1P3BC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bC00
4YM6C 3B6GA 2AROB 3V9RA 1F66D 5B31B 3MNNA 1HQ3B 5GSUA 3C1BC 1M18B 3AZNB 4WU8A 1P3MC 1P3PA 1P3AC 2PYOD 1ZLAD 5F99D 1JFIB 4AWLB 1P3BD 5FUGA 3AZFA 3VH6T 4J8XA 5B33B 3MGRD 3A6NC 5JRGB 3AN2C 4H9SC 2FJ7B 4EO5B 1ZLAB 5AV9C 3KUYD 3MGSA 5AV6C 5DNMA 3KWQB 3REID 3AZIB 2CV5A 1KX3B 4R8PC 1P3BB 3W96B 1TZYA 5GXQC 1KX5A 2HIOB 3LZ1D 3KXBA 3W97B 3AZLC 4WNNB 3AZJA 5G49B 5B2ID 3WKJD 2NZDC 3LELB 1BH9A 3VH5A 5AV8A 3B6FD 1EQZB 5DNNA 1U35A 5CP6C 5GT0B 3X1VA 4XZQA 3LJAA 5AY8B 1P3FD 1P3GD 3WA9A 4G91C 5BS7A 1P3LC 4NE6A 3W98C 4XUJA 3REHD 1M1AB 1P3KA 4J8UA 4WU9D 5AVBB 1H3OB 5BT1C 5GT3C 3X1SA 3LZ0D 1S32B 5CPKB 3R45B 1ID3B 3REKA 3O62A 2JSSA 3X1UD 3MGQB 1P3FB 4LD9C 3REHB 3MVDB 1KX4C 4Z66C 4KGCC 3WAAB 3W99A 3REJB 5B1LB 4UUZB 3AYWA 3TU4D 4YM6B 2AROA 5B31A 1HQ3A 1BH8B 1M18A 5AV5B 3C1BB 3AZNA 2F8NK 1P3OA 1P3MB 1P3AB 3MGSD 1JFIA 5DNMD 4WZSB 1BFMA 1P34C 3TU4B 1F66A 5B33A 3KXBD 5B0ZC 3AFAD 3RELC 3AZJD 5B40C 5JRGA 2FJ7A 3AZMD 1ZLAA 3C1CB 5AV9B 4J8VC 3KWQA 5DNND 5AV6B 1KX3A 3B0CT 3W96A 4XZQD 3LJAD 1P3BA 1AOIC 2HIOA 4X23D 1TAFB 2NQBB 4WNNA 3AZLB 5G49A 3AFAB 1P3KD 4KUDD 1F1EA 3AZGC 3AZED 2NZDB 3LELA 1EQZA 4H9RB 4ZUXD 5GT0A 5CPJC 3REKD 5AY8A 5AVCC 3O62D 4G92C 4G91B 1P3LB 3AV1C 4NFTA 3NQJB 5B2JC 5F99C 5AVBA 1H3OA 3WKJA 3W99D 4NE5A 3X1TC 1S32A 5GT3B 5CPKA 3R45A 4NE3A 3UTAD 3UTBC 4ZUXB 3AYWD 2AROD 1P3FA 1P3GA 1HQ3D 3AZND 4LD9B 3REHA 3MVDA 1KX4B 2IO5C 4Z66B 3VH5T 5E5AC 3REIC 3WAAA 4KGCB 5B1LA 3AV2D 4UUZA 4DRBA 1M19C 5B32D 4J8WC 3UTAB 4WV4B 3VH5W 4JJND 1BH8A 3X1UA 5B33D 5AV5A 3C1BA 2BYMB 1P3MA 5JRGD 2FJ7D 4Z5TC 4Z2MH 3AZID 3AV2B 3KWQD 1KX3D 5B32B 3W96D 5CPIB 3TU4A 4QLCC 1P34B 2HIOD 4WU9C 4JJNB 1P3ID 3W97D 5B0ZB 3RELB 4ZBJC 5B40B 3B0DC 4H9SA 3LELD 3C1CA 5AV9A 1EQZD 4J8VB 3B6GC 5GT0D 3MNNC 5GSUC 5BO0B 5AY8D 1N1JB 4WU8C 1TAFA 4Z2MG 1P3IB 1P3PC 3AZLA 1M1AD 2NQBA 3AFAA 5AVBD 4CSRB 3AZGB 3AZMA 1S32D 4YS3C 3AZFC 4H9RA 5CPKD 4J8XC 1ID3D 5CPJB 