1P3BC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bC00
1U35B 4KGCC 3AZEA 3AZKC 4H9SA 1ZLAD 3UT9B 3B0DB 3MVDA 3TU4A 5B31G 5AY8C 5E5AB 1P3IB 4E44A 1KX4D 5CHLB 3REHB 3W96B 4XZQB 5BNVB 4WU8C 5CP6D 5B1MD 4EO5B 3AZJA 2FJ7C 3X1UD 5B0ZB 3AFAD 2HIOB 5B1LB 3KWQC 4NE3A 1AOIC 4KGCB 3REIC 3AZKB 4H9NB 4HGAC 5AY8B 3LJAD 3MGPC 1TAFA 1M19D 4XZQD 2F8NA 4WU9A 4XUJA 4H9OA 1KU5A 4WU8B 3REKC 1P3GA 3MNNC 5B0ZD 4Z66A 2FJ7B 3AZGC 5B24D 3O62C 2HIOD 5B1LD 5AV5C 4J8XB 3KWQB 4NE6A 4KGCD 2NQBD 3AZKD 3AZIB 4WNNA 3REIB 1N1JA 1A7WA 2BYMA 4HGAB 1F66A 5AY8D 5GT3C 3AZLA 4QLCC 3MGPB 5BNXB 3AZNA 4J8VA 3LZ1C 4H9RB 4WU8D 2CWEA 3NQUA 3REKB 5B31C 3B6FC 3MNNB 1JFIA 3AZGB 5AV5B 3X1VC 1KX5D 3KWQD 1P3PA 3MGSA 2PYOC 3X1SA 1AOID 3AV1A 4YS3C 4LD9C 4YM6C 1BH8B 2LY8A 4CSRB 3REJC 5F99A 5KDMB 1P3LA 4QLCB 3AZFC 1ID3D 3X1TC 5G49B 3LZ1B 3AN2C 1P3AA 5B31B 3MNND 3C1BC 1P3BD 5AVCC 5B0YC 4KUDA 3AZMD 3O62D 4KHAB 3X1VB 2F8NK 5AV6D 2NZDC 1P3FC 4DRAA 3RELC 2BYKB 4YS3B 3A6NA 3WTPA 2IO5C 4LD9B 4YM6B 5B33A 3REJB 1BH9A 5GSUC 5GT3D 5CPKA 3W97B 3WA9C 3WAAC 3AZFB 5JA4B 1EQZA 1HQ3C 3X1TB 3LELD 4JJNC 3R45B 4Z5TB 5DNMC 5AV8A 3W99A 5B2IA 2F8NG 3UTAC 3LZ0A 3B6FD 3AZHC 5B2JD 5AVCB 5B0YB 4G92C 3KXBA 1P3OC 5DNNA 3NQJA 5B40C 2NZDB 2PYOD 1P3FB 5AV9D 1P3KC 3RELB 4X23D 4YS3D 4H9QA 3MGRA 1U35C 4LD9D 2IO5B 5GT0A 1H3OB 5GXQA 5GSUB 1P3MC 3W98A 5JRGC 5BT1C 3AZFD 3WA9B 3WAAB 2CV5C 1HQ3B 4ZBJC 4J8UB 4JJNB 1F1EA 3AN2D 5CPIC 3C1BD 3UTAB 1P34C 1ZLAA 5AVCD 3AZHB 4NFTA 1M18D 4G92B 1P3OB 1KX3D 2NZDD 5B40B 4G91C 1P3KB 1KX4A 5CP6A 5GSUD 5B1MA 1P3MB 5JRGB 3WA9D 3X1UA 3VH6T 3AFAA 3B0CT 4CAYB 2CV5B 4ZBJB 4E45A 5CPJD 4JJND 5DNMD 3KSYA 3UTAD 5CPIB 3AZHD 1P34B 4UUZA 2AROD 4J8XC 4G91B 3LJAA 1P3KD 1U35D 4XZQA 4XUJC 4WU9C 1S32C 3AZIC 1M19A 3UT9D 3WKJC 5BT1D 5E5AD 5B0ZA 1P3ID 3VH6W 5B24A 2HIOA 1HTAA 3B0CW 5B1LA 3REHD 2CV5D 3W96D 4KGCA 2NQBA 3AZKA 3C1CC 1P34D 3MGQC 1F66C 5AY8A 1TAFB 4J8VC 2F8NB 4WU9B 4XUJB 4H9OB 1S32B 4WU8A 5B32C 3WKJB 4M6BA 1TZYC 1KX5A 3MGSC 3X1SC 3KWQA 3AV1C 4WNNB 1AOIA 3VH5T 3KUYC 1N1JB 3C1CB 2HUEC 4R8PC 3MGQB 1F66B 2FJ7D 4J8XD 3V9RA 3AZNB 5BNXA 4J8VB 1ID3A 1S32D 3NQUB 3REID 4H9RA 3AZID 5B32B 3WKJD 1P3BA 3MNNA 5BS7A 3O62A 3AZMA 1TZYB 3MGPD 3W97C 5AV6A 3MGSB 3X1SB 3REKD 4Z5TC 3AV1B 3VH6A 3VH5W 3WTPC 3A6NC 3KUYB 3C1CD 3AV2C 5BO0A 2HUEB 3MGQD 4R8PB 3AZGD 5GT3A 5AV5D 3B6GC 4QLCA 4ZUXC 2YFVB 5AV8C 3W99C 3LELA 5B32D 5B2IC 4AWLC 3LZ0C 3B6FA 3UTBC 5B2JA 1TZYD 4QLCD 4KHAA 5AVBC 4J8WC 3LZ1D 4J8UC 2PYOA 4Z2MG 5AV9A 3KUYD 3A6NB 3WTPB 4X23A 4YS3A 5B31D 5GXQC 3AV2B 4R8PD 1Q9CA 1BH9B 4LD9A 1M1AC 3X1VD 3B6GB 2L5AA 3AZFA 5JA4A 3AYWC 4ZUXB 5FUGA 1WWSA 5AV8B 3W99B 4AWLB 5B2IB 4YM6D 3LZ0B 3REJD 3AN2A 1ZLAC 3C1BA 2F8NH 3UTBB 5AVCA 5C3IC 3W97D 5DNNB 1M18A 1KX3A 4H9PB 3NQJB 2NZDA 5AVBB 3X1TD 1KX4C 4J8WB 1ULYA 4Z5TD 4H9QB 3AZEC 4H9SC 3AV2D 5GXQB 5B0YD 2RVQC 3MVDC 3TU4C 5GSUA 1M1AB 3VH5A 3B6GD 4WZSB 3AFAC 3WA9A 4ZUXD 1P3FD 3AYWB 3RELD 5CPJA 4JJNA 5DNMA 2YFWB 3UTAA 1ZLAB 3UTBD 3AZJC 3AZHA 5C3IB 2AROA 3WAAD 1B6WA 5AVBD 1HQ3D 4J8WD 4J8UD 1KX4B 1M19C 1P3KA 3AZEB 1U35A 3UT9A 1M1AD 3MVDB 3TU4B 1P3OD 5B24C 5E5AA 5B40D 3AFAB 1P3IA 3AYWD 4CAYA 2CV5A 3REHA 3W96A 5BNVA 2NQBC 1P3GC 5CPIA 3B0BA 4UUZB 3AZJB 1P34A 1P3MD 4Z66C 5JRGD 3LJAB 1M19B 3AZED 5CPID 4H9NA 1R4VA 3MVDD 2RVQD 3TU4D 3AZLC 5B24B 1KX5C 3AZNC 2NQBB 3WTPE 1P3GB 3AZJD 4Z66B 2FJ7A 4J8XA 1P3PC 4NE5A 1ID3C 1S32A 3AZIA 3REIA 2BYMB 3WKJA 1P3BC 5F99C 5BS7C 3AZMC 3AZLB 1P3LC 1KX5B 5AV6C 3MGPA 2F8ND 4WU9D 4XUJD 1AOIB 1P3GD 3REKA 1P3AC 3C1CA 2JSSA 4Z66D 1JFIB 3MGQA 4KUDC 1WWIA 3AZGA 3V9RB 5AV5A 4DRBA 1P3PB 1ID3B 3LELC 5B32A 5B33C 1BH8A 1F66D 4CSRA 1P3BB 5B2JC 5F99B 5CPKC 3AZLD 3AZMB 3O62B 5KDMA 1P3LB 1TZYA 3AZND 5AV6B 1EQZC 4J8VD 5G49A 5AV9C 3LZ1A 4X23C 3KUYA 5BO0B 1P3AB 5B31A 4R8PA 4KUDB 3KXBC 5GT3B 5DNNC 3X1VA 1P3PD 3MGSD 3X1SD 2YFVA 3LELB 3MGRC 3AV1D 2BYKA 5GT0C 5B33B 4YM6A 3REJA 5F99D 3B6FB 3W98C 5B2JB 5CPKB 1P3LD 1M18C 1KX3C 3W97A 1EQZB 2PYOB 3X1TA 5AV9B 3R45A 4Z5TA 4X23B 1P3AD 4Z2MH 3AV2A 4KUDD 1B67A 5B0YA 3KXBB 3B6GA 4WV4B 4ZUXA 5FUGB 1P3FA 3MGRB 5CPJC 3A6ND 3WTPD 3RELA 5CP6C 5GT0B 5B33D 3AN2B 3C1BB 1H3OA 5B1MC 5CPKD 3W98B 3UTBA 2AROC 1M18B 3X1UC 1KX3B 4H9PA 1EQZD 3WAAA 5AVBA 1HQ3A 4J8WA 5AV8D 3W99D 4J8UA 5B2ID 3LZ0D 3UT9C 3B0DC 3KXBD 1M1AA 5DNND 1P3OA 5E5AC 1P3IC 5B40A 3LJAC 3REHC 3AYWA 3MGRD 3W96C 4XZQC 5CPJB 5DNMB 5GT0D 2YFWA 5GXQD 5CP6B 5B32G 3W98D 5B1MB 4EO5C 1BFMA 1P3MA 2AROB 5B0ZC 3X1UB 5JRGA 2HIOC 5B1LC
