B6GC 4J8WC 4YS3B 5CPIA 1P3AA 3AL0C 3TU4C 3AZHA 3LZ0D 3AV1B 2NQBD 4JJNA 1P3GB 5B2JC 5DNMC 4CSRB 3EPLA 1M18A 3NQJA 4KUDB 3C1BC 3P5JB 1ULYA 3X1SA 2Y2IA 5C3IB 3MGRB 3REID 3W97D 5CPID 3AZHD 3AZIB 3W99B 1M1AC 4WU8D 5AV5B 1P3PD 5B32G 1AOIC 5B0YA 5CPKC 1M18D 1P3LA 2Y2NA 1P3KB 3B6GB 4J8WB 5DNNC 2XD1A 5B24C 1H3OA 3TU4B 1U35C 5JA4A 5CPJC 5B2JB 2Y2OA 5DNMB 2FJ7C 5KDMA 1S32D 4NE5A 1BH8B 4EO5C 3X1VC 1BH9B 4H9SC 1M19C 5BT1D 4Z5TA 4UUZA 1P3MC 1Q9CA 3C1BB 1P3LD 5BO0A 3KUYA 2YFVA 2G5HC 5AY8A 4Z66A 1P3OC 4QLCD 4WU9C 4YM6C 1F66A 5B2IC 1A7WA 1M1AB 3WA9D 2VQRA 2HIOA 2G5IC 1AOIB 3C1CA 5CPKB 3WAAC 1P3IC 3X1UC 3REJA 5B33C 1U35A 5BNVA 2DQNC 5B1MA 1KX3A 3X1TA 3V9RB 5DNNB 3MVDD 5B24B 2ZY3A 2PYOC 3EPKA 2FJ7A 3AFAC 1U35B 3X1VA 5CPJB 3AZJC 1WWSA 2Y2KA 3AV2D 2FJ7B 3X1VB 4EO5B 3W98A 4KGCA 1B67A 1ID3A 3LELA 1M19B 4J8UA 3AZLD 3AZFD 4WZSB 1P3MB 3O62C 5GXQD 1P3OA 3AZNC 2YFWA 4YM6A 4R8PC 3AZKC 3W96D 5CP6C 4LD9A 4WJ3C 5B2IA 3IP4C 1P3OB 4J8VD 1KX3D 1EQZA 2BYMB 4YM6B 4WU9B 1P3FA 1P34C 3B0CT 2IO5C 5B2IB 5B40A 5B31G 3KXBA 1KX5A 1ZLAA 1JFIB 3WAAA 3W98D 4KGCD 5AV9A 1P3IB 1P3BA 3LJAD 3WAAB 3X1UB 4J8UD 2PYOA 5B33B 3AFAA 1KX4D 4XUJD 3MNNA 4KHAA 3LZ0C 2PYOB 2NQBC 5GT0D 3AFAB 4LD9D 4J8XD 2ZY2A 3UTBD 1EQZD 3AYWA 3AZJB 4ZUXD 5AVBD 5B40D 3O62B 2F8NA 3AZNB 2AROD 5FUGA 5AV9D 5GT3C 1P3BD 3WTPC 4R8PB 3AZKB 3KFUG 5CP6B 1HQ3C 3W97C 5AV8A 1TZYD 5AVCC 3WKJD 2BYKB 3AN2C 1P34B 2IO5B 5AV6D 3AV1A 3REKD 3AYWD 1P3GA 4CSRA 3B6FC 3VH6T 3KWQD 1N1JA 3LZ0B 3A6NC 2NQBB 3EPJA 4KUDA 3VH5A 3AZGD 3RELD 2RVQD 1N1JB 1S32C 3MGRA 4YS3D 4WU9A 3EPHA 5BT1C 3AZIA 5B1LD 5GSUC 4XZQD 2LY8A 3W99A 1HQ3A 1P3AD 4Z2MH 4G92B 5AVCA 5AV5A 5BS7A 5E5AC 5GT3B 3WTPB 4JJND 2HUEC 3AN2A 1HQ3B 3W97B 5AVCB 1P3KA 5F99C 5B32C 3B6GA 3AN2B 4J8WA 5B0ZC 4KUDD 3AZMC 4DQYB 3TU4A 2Y2GA 3UTAC 3MGRD 5B2JA 3MGPC 5DNMA 1BH8A 4NFTA 3X1SD 3A6NA 3B6FB 1BH9A 3MVDC 2Y2QA 3MGSC 3A6NB 1W2EA 3NQUB 3UT9C 3C1BA 3AV2C 1S32B 1P3KD 5GSUA 3B6GD 5B0YD 4J8WD 3AZLC 3AZFC 3TU4D 3LZ1C 2JCHA 5E5AA 5GSUB 5GXQC 4H9NB 1M1AA 2CV5C 5B2JD 3W96C 3MGQC 5E5AB 1AOIA 2HUEB 3REHC 4J8VC 5CPKA 5B0ZA 4WV4B 4X23C 3AZMA 