5AVCB 3WTPC 1Q9CA 3MGQD 1P3LA 4X23A 3AZHC 3MVDD 5B2JB 4KUDA 5B24C 5B1MC 3MGSC 3WAAD 3AZEA 2CV5C 5BNVB 5GT3A 3REJD 5B1LD 1TZYC 4ZUXA 1KX5C 3UT9B 3KXBC 4YM6D 5AV5D 4HGAC 4M6BA 3C1BD 3MGPB 5KDMA 1KX4A 3AZKC 2IO5B 5AV8C 1P3MD 1P3AD 4KGCA 1U35C 1HTAA 3X1VC 2L5AA 1M19B 3UTAA 5B0YB 3WA9C 5BS7C 4J8WB 2F8NG 4XUJC 4J8UC 3A6ND 3X1SC 5C3IC 3AN2D 2RVQC 2YFVB 3C1CD 5AV9D 3AV2A 5AV6D 5B32A 4E45A 4H9NB 3VH6A 4R8PD 5CPIA 5GXQD 1P34A 5BNXB 4QLCB 4JJNA 2NQBD 3AZLD 3RELA 3A6NB 5B40A 4ZBJB 2NZDD 3B0DB 3AN2B 1R4VA 4J8VA 3AZIA 5B31C 3MNNB 1M18C 5GSUB 3AZNC 4R8PB 1N1JA 5GXQB 1P3LD 1P3IA 3W98D 1WWSA 3W97A 1P3OC 1P3PB 4CSRA 1A7WA 5BT1D 5GT3D 4YS3B 3AZFB 1B6WA 2BYKB 1KU5A 3WTPE 1F66C 5CP6B 5AVCA 3WTPB 3AZHB 4LD9D 1M1AA 3W98B 4EO5C 1KX4D 2PYOC 5B2JA 4Z66D 1ZLAC 5B24B 5B1MB 4KGCD 5BNVA 1P3BC 3UT9A 1ID3A 3MGRC 3MGQA 3MGPA 3KSYA 3AZKB 3KUYC 1U35B 3X1VB 3REJA 1M19A 5B0YA 4J8WA 3LZ1C 2LY8A 5CPID 4XUJB 4YM6A 1P34D 5B2IC 5B0ZD 5AVBC 3WKJC 3RELD 1S32C 5B40D 4E44A 5C3IB 3X1SB 2HUEC 3B6FC 5B31G 1P3AA 2YFVA 4J8VD 1P3FC 1P3GC 4H9NA 5BNXA 3REHC 3MVDC 3A6NA 3LZ0C 3AZGD 3AN2A 5CHLB 5AV6A 3X1UC 5AV5C 5CPJD 4R8PA 5AVCD 1AOIB 5GXQA 3AV1D 1P3OB 5B2JD 2NZDA 3X1TD 4YS3A 2BYKA 3TU4C 3UTBD 3UT9D 4KHAB 5CP6A 1F66B 2YFWB 4G92B 4H9PB 3WTPA 3AZHA 3W98A 3MGPD 3VH6W 3AV1B 2F8NH 2PYOB 3NQJA 3C1CC 3NQUB 5F99B 5E5AD 5B1MA 5B24A 5DNMC 2CWEA 3X1TB 1ULYA 1M19D 5B0YD 4J8WD 3UTBB 3MGRB 2NQBC 3AFAC 3AZJC 4LD9A 3AZMC 3AZKA 4Z66A 3KUYB 4Z5TD 5E5AB 5DNNC 3REIB 4XZQC 3LJAC 5JA4B 4X23C 3LZ1B 4QLCD 1P3KC 5B2IB 2BYMA 2F8ND 4KUDC 3WKJB 3AZEC 3B6FB 2HUEB 1WWIA 4ZUXC 4DRAA 4Z5TB 3REKC 3O62C 4CAYB 3B6GD 1P3GB 3MNND 5GSUD 4H9QB 4H9OB 4WU8D 4WU9B 5B0ZA 1P3PD 2F8NB 3W99C 3LZ0B 3UTAC 3AYWC 4YS3D 3AZFD 2AROC 4J8XD 3B6GB 3V9RB 1HQ3C 5CP6D 3X1UB 5BO0A 1AOIA 3WTPD 3AZHD 4WU8B 3AV2C 5B24D 5B1MD 3AZGA 2CV5D 5B32C 4AWLC 5CPIC 5FUGB 1TZYD 4KHAA 1KX5D 4JJNC 4J8XB 5B33C 5CPJA 2YFWA 4H9PA 5JRGC 3AV1A 2FJ7C 2PYOA 3NQUA 5F99A 5AV8D 3AZKD 