chains in the Genus database with same CATH superfamily
1U35B 4KGCC 3AZEA 3AZKC 4H9SA 1ZLAD 3UT9B 3B0DB 3MVDA 2Y2OA 5B31G 3TU4A 5AY8C 5E5AB 1P3IB 4E44A 1KX4D 5CHLB 3REHB 3W96B 4XZQB 5BNVB 4WU8C 5CP6D 5B1MD 4EO5B 3AZJA 2FJ7C 3X1UD 5B0ZB 3AFAD 2HIOB 5B1LB 3KWQC 4NE3A 1AOIC 4KGCB 3REIC 3AZKB 4H9NB 4HGAC 5AY8B 3LJAD 3MGPC 1TAFA 1M19D 4XZQD 4UPKA 2Y2QA 2F8NA 4WU9A 4XUJA 4H9OA 1KU5A 4WU8B 3REKC 1P3GA 3MNNC 5B0ZD 4Z66A 2FJ7B 3AZGC 5B24D 3O62C 2HIOD 5B1LD 5AV5C 4J8XB 2Y2JA 3KWQB 4NE6A 4KGCD 2NQBD 3AZKD 3AZIB 4WNNA 2Y2MA 3REIB 1N1JA 1A7WA 2BYMA 4HGAB 1F66A 5AY8D 5GT3C 3AZLA 4QLCC 3MGPB 5BNXB 3AZNA 4J8VA 3LZ1C 4H9RB 4WU8D 2CWEA 3NQUA 3REKB 4WJ3C 5B31C 3B6FC 3MNNB 1JFIA 3AZGB 5AV5B 3X1VC 1KX5D 3KWQD 1P3PA 3MGSA 2PYOC 3X1SA 1AOID 3AV1A 4YS3C 4LD9C 4YM6C 1BH8B 2LY8A 4CSRB 3REJC 5F99A 5KDMB 1P3LA 3F6TA 4QLCB 3AZFC 1ID3D 3X1TC 5G49B 3LZ1B 2G5HC 3AN2C 1P3AA 5B31B 3MNND 3C1BC 1P3BD 5AVCC 5B0YC 4KUDA 3AZMD 3O62D 4KHAB 3X1VB 2F8NK 5AV6D 2NZDC 1P3FC 4DRAA 3RELC 2BYKB 4YS3B 3A6NA 3WTPA 2IO5C 4LD9B 4YM6B 5B33A 3REJB 1BH9A 5GSUC 1W2EA 5GT3D 5CPKA 3W97B 3WA9C 3WAAC 3AZFB 5JA4B 1EQZA 1HQ3C 3X1TB 3LELD 4JJNC 3R45B 4Z5TB 5DNMC 5AV8A 3W99A 3AL0C 5B2IA 2F8NG 3UTAC 3LZ0A 3B6FD 3AZHC 5B2JD 5AVCB 5B0YB 4G92C 3KXBA 1P3OC 5DNNA 3NQJA 5B40C 2NZDB 2PYOD 1P3FB 5AV9D 1P3KC 3RELB 4X23D 4YS3D 4H9QA 3MGRA 1U35C 4LD9D 2IO5B 5GT0A 1H3OB 5GXQA 5GSUB 1P3MC 3W98A 5JRGC 5BT1C 3AZFD 3WA9B 3WAAB 2CV5C 1HQ3B 4ZBJC 4J8UB 2BG1A 4JJNB 1F1EA 3AN2D 5CPIC 3C1BD 3UTAB 1P34C 1ZLAA 5AVCD 3AZHB 3H0LC 4NFTA 1M18D 4G92B 1P3OB 1KX3D 2NZDD 5B40B 4G91C 1P3KB 1KX4A 5CP6A 5GSUD 5B1MA 3EPLA 1P3MB 5JRGB 3WA9D 3X1UA 3VH6T 3FDDA 3B0CT 4CAYB 3AFAA 2CV5B 4ZBJB 4E45A 5CPJD 4JJND 5DNMD 3KSYA 3UTAD 5CPIB 3AZHD 1P34B 4UUZA 2AROD 4J8XC 4G91B 3LJAA 1P3KD 1U35D 4XZQA 4XUJC 4WU9C 1S32C 3AZIC 1M19A 3UT9D 2RIQA 3WKJC 5BT1D 5E5AD 5B0ZA 1P3ID 3VH6W 5B24A 2HIOA 1HTAA 3B0CW 5B1LA 3REHD 2CV5D 3W96D 2ZY2A 4KGCA 2NQBA 3AZKA 3C1CC 1P34D 3MGQC 1F66C 5AY8A 1TAFB 4J8VC 2F8NB 4WU9B 4XUJB 4H9OB 1S32B 4WU8A 5B32C 3WKJB 4M6BA 1TZYC 3A1KA 1KX5A 3MGSC 3X1SC 3KWQA 3AV1C 4WNNB 1AOIA 3VH5T 3KUYC 1N1JB 3C1CB 2HUEC 4R8PC 3MGQB 1F66B 2FJ7D 4J8XD 3V9RA 3AZNB 5BNXA 4J8VB 2XD1A 1ID3A 1S32D 3NQUB 3REID 4H9RA 3AZID 5B32B 3WKJD 1P3BA 3MNNA 5BS7A 3O62A 3AZMA 1TZYB 3MGPD 3W97C 5AV6A 3MGSB 3X1SB 3REKD 4Z5TC 3AV1B 3VH6A 3VH5W 3WTPC 3A6NC 3KUYB 3C1CD 3AV2C 5BO0A 2HUEB 3MGQD 4R8PB 3AZGD 5GT3A 5AV5D 3B6GC 2Y2LA 4QLCA 4ZUXC 2YFVB 5AV8C 3W99C 3LELA 5B32D 5B2IC 4AWLC 3LZ0C 3B6FA 3UTBC 5B2JA 1TZYD 4QLCD 4KHAA 5AVBC 4J8WC 3LZ1D 4J8UC 2PYOA 4Z2MG 5AV9A 3KUYD 3A6NB 3WTPB 4X23A 4YS3A 5B31D 5GXQC 3AV2B 4R8PD 1Q9CA 1BH9B 4LD9A 1M1AC 3EPJA 2J8PA 3X1VD 3B6GB 2L5AA 3AZFA 5JA4A 3AYWC 4ZUXB 5FUGA 1WWSA 5AV8B 3W99B 4AWLB 5B2IB 4YM6D 3LZ0B 2FFFB 3REJD 3AN2A 1ZLAC 3C1BA 2F8NH 3UTBB 5AVCA 5C3IC 3W97D 5DNNB 1M18A 1KX3A 4H9PB 3NQJB 2Y2HA 3EG5B 2NZDA 5AVBB 3X1TD 1KX4C 4J8WB 1ULYA 4Z5TD 4H9QB 3AZEC 4H9SC 3AV2D 5GXQB 5B0YD 2RVQC 3MVDC 3TU4C 5GSUA 1M1AB 3VH5A 3B6GD 4WZSB 3AFAC 3WA9A 4ZUXD 1P3FD 3AYWB 3RELD 5CPJA 4JJNA 5DNMA 2YFWB 3UTAA 1ZLAB 1T3UA 3UTBD 3AZJC 3AZHA 5C3IB 2AROA 3WAAD 1B6WA 5AVBD 1HQ3D 4J8WD 4J8UD 1KX4B 1M19C 1P3KA 3AZEB 1U35A 2UWXA 3UT9A 1M1AD 3MVDB 3TU4B 1P3OD 5B24C 5E5AA 5B40D 3AFAB 2DF4C 1P3IA 3AYWD 4CAYA 2CV5A 3REHA 3W96A 5BNVA 2NQBC 4DQYB 1P3GC 5CPIA 3B0BA 4UUZB 3AZJB 1P34A 1P3MD 4Z66C 5JRGD 2ZY4A 2JE5A 3LJAB 1M19B 3AZED 3A1IA 5CPID 4H9NA 1R4VA 3MVDD 2RVQD 3TU4D 2Y2GA 1PZRA 3AZLC 5B24B 1KX5C 3AZNC 2NQBB 3WTPE 1P3GB 3AZJD 4Z66B 2FJ7A 4J8XA 1P3PC 4NE5A 1ID3C 2G5IC 1S32A 3AZIA 3EPKA 3REIA 2Y2IA 2BYMB 3WKJA 1P3BC 5F99C 5BS7C 3AZMC 3AZLB 1P3LC 2F2AC 5AV6C 3MGPA 1KX5B 2F8ND 4WU9D 4XUJD 1AOIB 1P3GD 3REKA 3P5JB 1P3AC 3IP4C 3C1CA 2JSSA 4Z66D 1JFIB 3MGQA 4KUDC 3KFUG 1WWIA 3H0RC 3AZGA 3V9RB 2ZY3A 5AV5A 4DRBA 1P3PB 1ID3B 3LELC 5B32A 5B33C 1BH8A 1F66D 3EPHA 4CSRA 1P3BB 5B2JC 5F99B 5CPKC 3AZLD 3AZMB 2Y2NA 5KDMA 3O62B 1P3LB 1TZYA 2XD5A 3H0MC 5AV6B 3AZND 1EQZC 4J8VD 2DQNC 5G49A 5AV9C 3LZ1A 4X23C 3KUYA 5BO0B 1P3AB 5B31A 4R8PA 4KUDB 3KXBC 5GT3B 5DNNC 3X1VA 1P3PD 3MGSD 3X1SD 2JCHA 2YFVA 3LELB 3MGRC 3AV1D 2BYKA 5GT0C 5B33B 4YM6A 3REJA 5F99D 3B6FB 3W98C 5B2JB 2ZY5A 5CPKB 1P3LD 1M18C 1KX3C 3W97A 2ZM5A 1EQZB 2PYOB 3X1TA 5AV9B 3R45A 4Z5TA 4X23B 1P3AD 4Z2MH 2Y2PA 3AV2A 4KUDD 1B67A 5B0YA 3KXBB 3B6GA 4WV4B 4ZUXA 5FUGB 1P3FA 3MGRB 5CPJC 3A6ND 3WTPD 3RELA 2W8SA 5CP6C 5GT0B 5B33D 3AN2B 3C1BB 1H3OA 5B1MC 5CPKD 3W98B 3UTBA 2AROC 1M18B 3X1UC 1KX3B 4H9PA 1EQZD 3WAAA 5AVBA 1HQ3A 4J8WA 5AV8D 3W99D 4J8UA 5B2ID 3LZ0D 2VQRA 3UT9C 3B0DC 3KXBD 1M1AA 5DNND 1Z2CB 1P3OA 5E5AC 1P3IC 5B40A 3LJAC 3REHC 3AYWA 3MGRD 3W96C 4XZQC 5CPJB 5DNMB 5GT0D 2YFWA 5GXQD 5CP6B 5B32G 2Y2KA 3W98D 5B1MB 4EO5C 1BFMA 1P3MA 2AROB 5B0ZC 3X1UB 5JRGA 2HIOC 5B1LC