5F99B 5B32B 3UTAA 4Z2MG 3V9RA 4H9RA 5DNNA 5B0ZB 5B24A 3AZMB 4Z5TD 2RIQA 4CAYB 3UTAB 5CPJA 4H9RB 3MGPB 3LJAC 3MGSA 3AZEC 3KUYD 4Z66D 5AY8D 4H9SA 1KX4C 1M19A 3UT9A 3MVDB 3MGSB 1P3MA 1F66D 5GT0C 2J8PA 5BNXB 4J8XC 3UT9B 3UTBC 3A1KA 2HIOD 3AV2B 4ZUXC 5AVBC 3VH5W 3C1CD 2BYMA 5DNND 3WTPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8P A; 
#chains in the Genus database with same CATH topology
 4H9Q A;  3REJ D;  3AZL B;  3AZF B;  1U35 D;  3LZ1 B;  2NZD C;  4E44 A;  5GXQ B;  5B1M D;  3REH A;  3X1T D;  2ARO C;  2CV5 B;  5G49 B;  1JFI A;  4H9Q B;  4X23 A;  2FJ7 D;  3H0M C;  3W96 B;  3MGQ B;  5B31 C;  3X1V D;  1TZY C;  3REH B;  4J8V B;  1P3I A;  3WKJ C;  3X1U A;  1M19 D;  4X23 B;  5B33 A;  4NE6 A;  5JRG C;  5AV6 C;  3LEL D;  1ID3 D;  4H9O B;  1TAF B;  3REK C;  3AZE A;  1P3O D;  2DF4 C;  4HGA C;  4YM6 D;  3AZJ A;  3LJA B;  3AZE B;  3EG5 B;  3KSY A;  5B2I D;  4E45 A;  2L5A A;  2F8N G;  1KX4 B;  1R4V A;  1P3F D;  5GT0 B;  3O62 A;  3AZN A;  4H9P B;  3KXB D;  2Y2P A;  1KX5 D;  2W8S A;  2FFF B;  4J8X B;  4R8P A;  3REL C;  3UTB B;  3AZK A;  1ZLA D;  3WAA D;  5CP6 A;  4ZUX B;  2NZD A;  4G92 C;  5AVB B;  2BYK A;  2Y2H A;  2PYO D;  5B1L C;  3VH6 A;  4XZQ C;  3AFA D;  3REI C;  2UWX A;  1P34 A;  2NZD B;  5B31 A;  5CPI C;  1P3A C;  3MNN D;  2ARO B;  3AZH C;  3AZJ D;  4JJN C;  1AOI D;  5B31 B;  4WU8 C;  3H0R C;  4M6B A;  1TZY B;  3B0B A;  1P3P C;  3WKJ B;  1F1E A;  3O62 D;  5JRG B;  1M18 C;  5AV6 B;  3B0D C;  1T3U A;  3LZ0 A;  2NQB A;  4R8P D;  3REK B;  2BG1 A;  2F8N D;  3R45 B;  4HGA B;  3X1S C;  3FDD A;  4WNN B;  5AV8 D;  1B6W A;  3KWQ B;  4ZBJ C;  1PZR A;  3AV1 D;  5GT3 A;  3WTP A;  3REL B;  1P3G D;  5B0Y C;  3W97 A;  2ZY5 A;  1P3L C;  5B1L B;  4XZQ B;  3REI B;  2Y2L A;  4QLC C;  4WU8 A;  5CPI B;  1P3A B;  1P3P A;  3AZH B;  4JJN B;  3WA9 C;  4WU8 B;  1P3P B;  3B6F A;  1M18 B;  4Z5T C;  3B0D B;  5GT3 D;  3AZI D;  3WTP D;  3NQU A;  3NQJ B;  3W99 D;  1HQ3 D;  5AVC D;  5AV5 D;  4NE3 A;  1S32 A;  4DRA A;  3KUY C;  3X1S B;  5AY8 C;  4Z66 C;  3AN2 D;  3VH5 T;  1F66 C;  4H9N A;  4ZBJ B;  