3AZIC 3KWQC 3MGSB 1U35D 5DNMB 3X1VD 2CV5B 3X1TA 1KX3C 3W96C 3WA9D 1TZYB 3UTBA 1KX5B 2HIOC 1P3IC 4XUJD 3KXBB 3MGRA 3W97C 4J8UD 3AZJB 3B0CW 4HGAB 3AZMB 3LELC 3X1SD 1BH9B 3KUYA 5AV8B 5E5AA 1EQZC 3REIA 2RVQD 5GT0C 5DNNB 4XZQB 3LJAB 5AY8C 5JA4A 3WA9B 4X23B 3LZ1A 1M1AC 5B2IA 4J8UB 1P3KB 4KUDB 3AZEB 3B6FA 5CPKC 3UT9C 4Z5TA 1ID3C 4CAYA 3REKB 3O62B 5B31D 3MGQC 4H9QA 1M18D 3MGPC 1AOID 3B0BA 4H9OA 4QLCA 5KDMB 4WU9A 1B67A 2F8NA 1P3OD 5B32G 3WAAC 3W99B 3REJC 3LZ0A 5B1LC 5B0YC 3AYWB
chains in the Genus database with same CATH superfamily
4YM6C 3B6GA 2AROB 3V9RA 1F66D 5B31B 3MNNA 1HQ3B 5GSUA 3C1BC 1M18B 3AZNB 3EG5B 4WU8A 1P3MC 1P3PA 1P3AC 2PYOD 1ZLAD 5F99D 1JFIB 4AWLB 1P3BD 5FUGA 3AZFA 3VH6T 3IP4C 4J8XA 2W8SA 5B33B 3MGRD 3A6NC 5JRGB 3AN2C 4H9SC 2FJ7B 4EO5B 1ZLAB 5AV9C 3KUYD 3MGSA 5AV6C 5DNMA 3KWQB 3REID 3AZIB 2CV5A 1KX3B 4R8PC 1P3BB 3W96B 1TZYA 5GXQC 1KX5A 2HIOB 3LZ1D 3KXBA 3W97B 2Y2JA 3AZLC 4WNNB 3AZJA 5G49B 5B2ID 3WKJD 2NZDC 3LELB 1BH9A 2Y2GA 3VH5A 5AV8A 3B6FD 1EQZB 5DNNA 1U35A 5CP6C 5GT0B 3X1VA 4XZQA 2FFFB 3LJAA 5AY8B 1P3FD 1P3GD 3WA9A 4G91C 5BS7A 1P3LC 4NE6A 3W98C 4XUJA 3REHD 1M1AB 1P3KA 4J8UA 4WU9D 5AVBB 1H3OB 5BT1C 5GT3C 3FDDA 3X1SA 3LZ0D 2Y2IA 5CPKB 3R45B 1S32B 1ID3B 3REKA 3O62A 2JSSA 3X1UD 3MGQB 1P3FB 4LD9C 3REHB 3MVDB 1KX4C 4Z66C 4KGCC 3WAAB 3W99A 3REJB 5B1LB 4UUZB 3AYWA 3TU4D 4YM6B 2AROA 3H0MC 5B31A 1HQ3A 1BH8B 1M18A 5AV5B 3C1BB 3AZNA 2F8NK 1P3OA 1P3MB 1P3AB 2BG1A 3MGSD 1JFIA 5DNMD 4WZSB 1BFMA 1P34C 3TU4B 1F66A 5B33A 3EPHA 3KXBD 5B0ZC 3AFAD 3RELC 3AZJD 5B40C 5JRGA 2FJ7A 3AZMD 1ZLAA 3C1CB 5AV9B 4J8VC 3KWQA 5DNND 5AV6B 1KX3A 3B0CT 3W96A 4XZQD 3LJAD 1P3BA 1AOIC 2HIOA 4X23D 2UWXA 1TAFB 3KFUG 2NQBB 4WNNA 3AZLB 5G49A 3AFAB 1P3KD 4KUDD 1F1EA 3AZGC 3AZED 2NZDB 3LELA 1EQZA 3EPLA 4H9RB 4ZUXD 5GT0A 5CPJC 3REKD 5AY8A 5AVCC 3O62D 4G92C 4G91B 1P3LB 3AV1C 4NFTA 3NQJB 5B2JC 5F99C 5AVBA 1H3OA 3WKJA 3W99D 4NE5A 3X1TC 1S32A 5GT3B 5CPKA 3R45A 4NE3A 3UTAD 3UTBC 3AL0C 