chains in the Genus database with same CATH topology
1U35B 4KGCC 3AZEA 3AZKC 4H9SA 1ZLAD 3UT9B 3B0DB 3MVDA 2Y2OA 5B31G 3TU4A 5AY8C 5E5AB 1P3IB 4E44A 1KX4D 5CHLB 3REHB 3W96B 4XZQB 5BNVB 4WU8C 5CP6D 5B1MD 4EO5B 3AZJA 2FJ7C 3X1UD 5B0ZB 3AFAD 2HIOB 5B1LB 3KWQC 4NE3A 1AOIC 4KGCB 3REIC 3AZKB 4H9NB 4HGAC 5AY8B 3LJAD 3MGPC 1TAFA 1M19D 4XZQD 4UPKA 2Y2QA 2F8NA 4WU9A 4XUJA 4H9OA 1KU5A 4WU8B 3REKC 1P3GA 3MNNC 5B0ZD 4Z66A 2FJ7B 3AZGC 5B24D 3O62C 2HIOD 5B1LD 5AV5C 4J8XB 2Y2JA 3KWQB 4NE6A 4KGCD 2NQBD 3AZKD 3AZIB 4WNNA 2Y2MA 3REIB 1N1JA 1A7WA 2BYMA 4HGAB 1F66A 5AY8D 5GT3C 3AZLA 4QLCC 3MGPB 5BNXB 3AZNA 4J8VA 3LZ1C 4H9RB 4WU8D 2CWEA 3NQUA 3REKB 4WJ3C 5B31C 3B6FC 3MNNB 1JFIA 3AZGB 5AV5B 3X1VC 1KX5D 3KWQD 1P3PA 3MGSA 2PYOC 3X1SA 1AOID 3AV1A 4YS3C 4LD9C 4YM6C 1BH8B 2LY8A 4CSRB 3REJC 5F99A 5KDMB 1P3LA 3F6TA 4QLCB 3AZFC 1ID3D 3X1TC 5G49B 3LZ1B 2G5HC 3AN2C 1P3AA 5B31B 3MNND 3C1BC 1P3BD 5AVCC 5B0YC 4KUDA 3AZMD 3O62D 4KHAB 3X1VB 2F8NK 5AV6D 2NZDC 1P3FC 4DRAA 3RELC 2BYKB 4YS3B 3A6NA 3WTPA 2IO5C 4LD9B 4YM6B 5B33A 3REJB 1BH9A 5GSUC 1W2EA 5GT3D 5CPKA 3W97B 3WA9C 3WAAC 3AZFB 5JA4B 1EQZA 1HQ3C 3X1TB 3LELD 4JJNC 3R45B 4Z5TB 5DNMC 5AV8A 3W99A 3AL0C 5B2IA 2F8NG 3UTAC 3LZ0A 3B6FD 3AZHC 5B2JD 5AVCB 5B0YB 4G92C 3KXBA 1P3OC 5DNNA 3NQJA 5B40C 2NZDB 2PYOD 1P3FB 5AV9D 1P3KC 3RELB 4X23D 4YS3D 4H9QA 3MGRA 1U35C 4LD9D 2IO5B 5GT0A 1H3OB 5GXQA 5GSUB 1P3MC 3W98A 5JRGC 5BT1C 3AZFD 3WA9B 3WAAB 2CV5C 1HQ3B 4ZBJC 4J8UB 2BG1A 4JJNB 1F1EA 3AN2D 5CPIC 3C1BD 3UTAB 1P34C 1ZLAA 5AVCD 3AZHB 3H0LC 4NFTA 1M18D 4G92B 1P3OB 1KX3D 2NZDD 5B40B 4G91C 1P3KB 1KX4A 5CP6A 5GSUD 5B1MA 3EPLA 1P3MB 5JRGB 3WA9D 3X1UA 3VH6T 3FDDA 3B0CT 4CAYB 3AFAA 2CV5B 4ZBJB 4E45A 5CPJD 4JJND 5DNMD 3KSYA 3UTAD 5CPIB 3AZHD 1P34B 4UUZA 2AROD 4J8XC 4G91B 3LJAA 1P3KD 1U35D 4XZQA 4XUJC 4WU9C 1S32C 3AZIC 1M19A 3UT9D 2RIQA 3WKJC 5BT1D 5E5AD 5B0ZA 1P3ID 3VH6W 5B24A 2HIOA 1HTAA 3B0CW 5B1LA 3REHD 2CV5D 3W96D 2ZY2A 4KGCA 2NQBA 3AZKA 3C1CC 1P34D 3MGQC 1F66C 5AY8A 1TAFB 4J8VC 2F8NB 4WU9B 4XUJB 4H9OB 1S32B 4WU8A 5B32C 3WKJB 4M6BA 1TZYC 3A1KA 1KX5A 3MGSC 3X1SC 3KWQA 3AV1C 4WNNB 1AOIA 3VH5T 3KUYC 1N1JB 3C1CB 2HUEC 4R8PC 3MGQB 1F66B 2FJ7D 4J8XD 3V9RA 3AZNB 5BNXA 4J8VB 2XD1A 1ID3A 1S32D 3NQUB 3REID 4H9RA 3AZID 5B32B 3WKJD 1P3BA 3MNNA 5BS7A 3O62A 3AZMA 1TZYB 3MGPD 3W97C 5AV6A 3MGSB 3X1SB 3REKD 4Z5TC 3AV1B 3VH6A 3VH5W 3WTPC 3A6NC 3KUYB 3C1CD 3AV2C 5BO0A 2HUEB 3MGQD 4R8PB 3AZGD 5GT3A 5AV5D 3B6GC 2Y2LA 4QLCA 4ZUXC 2YFVB 5AV8C 3W99C 3LELA 5B32D 5B2IC 4AWLC 3LZ0C 3B6FA 3UTBC 5B2JA 1TZYD 4QLCD 4KHAA 5AVBC 4J8WC 3LZ1D 4J8UC 2PYOA 4Z2MG 5AV9A 3KUYD 3A6NB 3WTPB 4X23A 4YS3A 5B31D 5GXQC 3AV2B 4R8PD 1Q9CA 1BH9B 4LD9A 1M1AC 3EPJA 2J8PA 3X1VD 3B6GB 2L5AA 3AZFA 5JA4A 3AYWC 4ZUXB 5FUGA 1WWSA 5AV8B 3W99B 4AWLB 5B2IB 4YM6D 3LZ0B 2FFFB 3REJD 3AN2A 1ZLAC 3C1BA 2F8NH 3UTBB 5AVCA 5C3IC 3W97D 5DNNB 1M18A 1KX3A 4H9PB 3NQJB 2Y2HA 3EG5B 2NZDA 5AVBB 3X1TD 1KX4C 4J8WB 1ULYA 4Z5TD 4H9QB 3AZEC 4H9SC 3AV2D 5GXQB 5B0YD 2RVQC 3MVDC 3TU4C 5GSUA 1M1AB 3VH5A 3B6GD 4WZSB 3AFAC 3WA9A 4ZUXD 1P3FD 3AYWB 3RELD 5CPJA 4JJNA 5DNMA 2YFWB 3UTAA 1ZLAB 1T3UA 3UTBD 3AZJC 3AZHA 5C3IB 2AROA 3WAAD 1B6WA 5AVBD 1HQ3D 4J8WD 4J8UD 1KX4B 1M19C 1P3KA 3AZEB 1U35A 2UWXA 3UT9A 1M1AD 3MVDB 3TU4B 1P3OD 5B24C 5E5AA 5B40D 3AFAB 2DF4C 1P3IA 3AYWD 4CAYA 2CV5A 3REHA 3W96A 5BNVA 2NQBC 4DQYB 1P3GC 5CPIA 3B0BA 4UUZB 3AZJB 1P34A 1P3MD 4Z66C 5JRGD 2ZY4A 2JE5A 3LJAB 1M19B 3AZED 3A1IA 5CPID 4H9NA 1R4VA 3MVDD 2RVQD 3TU4D 2Y2GA 1PZRA 3AZLC 5B24B 1KX5C 3AZNC 2NQBB 3WTPE 1P3GB 3AZJD 4Z66B 2FJ7A 4J8XA 1P3PC 4NE5A 1ID3C 2G5IC 1S32A 3AZIA 3EPKA 3REIA 2Y2IA 2BYMB 3WKJA 1P3BC 5F99C 5BS7C 3AZMC 3AZLB 1P3LC 2F2AC 5AV6C 3MGPA 1KX5B 2F8ND 4WU9D 4XUJD 1AOIB 1P3GD 3REKA 3P5JB 1P3AC 3IP4C 3C1CA 2JSSA 4Z66D 1JFIB 3MGQA 4KUDC 3KFUG 1WWIA 3H0RC 3AZGA 3V9RB 2ZY3A 5AV5A 4DRBA 1P3PB 1ID3B 3LELC 5B32A 5B33C 1BH8A 1F66D 3EPHA 4CSRA 1P3BB 5B2JC 5F99B 5CPKC 3AZLD 3AZMB 2Y2NA 5KDMA 3O62B 1P3LB 1TZYA 2XD5A 3H0MC 5AV6B 3AZND 1EQZC 4J8VD 2DQNC 5G49A 5AV9C 3LZ1A 4X23C 3KUYA 5BO0B 1P3AB 5B31A 4R8PA 4KUDB 3KXBC 5GT3B 5DNNC 3X1VA 1P3PD 3MGSD 3X1SD 2JCHA 2YFVA 3LELB 3MGRC 3AV1D 2BYKA 5GT0C 5B33B 4YM6A 3REJA 5F99D 3B6FB 3W98C 5B2JB 2ZY5A 5CPKB 1P3LD 1M18C 1KX3C 3W97A 2ZM5A 1EQZB 2PYOB 3X1TA 5AV9B 3R45A 4Z5TA 4X23B 1P3AD 4Z2MH 2Y2PA 3AV2A 4KUDD 1B67A 5B0YA 3KXBB 3B6GA 4WV4B 4ZUXA 5FUGB 1P3FA 3MGRB 5CPJC 3A6ND 3WTPD 3RELA 2W8SA 5CP6C 5GT0B 5B33D 3AN2B 3C1BB 1H3OA 5B1MC 5CPKD 3W98B 3UTBA 2AROC 1M18B 3X1UC 1KX3B 4H9PA 1EQZD 3WAAA 5AVBA 1HQ3A 4J8WA 5AV8D 3W99D 4J8UA 5B2ID 3LZ0D 2VQRA 3UT9C 3B0DC 3KXBD 1M1AA 5DNND 1Z2CB 1P3OA 5E5AC 1P3IC 5B40A 3LJAC 3REHC 3AYWA 3MGRD 3W96C 4XZQC 5CPJB 5DNMB 5GT0D 2YFWA 5GXQD 5CP6B 5B32G 2Y2KA 3W98D 5B1MB 4EO5C 1BFMA 1P3MA 2AROB 5B0ZC 3X1UB 5JRGA 2HIOC 5B1LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 B;  4KGC C;  3AZE A;  3AZK C;  4H9S A;  1ZLA D;  3UT9 B;  3B0D B;  3MVD A;  3TU4 A;  5B31 G;  5AY8 C;  5E5A B;  1P3I B;  4E44 A;  1KX4 D;  5CHL B;  3REH B;  3W96 B;  4XZQ B;  5BNV B;  4WU8 C;  5CP6 D;  5B1M D;  4EO5 B;  3AZJ A;  2FJ7 C;  3X1U D;  5B0Z B;  3AFA D;  2HIO B;  5B1L B;  3KWQ C;  4NE3 A;  1AOI C;  4KGC B;  3REI C;  3AZK B;  4H9N B;  4HGA C;  5AY8 B;  3LJA D;  3MGP C;  1TAF A;  1M19 D;  4XZQ D;  2F8N A;  4WU9 A;  4XUJ A;  4H9O A;  1KU5 A;  4WU8 B;  3REK C;  1P3G A;  3MNN C;  5B0Z D;  4Z66 A;  2FJ7 B;  3AZG C;  5B24 D;  3O62 C;  2HIO D;  5B1L D;  5AV5 C;  4J8X B;  3KWQ B;  4NE6 A;  4KGC D;  2NQB D;  3AZK D;  3AZI B;  4WNN A;  3REI B;  1N1J A;  1A7W A;  2BYM A;  4HGA B;  1F66 A;  5AY8 D;  5GT3 C;  3AZL A;  4QLC C;  3MGP B;  5BNX B;  3AZN A;  4J8V A;  3LZ1 C;  4H9R B;  4WU8 D;  2CWE A;  3NQU A;  3REK B;  5B31 C;  3B6F C;  3MNN B;  1JFI A;  3AZG B;  5AV5 B;  3X1V C;  1KX5 D;  3KWQ D;  1P3P A;  3MGS A;  2PYO C;  3X1S A;  1AOI D;  3AV1 A;  4YS3 C;  4LD9 C;  4YM6 C;  1BH8 B;  2LY8 A;  4CSR B;  3REJ C;  5F99 A;  5KDM B;  1P3L A;  4QLC B;  3AZF C;  1ID3 D;  3X1T C;  5G49 B;  3LZ1 B;  3AN2 C;  1P3A A;  5B31 B;  3MNN D;  3C1B C;  1P3B D;  5AVC C;  5B0Y C;  4KUD A;  3AZM D;  3O62 D;  4KHA B;  3X1V B;  2F8N K;  5AV6 D;  2NZD C;  1P3F C;  4DRA A;  3REL C;  2BYK B;  4YS3 B;  3A6N A;  3WTP A;  2IO5 C;  4LD9 B;  4YM6 B;  5B33 A;  3REJ B;  1BH9 A;  5GSU C;  5GT3 D;  5CPK A;  3W97 B;  3WA9 C;  3WAA C;  3AZF B;  5JA4 B;  1EQZ A;  1HQ3 C;  3X1T B;  3LEL D;  4JJN C;  3R45 B;  4Z5T B;  5DNM C;  5AV8 A;  3W99 A;  5B2I A;  2F8N G;  3UTA C;  3LZ0 A;  3B6F D;  3AZH C;  5B2J D;  5AVC B;  5B0Y B;  4G92 C;  3KXB A;  1P3O C;  5DNN A;  3NQJ A;  5B40 C;  2NZD B;  2PYO D;  1P3F B;  5AV9 D;  1P3K C;  3REL B;  4X23 D;  4YS3 D;  4H9Q A;  3MGR A;  1U35 C;  4LD9 D;  2IO5 B;  5GT0 A;  1H3O B;  5GXQ A;  5GSU B;  1P3M C;  3W98 A;  5JRG C;  5BT1 C;  3AZF D;  3WA9 B;  3WAA B;  2CV5 C;  1HQ3 B;  4ZBJ C;  4J8U B;  4JJN B;  1F1E A;  3AN2 D;  5CPI C;  3C1B D;  3UTA B;  1P34 C;  1ZLA A;  5AVC D;  3AZH B;  4NFT A;  1M18 D;  4G92 B;  1P3O B;  1KX3 D;  2NZD D;  5B40 B;  4G91 C;  1P3K B;  1KX4 A;  5CP6 A;  5GSU D;  5B1M A;  1P3M B;  5JRG B;  3WA9 D;  3X1U A;  3VH6 T;  3AFA A;  3B0C T;  4CAY B;  2CV5 B;  4ZBJ B;  4E45 A;  5CPJ D;  4JJN D;  5DNM D;  3KSY A;  3UTA D;  5CPI B;  3AZH D;  1P34 B;  4UUZ A;  2ARO D;  4J8X C;  4G91 B;  3LJA A;  1P3K D;  1U35 D;  4XZQ A;  4XUJ C;  4WU9 C;  1S32 C;  3AZI C;  1M19 A;  3UT9 D;  3WKJ C;  5BT1 D;  5E5A D;  5B0Z A;  1P3I D;  3VH6 W;  5B24 A;  2HIO A;  1HTA A;  3B0C W;  5B1L A;  3REH D;  2CV5 D;  3W96 D;  4KGC A;  2NQB A;  3AZK A;  3C1C C;  1P34 D;  3MGQ C;  1F66 C;  5AY8 A;  1TAF B;  4J8V C;  2F8N B;  4WU9 B;  4XUJ B;  4H9O B;  1S32 B;  4WU8 A;  5B32 C;  3WKJ B;  4M6B A;  1TZY C;  1KX5 A;  3MGS C;  3X1S C;  3KWQ A;  3AV1 C;  4WNN B;  1AOI A;  3VH5 T;  3KUY C;  1N1J B;  3C1C B;  2HUE C;  4R8P C;  3MGQ B;  1F66 B;  2FJ7 D;  4J8X D;  3V9R A;  3AZN B;  5BNX A;  4J8V B;  1ID3 A;  1S32 D;  3NQU B;  3REI D;  4H9R A;  3AZI D;  5B32 B;  3WKJ D;  1P3B A;  3MNN A;  5BS7 A;  3O62 A;  3AZM A;  1TZY B;  3MGP D;  3W97 C;  5AV6 A;  3MGS B;  3X1S B;  3REK D;  4Z5T C;  3AV1 B;  3VH6 A;  3VH5 W;  3WTP C;  3A6N C;  3KUY B;  3C1C D;  3AV2 C;  5BO0 A;  2HUE B;  3MGQ D;  4R8P B;  3AZG D;  5GT3 A;  5AV5 D;  3B6G C;  4QLC A;  4ZUX