2HIO C;  3B6F D;  3C1C C;  5B0Y B;  4G91 C;  4QLC A;  5DNM D;  3REJ C;  1P3L B;  5F99 A;  5B32 A;  3A6N D;  5B1M C;  2ZY4 A;  1KX3 C;  4QLC B;  3X1T C;  3WA9 A;  1H3O B;  3VH6 W;  4CAY A;  5JA4 B;  3MGP A;  2F8N H;  3C1B D;  3WA9 B;  5KDM B;  5GSU D;  3W98 C;  4KGC C;  3MVD A;  3LEL C;  1ID3 C;  4J8U C;  1Z2C B;  4Z5T B;  4UUZ B;  5E5A D;  5BNX A;  4XUJ C;  1M1A D;  3AV2 A;  4LD9 C;  5F99 D;  5BO0 B;  5B32 D;  2YFV B;  3A1I A;  4Z66 B;  5AY8 B;  3KUY B;  5B0Z D;  2Y2M A;  5CPK D;  1EQZ C;  2JSS A;  3AZM D;  3AZL A;  3AZF A;  1P3F C;  3LZ1 A;  1F66 B;  2XD5 A;  5GXQ A;  3UTA D;  2Y2J A;  5B40 C;  2CWE A;  3KXB C;  2CV5 A;  5G49 A;  5B24 D;  3MGP D;  1KX5 C;  1ZLA C;  3W96 A;  2HIO B;  3MGQ A;  4J8V A;  5CPJ D;  3C1C B;  5AV9 C;  4G91 B;  1P3B C;  3MGS D;  2F8N K;  3REJ B;  5BNV B;  5B1M B;  4H9O A;  3MNN C;  1TAF A;  4AWL C;  3UT9 D;  3X1T B;  1P3M D;  1KX3 B;  3LJA A;  3AYW C;  3LZ1 D;  3W98 B;  4KGC B;  1KX4 A;  4XUJ A;  4WU9 D;  2CV5 D;  1ID3 B;  3LEL B;  4J8U B;  5GT0 A;  3MGQ D;  1KU5 A;  4H9P A;  4XUJ B;  3REH D;  4J8X A;  4DRB A;  3KWQ C;  5CHL B;  2YFW B;  4X23 D;  3UTB A;  4ZUX A;  5AVB A;  3AZG C;  4LD9 B;  5AV8 C;  1P3I D;  2RVQ C;  3X1U D;  1EQZ B;  1P3F B;  5B33 D;  4YS3 C;  1WWI A;  4UPK A;  5B40 B;  3KXB B;  2ARO A;  3AV1 C;  1KX5 B;  1ZLA B;  3AZE D;  1P3G C;  1TZY A;  3WKJ A;  5AV9 B;  1P3B B;  5JRG A;  5AV6 A;  3MNN B;  4KHA B;  4AWL B;  3REK A;  1HTA A;  3H0L C;  4KUD C;  2F2A C;  3R45 A;  3AZN D;  3AZK D;  3F6T A;  1BFM A;  5C3I C;  5CP6 D;  3MGR C;  3AYW B;  4WNN A;  2NZD D;  3KWQ A;  3AZI C;  1P34 D;  3W99 C;  5B31 D;  3AZG A;  2F8N B;  5AV5 C;  5BS7 C;  5FUG B;  3REL A;  2JE5 A;  2ZM5 A;  4YS3 A;  3AZG B;  5AV8 B;  3B0C W;  5JRG D;  5B1L A;  4XZQ A;  3REI A;  1P3K C;  3B6G C;  4J8W C;  4YS3 B;  5CPI A;  1P3A A;  3AL0 C;  3TU4 C;  3AZH A;  3LZ0 D;  3AV1 B;  2NQB D;  4JJN A;  1P3G B;  5B2J C;  5DNM C;  4CSR B;  3EPL A;  1M18 A;  3NQJ A;  4KUD B;  3C1B C;  3P5J B;  1ULY A;  3X1S A;  2Y2I A;  5C3I B;  3MGR B;  3REI D;  3W97 D;  5CPI D;  3AZH D;  3AZI B;  3W99 B;  1M1A C;  4WU8 D;  5AV5 B;  1P3P D;  5B32 G;  1AOI C;  5B0Y A;  5CPK C;  1M18 D;  1P3L A;  2Y2N A;  1P3K B;  3B6G B;  4J8W B;  5DNN C;  2XD1 A;  5B24 C;  1H3O A;  3TU4 B;  1U35 C;  5JA4 A;  5CPJ C;  5B2J B;  2Y2O A;  5DNM B;  2FJ7 C;  5KDM A;  1S32 D;  4NE5 A;  1BH8 B;  4EO5 C;  3X1V C;  1BH9 B;  4H9S C;  1M19 C;  5BT1 D;  4Z5T A;  4UUZ A;  1P3M C;  1Q9C A;  3C1B B;  1P3L D;  5BO0 A;  3KUY A;  2YFV A;  2G5H C;  5AY8 A;  4Z66 A;  1P3O C;  4QLC D;  4WU9 C;  4YM6 C;  1F66 A;  5B2I C;  1A7W A;  1M1A B;  3WA9 D;  2VQR A;  2HIO A;  2G5I C;  1AOI B;  3C1C A;  5CPK B;  3WAA C;  1P3I C;  3X1U C;  3REJ A;  5B33 C;  1U35 A;  5BNV A;  2DQN C;  5B1M A;  1KX3 A;  3X1T A;  3V9R B;  5DNN B;  3MVD D;  5B24 B;  2ZY3 A;  2PYO C;  3EPK A;  2FJ7 A;  3AFA C;  1U35 B;  3X1V A;  5CPJ B;  3AZJ C;  1WWS A;  2Y2K A;  3AV2 D;  2FJ7 B;  3X1V B;  4EO5 B;  3W98 A;  4KGC A;  1B67 A;  1ID3 A;  3LEL A;  1M19 B;  4J8U A;  3AZL D;  3AZF D;  4WZS B;  1P3M B;  3O62 C;  5GXQ D;  1P3O A;  3AZN C;  2YFW A;  4YM6 A;  4R8P C;  3AZK C;  3W96 D;  5CP6 C;  4LD9 A;  4WJ3 C;  5B2I A;  3IP4 C;  1P3O B;  4J8V D;  1KX3 D;  1EQZ A;  2BYM B;  4YM6 B;  4WU9 B;  1P3F A;  1P34 C;  3B0C T;  2IO5 C;  5B2I B;  5B40 A;  5B31 G;  3KXB A;  1KX5 A;  1ZLA A;  1JFI B;  3WAA A;  3W98 D;  4KGC D;  5AV9 A;  1P3I B;  1P3B A;  3LJA D;  3WAA B;  3X1U B;  4J8U D;  2PYO A;  5B33 B;  3AFA A;  1KX4 D;  4XUJ D;  3MNN A;  4KHA A;  3LZ0 C;  2PYO B;  2NQB C;  5GT0 D;  3AFA B;  4LD9 D;  4J8X D;  2ZY2 A;  3UTB D;  1EQZ D;  3AYW A;  3AZJ B;  4ZUX D;  5AVB D;  5B40 D;  3O62 B;  2F8N A;  3AZN B;  2ARO D;  5FUG A;  5AV9 D;  5GT3 C;  1P3B D;  3WTP C;  4R8P B;  3AZK B;  3KFU G;  5CP6 B;  1HQ3 C;  3W97 C;  5AV8 A;  1TZY D;  5AVC C;  3WKJ D;  2BYK B;  3AN2 C;  1P34 B;  2IO5 B;  5AV6 D;  3AV1 A;  3REK D;  3AYW D;  1P3G A;  4CSR A;  3B6F C;  3VH6 T;  3KWQ D;  1N1J A;  3LZ0 B;  3A6N C;  2NQB B;  3EPJ A;  4KUD A;  3VH5 A;  3AZG D;  3REL D;  2RVQ D;  1N1J B;  1S32 C;  3MGR A;  4YS3 D;  4WU9 A;  3EPH A;  5BT1 C;  3AZI A;  5B1L D;  5GSU C;  4XZQ D;  2LY8 A;  3W99 A;  1HQ3 A;  1P3A D;  4Z2M H;  4G92 B;  5AVC A;  5AV5 A;  5BS7 A;  5E5A C;  5GT3 B;  3WTP B;  4JJN D;  2HUE C;  3AN2 A;  1HQ3 B;  3W97 B;  5AVC B;  1P3K A;  5F99 C;  5B32 C;  3B6G A;  3AN2 B;  4J8W A;  5B0Z C;  4KUD D;  3AZM C;  4DQY B;  3TU4 A;  2Y2G A;  3UTA C;  3MGR D;  5B2J A;  3MGP C;  5DNM A;  1BH8 A;  4NFT A;  3X1S D;  3A6N A;  3B6F B;  1BH9 A;  3MVD C;  2Y2Q A;  3MGS C;  3A6N B;  1W2E A;  3NQU B;  3UT9 C;  3C1B A;  3AV2 C;  1S32 B;  1P3K D;  5GSU A;  3B6G D;  5B0Y D;  4J8W D;  3AZL C;  3AZF C;  3TU4 D;  3LZ1 C;  2JCH A;  5E5A A;  5GSU B;  5GXQ C;  4H9N B;  1M1A A;  2CV5 C;  5B2J D;  3W96 C;  3MGQ C;  5E5A B;  1AOI A;  2HUE B;  3REH C;  4J8V C;  5CPK A;  5B0Z A;  4WV4 B;  4X23 C;  3AZM A;  5F99 B;  5B32 B;  3UTA A;  4Z2M G;  3V9R A;  4H9R A;  5DNN A;  5B0Z B;  5B24 A;  3AZM B;  4Z5T D;  2RIQ A;  4CAY B;  3UTA B;  5CPJ A;  4H9R B;  3MGP B;  3LJA C;  3MGS A;  3AZE C;  3KUY D;  4Z66 D;  5AY8 D;  4H9S A;  1KX4 C;  1M19 A;  3UT9 A;  3MVD B;  3MGS B;  1P3M A;  1F66 D;  5GT0 C;  2J8P A;  5BNX B;  4J8X C;  3UT9 B;  3UTB C;  3A1K A;  2HIO D;  3AV2 B;  4ZUX C;  5AVB C;  3VH5 W;  3C1C D;  2BYM A;  5DNN D;  3WTP E; 
#chains in the Genus database with same CATH homology
 4H9Q A;  3REJ D;  3AZL B;  3AZF B;  1U35 D;  3LZ1 B;  2NZD C;  4E44 A;  5GXQ B;  5B1M D;  3REH A;  3X1T D;  2ARO C;  2CV5 B;  5G49 B;  1JFI A;  4H9Q B;  4X23 A;  2FJ7 D;  3H0M C;  3W96 B;  3MGQ B;  5B31 C;  3X1V D;  1TZY C;  3REH B;  4J8V B;  1P3I A;  3WKJ C;  3X1U A;  1M19 D;  4X23 B;  5B33 A;  4NE6 A;  5JRG C;  5AV6 C;  3LEL D;  1ID3 D;  4H9O B;  1TAF B;  3REK C;  3AZE A;  1P3O D;  2DF4 C;  4HGA C;  4YM6 D;  3AZJ A;  3LJA B;  3AZE B;  3EG5 B;  3KSY A;  5B2I D;  4E45 A;  2L5A A;  2F8N G;  1KX4 B;  1R4V A;  1P3F D;  5GT0 B;  3O62 A;  3AZN A;  4H9P B;  3KXB D;  2Y2P A;  1KX5 D;  2W8S A;  2FFF B;  4J8X B;  4R8P A;  3REL C;  3UTB B;  3AZK A;  1ZLA D;  3WAA D;  5CP6 A;  4ZUX B;  2NZD A;  4G92 C;  5AVB B;  2BYK A;  2Y2H A;  2PYO D;  5B1L C;  3VH6 A;  4XZQ C;  3AFA D;  3REI C;  2UWX A;  1P34 A;  