C;  2YFV B;  5AV8 C;  3W99 C;  3LEL A;  5B32 D;  5B2I C;  4AWL C;  3LZ0 C;  3B6F A;  3UTB C;  5B2J A;  1TZY D;  4QLC D;  4KHA A;  5AVB C;  4J8W C;  3LZ1 D;  4J8U C;  2PYO A;  4Z2M G;  5AV9 A;  3KUY D;  3A6N B;  3WTP B;  4X23 A;  4YS3 A;  5B31 D;  5GXQ C;  3AV2 B;  4R8P D;  1Q9C A;  1BH9 B;  4LD9 A;  1M1A C;  3X1V D;  3B6G B;  2L5A A;  3AZF A;  5JA4 A;  3AYW C;  4ZUX B;  5FUG A;  1WWS A;  5AV8 B;  3W99 B;  4AWL B;  5B2I B;  4YM6 D;  3LZ0 B;  3REJ D;  3AN2 A;  1ZLA C;  3C1B A;  2F8N H;  3UTB B;  5AVC A;  5C3I C;  3W97 D;  5DNN B;  1M18 A;  1KX3 A;  4H9P B;  3NQJ B;  2NZD A;  5AVB B;  3X1T D;  1KX4 C;  4J8W B;  1ULY A;  4Z5T D;  4H9Q B;  3AZE C;  4H9S C;  3AV2 D;  5GXQ B;  5B0Y D;  2RVQ C;  3MVD C;  3TU4 C;  5GSU A;  1M1A B;  3VH5 A;  3B6G D;  4WZS B;  3AFA C;  3WA9 A;  4ZUX D;  1P3F D;  3AYW B;  3REL D;  5CPJ A;  4JJN A;  5DNM A;  2YFW B;  3UTA A;  1ZLA B;  3UTB D;  3AZJ C;  3AZH A;  5C3I B;  2ARO A;  3WAA D;  1B6W A;  5AVB D;  1HQ3 D;  4J8W D;  4J8U D;  1KX4 B;  1M19 C;  1P3K A;  3AZE B;  1U35 A;  3UT9 A;  1M1A D;  3MVD B;  3TU4 B;  1P3O D;  5B24 C;  5E5A A;  5B40 D;  3AFA B;  1P3I A;  3AYW D;  4CAY A;  2CV5 A;  3REH A;  3W96 A;  5BNV A;  2NQB C;  1P3G C;  5CPI A;  3B0B A;  4UUZ B;  3AZJ B;  1P34 A;  1P3M D;  4Z66 C;  5JRG D;  3LJA B;  1M19 B;  3AZE D;  5CPI D;  4H9N A;  1R4V A;  3MVD D;  2RVQ D;  3TU4 D;  3AZL C;  5B24 B;  1KX5 C;  3AZN C;  2NQB B;  3WTP E;  1P3G B;  3AZJ D;  4Z66 B;  2FJ7 A;  4J8X A;  1P3P C;  4NE5 A;  1ID3 C;  1S32 A;  3AZI A;  3REI A;  2BYM B;  3WKJ A;  1P3B C;  5F99 C;  5BS7 C;  3AZM C;  3AZL B;  1P3L C;  1KX5 B;  5AV6 C;  3MGP A;  2F8N D;  4WU9 D;  4XUJ D;  1AOI B;  1P3G D;  3REK A;  1P3A C;  3C1C A;  2JSS A;  4Z66 D;  1JFI B;  3MGQ A;  4KUD C;  1WWI A;  3AZG A;  3V9R B;  5AV5 A;  4DRB A;  1P3P B;  1ID3 B;  3LEL C;  5B32 A;  5B33 C;  1BH8 A;  1F66 D;  4CSR A;  1P3B B;  5B2J C;  5F99 B;  5CPK C;  3AZL D;  3AZM B;  3O62 B;  5KDM A;  1P3L B;  1TZY A;  3AZN D;  5AV6 B;  1EQZ C;  4J8V D;  5G49 A;  5AV9 C;  3LZ1 A;  4X23 C;  3KUY A;  5BO0 B;  1P3A B;  5B31 A;  4R8P A;  4KUD B;  3KXB C;  5GT3 B;  5DNN C;  3X1V A;  1P3P D;  3MGS D;  3X1S D;  2YFV A;  3LEL B;  3MGR C;  3AV1 D;  2BYK A;  5GT0 C;  5B33 B;  4YM6 A;  3REJ A;  5F99 D;  3B6F B;  3W98 C;  5B2J B;  5CPK B;  1P3L D;  1M18 C;  1KX3 C;  3W97 A;  1EQZ B;  2PYO B;  3X1T A;  5AV9 B;  3R45 A;  4Z5T A;  4X23 B;  1P3A D;  4Z2M H;  3AV2 A;  4KUD D;  1B67 A;  5B0Y A;  3KXB B;  3B6G A;  4WV4 B;  4ZUX A;  5FUG B;  1P3F A;  3MGR B;  5CPJ C;  3A6N D;  3WTP D;  3REL A;  5CP6 C;  5GT0 B;  5B33 D;  3AN2 B;  3C1B B;  1H3O A;  5B1M C;  5CPK D;  3W98 B;  3UTB A;  2ARO C;  1M18 B;  3X1U C;  1KX3 B;  4H9P A;  1EQZ D;  3WAA A;  5AVB A;  1HQ3 A;  4J8W A;  5AV8 D;  3W99 D;  4J8U A;  5B2I D;  3LZ0 D;  3UT9 C;  3B0D C;  3KXB D;  1M1A A;  5DNN D;  1P3O A;  5E5A C;  1P3I C;  5B40 A;  3LJA C;  3REH C;  3AYW A;  3MGR D;  3W96 C;  4XZQ C;  5CPJ B;  5DNM B;  5GT0 D;  2YFW A;  5GXQ D;  5CP6 B;  5B32 G;  3W98 D;  5B1M B;  4EO5 C;  1BFM A;  1P3M A;  2ARO B;  5B0Z C;  3X1U B;  5JRG A;  2HIO C;  5B1L C; 
#chains in the Genus database with same CATH topology
 1U35 B;  4KGC C;  3AZE A;  3AZK C;  4H9S A;  1ZLA D;  3UT9 B;  3B0D B;  3MVD A;  2Y2O A;  5B31 G;  3TU4 A;  5AY8 C;  5E5A B;  1P3I B;  4E44 A;  1KX4 D;  5CHL B;  3REH B;  3W96 B;  4XZQ B;  5BNV B;  4WU8 C;  5CP6 D;  5B1M D;  4EO5 B;  3AZJ A;  2FJ7 C;  3X1U D;  5B0Z B;  3AFA D;  2HIO B;  5B1L B;  3KWQ C;  4NE3 A;  1AOI C;  4KGC B;  3REI C;  3AZK B;  4H9N B;  4HGA C;  5AY8 B;  3LJA D;  3MGP C;  1TAF A;  1M19 D;  4XZQ D;  4UPK A;  2Y2Q A;  2F8N A;  4WU9 A;  4XUJ A;  4H9O A;  1KU5 A;  4WU8 B;  3REK C;  1P3G A;  3MNN C;  5B0Z D;  4Z66 A;  2FJ7 B;  3AZG C;  5B24 D;  3O62 C;  2HIO D;  5B1L D;  5AV5 C;  4J8X B;  2Y2J A;  3KWQ B;  4NE6 A;  4KGC D;  2NQB D;  3AZK D;  3AZI B;  4WNN A;  2Y2M A;  3REI B;  1N1J A;  1A7W A;  2BYM A;  4HGA B;  1F66 A;  5AY8 D;  5GT3 C;  3AZL A;  4QLC C;  3MGP B;  5BNX B;  3AZN A;  4J8V A;  3LZ1 C;  4H9R B;  4WU8 D;  2CWE A;  3NQU A;  3REK B;  4WJ3 C;  5B31 C;  3B6F C;  3MNN B;  1JFI A;  3AZG B;  5AV5 B;  3X1V C;  1KX5 D;  3KWQ D;  1P3P A;  3MGS A;  2PYO C;  3X1S A;  1AOI D;  3AV1 A;  4YS3 C;  4LD9 C;  4YM6 C;  1BH8 B;  2LY8 A;  4CSR B;  3REJ C;  5F99 A;  5KDM B;  1P3L A;  3F6T A;  