2NZD B;  5B31 A;  5CPI C;  1P3A C;  3MNN D;  2ARO B;  3AZH C;  3AZJ D;  4JJN C;  1AOI D;  5B31 B;  4WU8 C;  3H0R C;  4M6B A;  1TZY B;  3B0B A;  1P3P C;  3WKJ B;  1F1E A;  3O62 D;  5JRG B;  1M18 C;  5AV6 B;  3B0D C;  1T3U A;  3LZ0 A;  2NQB A;  4R8P D;  3REK B;  2BG1 A;  2F8N D;  3R45 B;  4HGA B;  3X1S C;  3FDD A;  4WNN B;  5AV8 D;  1B6W A;  3KWQ B;  4ZBJ C;  1PZR A;  3AV1 D;  5GT3 A;  3WTP A;  3REL B;  1P3G D;  5B0Y C;  3W97 A;  2ZY5 A;  1P3L C;  5B1L B;  4XZQ B;  3REI B;  2Y2L A;  4QLC C;  4WU8 A;  5CPI B;  1P3A B;  1P3P A;  3AZH B;  4JJN B;  3WA9 C;  4WU8 B;  1P3P B;  3B6F A;  1M18 B;  4Z5T C;  3B0D B;  5GT3 D;  3AZI D;  3WTP D;  3NQU A;  3NQJ B;  3W99 D;  1HQ3 D;  5AVC D;  5AV5 D;  4NE3 A;  1S32 A;  4DRA A;  3KUY C;  3X1S B;  5AY8 C;  4Z66 C;  3AN2 D;  3VH5 T;  1F66 C;  4H9N A;  4ZBJ B;  2HIO C;  3B6F D;  3C1C C;  5B0Y B;  4G91 C;  4QLC A;  5DNM D;  3REJ C;  1P3L B;  5F99 A;  5B32 A;  3A6N D;  5B1M C;  2ZY4 A;  1KX3 C;  4QLC B;  3X1T C;  3WA9 A;  1H3O B;  3VH6 W;  4CAY A;  5JA4 B;  3MGP A;  2F8N H;  3C1B D;  3WA9 B;  5KDM B;  5GSU D;  3W98 C;  4KGC C;  3MVD A;  3LEL C;  1ID3 C;  4J8U C;  1Z2C B;  4Z5T B;  4UUZ B;  5E5A D;  5BNX A;  4XUJ C;  1M1A D;  3AV2 A;  4LD9 C;  5F99 D;  5BO0 B;  5B32 D;  2YFV B;  3A1I A;  4Z66 B;  5AY8 B;  3KUY B;  5B0Z D;  2Y2M A;  5CPK D;  1EQZ C;  2JSS A;  3AZM D;  3AZL A;  3AZF A;  1P3F C;  3LZ1 A;  1F66 B;  2XD5 A;  5GXQ A;  3UTA D;  2Y2J A;  5B40 C;  2CWE A;  3KXB C;  2CV5 A;  5G49 A;  5B24 D;  3MGP D;  1KX5 C;  1ZLA C;  3W96 A;  2HIO B;  3MGQ A;  4J8V A;  5CPJ D;  3C1C B;  5AV9 C;  4G91 B;  1P3B C;  3MGS D;  2F8N K;  3REJ B;  5BNV B;  5B1M B;  4H9O A;  3MNN C;  1TAF A;  4AWL C;  3UT9 D;  3X1T B;  1P3M D;  1KX3 B;  3LJA A;  3AYW C;  3LZ1 D;  3W98 B;  4KGC B;  1KX4 A;  4XUJ A;  4WU9 D;  2CV5 D;  1ID3 B;  3LEL B;  4J8U B;  5GT0 A;  3MGQ D;  1KU5 A;  4H9P A;  4XUJ B;  3REH D;  4J8X A;  4DRB A;  3KWQ C;  5CHL B;  2YFW B;  4X23 D;  3UTB A;  4ZUX A;  5AVB A;  3AZG C;  4LD9 B;  5AV8 C;  1P3I D;  2RVQ C;  3X1U D;  1EQZ B;  1P3F B;  5B33 D;  4YS3 C;  1WWI A;  4UPK A;  5B40 B;  3KXB B;  2ARO A;  3AV1 C;  1KX5 B;  1ZLA B;  3AZE D;  1P3G C;  1TZY A;  3WKJ A;  5AV9 B;  1P3B B;  5JRG A;  5AV6 A;  3MNN B;  4KHA B;  4AWL B;  3REK A;  1HTA A;  3H0L C;  4KUD C;  2F2A C;  3R45 A;  3AZN D;  3AZK D;  3F6T A;  1BFM A;  5C3I C;  5CP6 D;  3MGR C;  3AYW B;  4WNN A;  2NZD D;  3KWQ A;  3AZI C;  1P34 D;  3W99 C;  5B31 D;  3AZG A;  2F8N B;  5AV5 C;  5BS7 C;  5FUG B;  3REL A;  2JE5 A;  2ZM5 A;  4YS3 A;  3AZG B;  5AV8 B;  3B0C W;  5JRG D;  5B1L A;  4XZQ A;  3REI A;  1P3K C;  3B6G C;  4J8W C;  4YS3 B;  5CPI A;  1P3A A;  3AL0 C;  3TU4 C;  3AZH A;  3LZ0 D;  3AV1 B;  2NQB D;  4JJN A;  1P3G B;  5B2J C;  5DNM C;  4CSR B;  3EPL A;  1M18 A;  3NQJ A;  4KUD B;  3C1B C;  3P5J B;  1ULY A;  3X1S A;  2Y2I A;  5C3I B;  3MGR B;  3REI D;  3W97 D;  5CPI D;  3AZH D;  3AZI B;  3W99 B;  1M1A C;  4WU8 D;  5AV5 B;  1P3P D;  5B32 G;  1AOI C;  5B0Y A;  5CPK C;  1M18 D;  1P3L A;  2Y2N A;  1P3K B;  3B6G B;  4J8W B;  5DNN C;  2XD1 A;  5B24 C;  1H3O A;  3TU4 B;  1U35 C;  5JA4 A;  5CPJ C;  5B2J B;  2Y2O A;  5DNM B;  2FJ7 C;  5KDM A;  1S32 D;  4NE5 A;  1BH8 B;  4EO5 C;  3X1V C;  1BH9 B;  4H9S C;  1M19 C;  5BT1 D;  4Z5T A;  4UUZ A;  1P3M C;  1Q9C A;  3C1B B;  1P3L D;  5BO0 A;  3KUY A;  2YFV A;  2G5H C;  5AY8 A;  4Z66 A;  1P3O C;  4QLC D;  4WU9 C;  4YM6 C;  1F66 A;  5B2I C;  1A7W A;  1M1A B;  3WA9 D;  2VQR A;  2HIO A;  2G5I C;  1AOI B;  3C1C A;  5CPK B;  3WAA C;  1P3I C;  3X1U C;  3REJ A;  5B33 C;  1U35 A;  5BNV A;  2DQN C;  5B1M A;  1KX3 A;  3X1T A;  3V9R B;  5DNN B;  3MVD D;  5B24 B;  2ZY3 A;  2PYO C;  3EPK A;  2FJ7 A;  3AFA C;  1U35 B;  3X1V A;  5CPJ B;  3AZJ C;  1WWS A;  2Y2K A;  3AV2 D;  2FJ7 B;  3X1V B;  4EO5 B;  3W98 A;  4KGC A;  1B67 A;  1ID3 A;  3LEL A;  1M19 B;  4J8U A;  3AZL D;  3AZF D;  4WZS B;  1P3M B;  3O62 C;  5GXQ D;  1P3O A;  3AZN C;  2YFW A;  4YM6 A;  4R8P C;  3AZK C;  3W96 D;  5CP6 C;  4LD9 A;  4WJ3 C;  5B2I A;  3IP4 C;  1P3O B;  4J8V D;  1KX3 D;  1EQZ A;  2BYM B;  4YM6 B;  4WU9 B;  1P3F A;  1P34 C;  3B0C T;  2IO5 C;  5B2I B;  5B40 A;  5B31 