4QLC B;  3AZF C;  1ID3 D;  3X1T C;  5G49 B;  3LZ1 B;  2G5H C;  3AN2 C;  1P3A A;  5B31 B;  3MNN D;  3C1B C;  1P3B D;  5AVC C;  5B0Y C;  4KUD A;  3AZM D;  3O62 D;  4KHA B;  3X1V B;  2F8N K;  5AV6 D;  2NZD C;  1P3F C;  4DRA A;  3REL C;  2BYK B;  4YS3 B;  3A6N A;  3WTP A;  2IO5 C;  4LD9 B;  4YM6 B;  5B33 A;  3REJ B;  1BH9 A;  5GSU C;  1W2E A;  5GT3 D;  5CPK A;  3W97 B;  3WA9 C;  3WAA C;  3AZF B;  5JA4 B;  1EQZ A;  1HQ3 C;  3X1T B;  3LEL D;  4JJN C;  3R45 B;  4Z5T B;  5DNM C;  5AV8 A;  3W99 A;  3AL0 C;  5B2I A;  2F8N G;  3UTA C;  3LZ0 A;  3B6F D;  3AZH C;  5B2J D;  5AVC B;  5B0Y B;  4G92 C;  3KXB A;  1P3O C;  5DNN A;  3NQJ A;  5B40 C;  2NZD B;  2PYO D;  1P3F B;  5AV9 D;  1P3K C;  3REL B;  4X23 D;  4YS3 D;  4H9Q A;  3MGR A;  1U35 C;  4LD9 D;  2IO5 B;  5GT0 A;  1H3O B;  5GXQ A;  5GSU B;  1P3M C;  3W98 A;  5JRG C;  5BT1 C;  3AZF D;  3WA9 B;  3WAA B;  2CV5 C;  1HQ3 B;  4ZBJ C;  4J8U B;  2BG1 A;  4JJN B;  1F1E A;  3AN2 D;  5CPI C;  3C1B D;  3UTA B;  1P34 C;  1ZLA A;  5AVC D;  3AZH B;  3H0L C;  4NFT A;  1M18 D;  4G92 B;  1P3O B;  1KX3 D;  2NZD D;  5B40 B;  4G91 C;  1P3K B;  1KX4 A;  5CP6 A;  5GSU D;  5B1M A;  3EPL A;  1P3M B;  5JRG B;  3WA9 D;  3X1U A;  3VH6 T;  3FDD A;  3B0C T;  4CAY B;  3AFA A;  2CV5 B;  4ZBJ B;  4E45 A;  5CPJ D;  4JJN D;  5DNM D;  3KSY A;  3UTA D;  5CPI B;  3AZH D;  1P34 B;  4UUZ A;  2ARO D;  4J8X C;  4G91 B;  3LJA A;  1P3K D;  1U35 D;  4XZQ A;  4XUJ C;  4WU9 C;  1S32 C;  3AZI C;  1M19 A;  3UT9 D;  2RIQ A;  3WKJ C;  5BT1 D;  5E5A D;  5B0Z A;  1P3I D;  3VH6 W;  5B24 A;  2HIO A;  1HTA A;  3B0C W;  5B1L A;  3REH D;  2CV5 D;  3W96 D;  2ZY2 A;  4KGC A;  2NQB A;  3AZK A;  3C1C C;  1P34 D;  3MGQ C;  1F66 C;  5AY8 A;  1TAF B;  4J8V C;  2F8N B;  4WU9 B;  4XUJ B;  4H9O B;  1S32 B;  4WU8 A;  5B32 C;  3WKJ B;  4M6B A;  1TZY C;  3A1K A;  1KX5 A;  3MGS C;  3X1S C;  3KWQ A;  3AV1 C;  4WNN B;  1AOI A;  3VH5 T;  3KUY C;  1N1J B;  3C1C B;  2HUE C;  4R8P C;  3MGQ B;  1F66 B;  2FJ7 D;  4J8X D;  3V9R A;  3AZN B;  5BNX A;  4J8V B;  2XD1 A;  1ID3 A;  1S32 D;  3NQU B;  3REI D;  4H9R A;  3AZI D;  5B32 B;  3WKJ D;  1P3B A;  3MNN A;  5BS7 A;  3O62 A;  3AZM A;  1TZY B;  3MGP D;  3W97 C;  5AV6 A;  3MGS B;  3X1S B;  3REK D;  4Z5T C;  3AV1 B;  3VH6 A;  3VH5 W;  3WTP C;  3A6N C;  3KUY B;  3C1C D;  3AV2 C;  5BO0 A;  2HUE B;  3MGQ D;  4R8P B;  3AZG D;  5GT3 A;  5AV5 D;  3B6G C;  2Y2L A;  4QLC A;  4ZUX C;  2YFV B;  5AV8 C;  3W99 C;  3LEL A;  5B32 D;  5B2I C;  4AWL C;  3LZ0 C;  3B6F A;  3UTB C;  5B2J A;  1TZY D;  4QLC D;  4KHA A;  5AVB C;  4J8W C;  3LZ1 D;  4J8U C;  2PYO A;  4Z2M G;  5AV9 A;  3KUY D;  3A6N B;  3WTP B;  4X23 A;  4YS3 A;  5B31 D;  5GXQ C;  3AV2 B;  4R8P D;  1Q9C A;  1BH9 B;  4LD9 A;  1M1A C;  3EPJ A;  2J8P A;  3X1V D;  3B6G B;  2L5A A;  3AZF A;  5JA4 A;  3AYW C;  4ZUX B;  5FUG A;  1WWS A;  5AV8 B;  3W99 B;  4AWL B;  5B2I B;  4YM6 D;  3LZ0 B;  2FFF B;  3REJ D;  3AN2 A;  1ZLA C;  3C1B A;  2F8N H;  3UTB B;  5AVC A;  5C3I C;  3W97 D;  5DNN B;  1M18 A;  1KX3 A;  4H9P B;  3NQJ B;  2Y2H A;  3EG5 B;  2NZD A;  5AVB B;  3X1T D;  1KX4 C;  4J8W B;  1ULY A;  4Z5T D;  4H9Q B;  3AZE C;  4H9S C;  3AV2 D;  5GXQ B;  5B0Y D;  2RVQ C;  3MVD C;  3TU4 C;  5GSU A;  1M1A B;  3VH5 A;  3B6G D;  4WZS B;  3AFA C;  3WA9 A;  4ZUX D;  1P3F D;  3AYW B;  3REL D;  5CPJ A;  4JJN A;  5DNM A;  2YFW B;  3UTA A;  1ZLA B;  1T3U A;  3UTB D;  3AZJ C;  3AZH A;  5C3I B;  2ARO A;  3WAA D;  1B6W A;  5AVB D;  1HQ3 D;  4J8W D;  4J8U D;  1KX4 B;  1M19 C;  1P3K A;  3AZE B;  1U35 A;  2UWX A;  3UT9 A;  1M1A D;  3MVD B;  3TU4 B;  1P3O D;  5B24 C;  5E5A A;  5B40 D;  3AFA B;  2DF4 C;  1P3I A;  3AYW D;  4CAY A;  2CV5 A;  3REH A;  3W96 A;  5BNV A;  2NQB C;  4DQY B;  1P3G C;  5CPI A;  3B0B A;  4UUZ B;  3AZJ B;  1P34 A;  1P3M D;  4Z66 C;  5JRG D;  2ZY4 A;  2JE5 A;  3LJA B;  1M19 B;  3AZE D;  3A1I A;  5CPI D;  4H9N A;  1R4V A;  3MVD D;  2RVQ D;  3TU4 D;  2Y2G A;  1PZR A;  3AZL C;  5B24 B;  1KX5 C;  3AZN C;  2NQB B;  3WTP E;  1P3G B;  3AZJ D;  4Z66 B;  2FJ7 A;  4J8X A;  1P3P C;  4NE5 A;  1ID3 C;  2G5I C;  1S32 A;  3AZI A;  3EPK A;  3REI A;  2Y2I A;  2BYM B;  3WKJ A;  1P3B C;  5F99 C;  5BS7 C;  3AZM C;  3AZL B;  1P3L C;  2F2A C;  5AV6 C;  3MGP A;  1KX5 B;  2F8N D;  4WU9 D;  4XUJ D;  1AOI B;  1P3G D;  3REK A;  3P5J B;  1P3A C;  3IP4 C;  3C1C A;  2JSS A;  4Z66 