G;  3KXB A;  1KX5 A;  1ZLA A;  1JFI B;  3WAA A;  3W98 D;  4KGC D;  5AV9 A;  1P3I B;  1P3B A;  3LJA D;  3WAA B;  3X1U B;  4J8U D;  2PYO A;  5B33 B;  3AFA A;  1KX4 D;  4XUJ D;  3MNN A;  4KHA A;  3LZ0 C;  2PYO B;  2NQB C;  5GT0 D;  3AFA B;  4LD9 D;  4J8X D;  2ZY2 A;  3UTB D;  1EQZ D;  3AYW A;  3AZJ B;  4ZUX D;  5AVB D;  5B40 D;  3O62 B;  2F8N A;  3AZN B;  2ARO D;  5FUG A;  5AV9 D;  5GT3 C;  1P3B D;  3WTP C;  4R8P B;  3AZK B;  3KFU G;  5CP6 B;  1HQ3 C;  3W97 C;  5AV8 A;  1TZY D;  5AVC C;  3WKJ D;  2BYK B;  3AN2 C;  1P34 B;  2IO5 B;  5AV6 D;  3AV1 A;  3REK D;  3AYW D;  1P3G A;  4CSR A;  3B6F C;  3VH6 T;  3KWQ D;  1N1J A;  3LZ0 B;  3A6N C;  2NQB B;  3EPJ A;  4KUD A;  3VH5 A;  3AZG D;  3REL D;  2RVQ D;  1N1J B;  1S32 C;  3MGR A;  4YS3 D;  4WU9 A;  3EPH A;  5BT1 C;  3AZI A;  5B1L D;  5GSU C;  4XZQ D;  2LY8 A;  3W99 A;  1HQ3 A;  1P3A D;  4Z2M H;  4G92 B;  5AVC A;  5AV5 A;  5BS7 A;  5E5A C;  5GT3 B;  3WTP B;  4JJN D;  2HUE C;  3AN2 A;  1HQ3 B;  3W97 B;  5AVC B;  1P3K A;  5F99 C;  5B32 C;  3B6G A;  3AN2 B;  4J8W A;  5B0Z C;  4KUD D;  3AZM C;  4DQY B;  3TU4 A;  2Y2G A;  3UTA C;  3MGR D;  5B2J A;  3MGP C;  5DNM A;  1BH8 A;  4NFT A;  3X1S D;  3A6N A;  3B6F B;  1BH9 A;  3MVD C;  2Y2Q A;  3MGS C;  3A6N B;  1W2E A;  3NQU B;  3UT9 C;  3C1B A;  3AV2 C;  1S32 B;  1P3K D;  5GSU A;  3B6G D;  5B0Y D;  4J8W D;  3AZL C;  3AZF C;  3TU4 D;  3LZ1 C;  2JCH A;  5E5A A;  5GSU B;  5GXQ C;  4H9N B;  1M1A A;  2CV5 C;  5B2J D;  3W96 C;  3MGQ C;  5E5A B;  1AOI A;  2HUE B;  3REH C;  4J8V C;  5CPK A;  5B0Z A;  4WV4 B;  4X23 C;  3AZM A;  5F99 B;  5B32 B;  3UTA A;  4Z2M G;  3V9R A;  4H9R A;  5DNN A;  5B0Z B;  5B24 A;  3AZM B;  4Z5T D;  2RIQ A;  4CAY B;  3UTA B;  5CPJ A;  4H9R B;  3MGP B;  3LJA C;  3MGS A;  3AZE C;  3KUY D;  4Z66 D;  5AY8 D;  4H9S A;  1KX4 C;  1M19 A;  3UT9 A;  3MVD B;  3MGS B;  1P3M A;  1F66 D;  5GT0 C;  2J8P A;  5BNX B;  4J8X C;  3UT9 B;  3UTB C;  3A1K A;  2HIO D;  3AV2 B;  4ZUX C;  5AVB C;  3VH5 W;  3C1C D;  2BYM A;  5DNN D;  3WTP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...