D;  1JFI B;  3MGQ A;  4KUD C;  3KFU G;  1WWI A;  3H0R C;  3AZG A;  3V9R B;  2ZY3 A;  5AV5 A;  4DRB A;  1P3P B;  1ID3 B;  3LEL C;  5B32 A;  5B33 C;  1BH8 A;  1F66 D;  3EPH A;  4CSR A;  1P3B B;  5B2J C;  5F99 B;  5CPK C;  3AZL D;  3AZM B;  2Y2N A;  5KDM A;  3O62 B;  1P3L B;  1TZY A;  2XD5 A;  3H0M C;  5AV6 B;  3AZN D;  1EQZ C;  4J8V D;  2DQN C;  5G49 A;  5AV9 C;  3LZ1 A;  4X23 C;  3KUY A;  5BO0 B;  1P3A B;  5B31 A;  4R8P A;  4KUD B;  3KXB C;  5GT3 B;  5DNN C;  3X1V A;  1P3P D;  3MGS D;  3X1S D;  2JCH A;  2YFV A;  3LEL B;  3MGR C;  3AV1 D;  2BYK A;  5GT0 C;  5B33 B;  4YM6 A;  3REJ A;  5F99 D;  3B6F B;  3W98 C;  5B2J B;  2ZY5 A;  5CPK B;  1P3L D;  1M18 C;  1KX3 C;  3W97 A;  2ZM5 A;  1EQZ B;  2PYO B;  3X1T A;  5AV9 B;  3R45 A;  4Z5T A;  4X23 B;  1P3A D;  4Z2M H;  2Y2P A;  3AV2 A;  4KUD D;  1B67 A;  5B0Y A;  3KXB B;  3B6G A;  4WV4 B;  4ZUX A;  5FUG B;  1P3F A;  3MGR B;  5CPJ C;  3A6N D;  3WTP D;  3REL A;  2W8S A;  5CP6 C;  5GT0 B;  5B33 D;  3AN2 B;  3C1B B;  1H3O A;  5B1M C;  5CPK D;  3W98 B;  3UTB A;  2ARO C;  1M18 B;  3X1U C;  1KX3 B;  4H9P A;  1EQZ D;  3WAA A;  5AVB A;  1HQ3 A;  4J8W A;  5AV8 D;  3W99 D;  4J8U A;  5B2I D;  3LZ0 D;  2VQR A;  3UT9 C;  3B0D C;  3KXB D;  1M1A A;  5DNN D;  1Z2C B;  1P3O A;  5E5A C;  1P3I C;  5B40 A;  3LJA C;  3REH C;  3AYW A;  3MGR D;  3W96 C;  4XZQ C;  5CPJ B;  5DNM B;  5GT0 D;  2YFW A;  5GXQ D;  5CP6 B;  5B32 G;  2Y2K A;  3W98 D;  5B1M B;  4EO5 C;  1BFM A;  1P3M A;  2ARO B;  5B0Z C;  3X1U B;  5JRG A;  2HIO C;  5B1L C; 
#chains in the Genus database with same CATH homology
 1U35 B;  4KGC C;  3AZE A;  3AZK C;  4H9S A;  1ZLA D;  3UT9 B;  3B0D B;  3MVD A;  2Y2O A;  5B31 G;  3TU4 A;  5AY8 C;  5E5A B;  1P3I B;  4E44 A;  1KX4 D;  5CHL B;  3REH B;  3W96 B;  4XZQ B;  5BNV B;  4WU8 C;  5CP6 D;  5B1M D;  4EO5 B;  3AZJ A;  2FJ7 C;  3X1U D;  5B0Z B;  3AFA D;  2HIO B;  5B1L B;  3KWQ C;  4NE3 A;  1AOI C;  4KGC B;  3REI C;  3AZK B;  4H9N B;  4HGA C;  5AY8 B;  3LJA D;  3MGP C;  1TAF A;  1M19 D;  4XZQ D;  4UPK A;  2Y2Q A;  2F8N A;  4WU9 A;  4XUJ A;  4H9O A;  1KU5 A;  4WU8 B;  3REK C;  1P3G A;  3MNN C;  5B0Z D;  4Z66 A;  2FJ7 B;  3AZG C;  5B24 D;  3O62 C;  2HIO D;  5B1L D;  5AV5 C;  4J8X B;  2Y2J A;  3KWQ B;  4NE6 A;  4KGC D;  2NQB D;  3AZK D;  3AZI B;  4WNN A;  2Y2M A;  3REI B;  1N1J A;  1A7W A;  2BYM A;  4HGA B;  1F66 A;  5AY8 D;  5GT3 C;  3AZL A;  4QLC C;  3MGP B;  5BNX B;  3AZN A;  4J8V A;  3LZ1 C;  4H9R B;  4WU8 D;  2CWE A;  3NQU A;  3REK B;  4WJ3 C;  5B31 C;  3B6F C;  3MNN B;  1JFI A;  3AZG B;  5AV5 B;  3X1V C;  1KX5 D;  3KWQ D;  1P3P A;  3MGS A;  2PYO C;  3X1S A;  1AOI D;  3AV1 A;  4YS3 C;  4LD9 C;  4YM6 C;  1BH8 B;  2LY8 A;  4CSR B;  3REJ C;  5F99 A;  5KDM B;  1P3L A;  3F6T A;  4QLC B;  3AZF C;  1ID3 D;  3X1T C;  5G49 B;  3LZ1 B;  2G5H C;  3AN2 C;  1P3A A;  5B31 B;  3MNN D;  3C1B C;  1P3B D;  5AVC C;  5B0Y C;  4KUD A;  3AZM D;  3O62 D;  4KHA B;  3X1V B;  2F8N K;  5AV6 D;  2NZD C;  1P3F C;  4DRA A;  3REL C;  2BYK B;  4YS3 B;  3A6N A;  3WTP A;  2IO5 C;  4LD9 B;  4YM6 B;  5B33 A;  3REJ B;  1BH9 A;  5GSU C;  1W2E A;  5GT3 D;  5CPK A;  3W97 B;  3WA9 C;  3WAA C;  3AZF B;  5JA4 B;  1EQZ A;  1HQ3 C;  3X1T B;  3LEL D;  4JJN C;  3R45 B;  4Z5T B;  5DNM C;  5AV8 A;  3W99 A;  3AL0 C;  5B2I A;  2F8N G;  3UTA C;  3LZ0 A;  3B6F D;  3AZH C;  5B2J D;  5AVC B;  5B0Y B;  4G92 C;  3KXB A;  1P3O C;  5DNN A;  3NQJ A;  5B40 C;  2NZD B;  2PYO D;  1P3F B;  5AV9 D;  1P3K C;  3REL B;  4X23 D;  4YS3 D;  4H9Q A;  3MGR A;  1U35 C;  4LD9 D;  2IO5 B;  5GT0 A;  1H3O B;  5GXQ A;  5GSU B;  1P3M C;  3W98 A;  5JRG C;  5BT1 C;  3AZF D;  3WA9 B;  3WAA B;  2CV5 C;  1HQ3 B;  4ZBJ C;  4J8U B;  2BG1 A;  4JJN B;  1F1E A;  3AN2 D;  5CPI C;  3C1B D;  3UTA B;  1P34 C;  1ZLA A;  5AVC D;  3AZH B;  3H0L C;  4NFT A;  1M18 D;  4G92 B;  1P3O B;  1KX3 D;  2NZD D;  5B40 B;  4G91 C;  1P3K B;  1KX4 A;  5CP6 A;  5GSU D;  5B1M A;  3EPL A;  1P3M B;  5JRG B;  3WA9 D;  3X1U A;  3VH6 T;  3FDD A;  3B0C T;  4CAY B;  3AFA A;  2CV5 B;  4ZBJ B;  4E45 A;  5CPJ D;  4JJN D;  5DNM D;  3KSY A;  3UTA D;  5CPI B;  3AZH D;  1P34 B;  4UUZ A;  2ARO D;  4J8X C;  4G91 B;  3LJA A;  1P3K D;  1U35 D;  4XZQ A;  4XUJ C;  4WU9 C;  1S32 C;  3AZI C;  1M19 A;  3UT9 D;  2RIQ A;  3WKJ C;  5BT1 D;  5E5A D;  5B0Z A;  1P3I D;  3VH6 W;  5B24 A;  2HIO A;  1HTA A;  3B0C W;  5B1L A;  3REH D;  2CV5 D;  3W96 D;  2ZY2 A;  4KGC A;  2NQB A;  3AZK A;  3C1C C;  1P34 D;  3MGQ C;  1F66 C;  5AY8 A;  1TAF B;  4J8V C;  2F8N B;  4WU9 B;  4XUJ B;  4H9O B;  1S32 B;  4WU8 A;  5B32 C;  3WKJ B;  4M6B A;  1TZY C;  3A1K A;  1KX5 A;  3MGS C;  3X1S C;  3KWQ A;  3AV1 C;  4WNN B;  1AOI A;  3VH5 T;  3KUY C;  1N1J B;  3C1C B;  2HUE C;  4R8P C;  3MGQ B;  1F66 B;  2FJ7 D;  4J8X D;  3V9R A;  3AZN B;  5BNX A;  4J8V B;  2XD1 A;  1ID3 A;  1S32 D;  3NQU B;  3REI D;  4H9R A;  3AZI D;  5B32 B;  3WKJ D;  1P3B A;  3MNN A;  5BS7 A;  3O62 A;  3AZM A;  1TZY B;  3MGP D;  3W97 C;  5AV6 A;  3MGS B;  3X1S B;  3REK D;  4Z5T C;  3AV1 B;  3VH6 A;  3VH5 W;  3WTP C;  3A6N C;  3KUY B;  3C1C D;  3AV2 C;  5BO0 A;  2HUE B;  3MGQ D;  4R8P B;  3AZG D;  5GT3 A;  5AV5 D;  3B6G C;  2Y2L A;  4QLC A;  4ZUX C;  2YFV B;  5AV8 C;  3W99 C;  3LEL A;  5B32 D;  5B2I C;  4AWL C;  3LZ0 C;  3B6F A;  3UTB C;  5B2J A;  1TZY D;  4QLC D;  4KHA A;  5AVB C;  4J8W C;  3LZ1 D;  4J8U C;  2PYO A;  4Z2M G;  5AV9 A;  3KUY D;  3A6N B;  3WTP B;  4X23 A;  4YS3 A;  5B31 D;  5GXQ C;  3AV2 B;  4R8P D;  1Q9C A;  1BH9 B;  4LD9 A;  1M1A C;  3EPJ A;  2J8P A;  3X1V D;  3B6G B;  2L5A A;  3AZF A;  5JA4 A;  3AYW C;  4ZUX B;  5FUG A;  1WWS A;  5AV8 B;  3W99 B;  4AWL B;  5B2I B;  4YM6 D;  3LZ0 B;  2FFF B;  3REJ D;  3AN2 A;  1ZLA C;  3C1B A;  2F8N H;  3UTB B;  5AVC A;  5C3I C;  3W97 D;  5DNN B;  1M18 A;  1KX3 A;  4H9P B;  3NQJ B;  2Y2H A;  3EG5 B;  2NZD A;  5AVB B;  3X1T D;  1KX4 C;  4J8W B;  1ULY A;  4Z5T D;  4H9Q B;  3AZE C;  4H9S C;  3AV2 D;  5GXQ B;  5B0Y D;  2RVQ C;  3MVD C;  3TU4 C;  5GSU A;  1M1A B;  3VH5 A;  3B6G D;  4WZS B;  3AFA C;  3WA9 A;  4ZUX D;  1P3F D;  3AYW B;  3REL D;  5CPJ A;  4JJN A;  5DNM A;  2YFW B;  3UTA A;  1ZLA B;  1T3U A;  3UTB D;  3AZJ C;  3AZH A;  5C3I B;  2ARO A;  3WAA D;  1B6W A;  5AVB D;  1HQ3 D;  4J8W D;  4J8U D;  1KX4 B;  1M19 C;  1P3K A;  3AZE B;  1U35 A;  2UWX A;  3UT9 A;  1M1A D;  3MVD B;  3TU4 B;  1P3O D;  5B24 C;  5E5A A;  5B40 D;  3AFA B;  2DF4 C;  1P3I A;  3AYW D;  4CAY A;  2CV5 A;  3REH A;  3W96 A;  5BNV A;  2NQB C;  4DQY B;  1P3G C;  5CPI A;  3B0B A;  4UUZ B;  3AZJ B;  1P34 A;  1P3M D;  4Z66 C;  5JRG D;  2ZY4 A;  2JE5 A;  3LJA B;  1M19 B;  3AZE D;  3A1I A;  5CPI D;  4H9N A;  1R4V A;  3MVD D;  2RVQ D;  3TU4 D;  2Y2G A;  1PZR A;  3AZL C;  5B24 B;  1KX5 C;  3AZN C;  2NQB B;  3WTP E;  1P3G B;  3AZJ D;  4Z66 B;  2FJ7 A;  4J8X A;  1P3P C;  4NE5 A;  1ID3 C;  2G5I C;  1S32 A;  3AZI A;  3EPK A;  3REI A;  2Y2I A;  2BYM B;  3WKJ A;  1P3B C;  5F99 C;  5BS7 C;  3AZM C;  3AZL B;  1P3L C;  2F2A C;  5AV6 C;  3MGP A;  1KX5 B;  2F8N D;  4WU9 D;  4XUJ D;  1AOI B;  1P3G D;  3REK A;  3P5J B;  1P3A C;  3IP4 C;  3C1C A;  2JSS A;  4Z66 D;  1JFI B;  3MGQ A;  4KUD C;  3KFU G;  1WWI A;  3H0R C;  3AZG A;  3V9R B;  2ZY3 A;  5AV5 A;  4DRB A;  1P3P B;  1ID3 B;  3LEL C;  5B32 A;  5B33 C;  1BH8 A;  1F66 D;  3EPH A;  4CSR A;  1P3B B;  5B2J C;  5F99 B;  5CPK C;  3AZL D;  3AZM B;  2Y2N A;  5KDM A;  3O62 B;  1P3L B;  1TZY A;  2XD5 A;  3H0M C;  5AV6 B;  3AZN D;  1EQZ C;  4J8V D;  2DQN C;  5G49 A;  5AV9 C;  3LZ1 A;  4X23 C;  3KUY A;  5BO0 B;  1P3A B;  5B31 A;  4R8P A;  4KUD B;  3KXB C;  5GT3 B;  5DNN C;  3X1V A;  1P3P D;  3MGS D;  3X1S D;  2JCH A;  2YFV A;  3LEL B;  3MGR C;  3AV1 D;  2BYK A;  5GT0 C;  5B33 B;  4YM6 A;  3REJ A;  5F99 D;  3B6F B;  3W98 C;  5B2J B;  2ZY5 A;  5CPK B;  1P3L D;  1M18 C;  1KX3 C;  3W97 A;  2ZM5 A;  1EQZ B;  2PYO B;  3X1T A;  5AV9 B;  3R45 A;  4Z5T A;  4X23 B;  1P3A D;  4Z2M H;  2Y2P A;  3AV2 A;  4KUD D;  1B67 A;  5B0Y A;  3KXB B;  3B6G A;  4WV4 B;  4ZUX A;  5FUG B;  1P3F A;  3MGR B;  5CPJ C;  3A6N D;  3WTP D;  3REL A;  2W8S A;  5CP6 C;  5GT0 B;  5B33 D;  3AN2 B;  3C1B B;  1H3O A;  5B1M C;  5CPK D;  3W98 B;  3UTB A;  2ARO C;  1M18 B;  3X1U C;  1KX3 B;  4H9P A;  1EQZ D;  3WAA A;  5AVB A;  1HQ3 A;  4J8W A;  5AV8 D;  3W99 D;  4J8U A;  5B2I D;  3LZ0 D;  2VQR A;  3UT9 C;  3B0D C;  3KXB D;  1M1A A;  5DNN D;  1Z2C B;  1P3O A;  5E5A C;  1P3I C;  5B40 A;  3LJA C;  3REH C;  3AYW A;  3MGR D;  3W96 C;  4XZQ C;  5CPJ B;  5DNM B;  5GT0 D;  2YFW A;  5GXQ D;  5CP6 B;  5B32 G;  2Y2K A;  3W98 D;  5B1M B;  4EO5 C;  1BFM A;  1P3M A;  2ARO B;  5B0Z C;  3X1U B;  5JRG A;  2HIO C;  5B1L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...