4ZUXB 3AYWD 2AROD 1P3FA 1P3GA 1HQ3D 3AZND 4LD9B 3REHA 3MVDA 1KX4B 2IO5C 4Z66B 3VH5T 5E5AC 3REIC 3WAAA 4KGCB 5B1LA 3AV2D 4UUZA 4DRBA 1M19C 5B32D 4J8WC 3UTAB 4WV4B 3VH5W 4JJND 1BH8A 3X1UA 5B33D 5AV5A 3C1BA 2BYMB 1P3MA 5JRGD 2FJ7D 4Z5TC 4Z2MH 2Y2PA 3AZID 3AV2B 3KWQD 1KX3D 5B32B 3W96D 5CPIB 3TU4A 4QLCC 1P34B 2HIOD 4WU9C 4JJNB 1P3ID 3W97D 5B0ZB 2Y2HA 2XD5A 4DQYB 3RELB 2DQNC 4ZBJC 5B40B 3B0DC 4H9SA 3LELD 3C1CA 5AV9A 1EQZD 2Y2LA 4J8VB 3B6GC 5GT0D 3MNNC 5GSUC 2Y2MA 5BO0B 5AY8D 1N1JB 4WU8C 1TAFA 4Z2MG 1P3IB 1P3PC 3AZLA 1M1AD 2NQBA 3AFAA 4UPKA 5AVBD 4CSRB 3AZGB 3AZMA 1S32D 4YS3C 3AZFC 4H9RA 5CPKD 4J8XC 1ID3D 2Y2KA 5CPJB 5AVCB 3WTPC 1Q9CA 3MGQD 1P3LA 4X23A 3AZHC 3MVDD 2Y2NA 5B2JB 4KUDA 5B24C 5B1MC 3MGSC 3WAAD 3AZEA 2CV5C 5BNVB 5GT3A 3REJD 5B1LD 3EPKA 1TZYC 4ZUXA 1KX5C 3UT9B 3KXBC 2Y2OA 4YM6D 5AV5D 4HGAC 4M6BA 3C1BD 3MGPB 5KDMA 1KX4A 3AZKC 2IO5B 5AV8C 1P3MD 1P3AD 4KGCA 1U35C 1HTAA 3X1VC 2L5AA 1M19B 3UTAA 5B0YB 3WA9C 5BS7C 4J8WB 2F8NG 4XUJC 4J8UC 3H0LC 3A6ND 3X1SC 5C3IC 3AN2D 2RVQC 2YFVB 3C1CD 5AV9D 3AV2A 5AV6D 5B32A 4E45A 4H9NB 3VH6A 4R8PD 5CPIA 5GXQD 1P34A 2XD1A 5BNXB 4QLCB 4JJNA 2NQBD 3AZLD 3RELA 3A6NB 2JCHA 5B40A 4ZBJB 2DF4C 2JE5A 2NZDD 3B0DB 3AN2B 1R4VA 4J8VA 3AZIA 1Z2CB 2G5HC 5B31C 3MNNB 1M18C 5GSUB 3AZNC 4R8PB 1N1JA 2ZY4A 5GXQB 1P3LD 1P3IA 3W98D 1WWSA 3W97A 1P3OC 1P3PB 4CSRA 1A7WA 5BT1D 5GT3D 2VQRA 3A1IA 4YS3B 3AZFB 2ZM5A 1B6WA 2BYKB 1KU5A 3WTPE 3A1KA 1F66C 5CP6B 5AVCA 3WTPB 3AZHB 4LD9D 1M1AA 3W98B 4EO5C 1KX4D 2PYOC 1W2EA 5B2JA 4Z66D 1ZLAC 5B24B 5B1MB 4KGCD 5BNVA 1P3BC 2RIQA 3UT9A 1ID3A 3MGRC 3MGQA 3MGPA 3KSYA 3AZKB 3KUYC 1U35B 3X1VB 3REJA 1M19A 5B0YA 4J8WA 3LZ1C 2LY8A 5CPID 4XUJB 4YM6A 1P34D 5B2IC 5B0ZD 5AVBC 3WKJC 3RELD 1S32C 5B40D 4E44A 5C3IB 3X1SB 2HUEC 3B6FC 5B31G 1P3AA 2YFVA 4J8VD 1P3FC 1P3GC 4H9NA 5BNXA 3REHC 3MVDC 3P5JB 3A6NA 3LZ0C 3AZGD 3AN2A 5CHLB 5AV6A 3X1UC 5AV5C 5CPJD 4R8PA 5AVCD 1AOIB 5GXQA 3AV1D 1P3OB 5B2JD 2NZDA 3X1TD 4YS3A 2BYKA 3TU4C 3UTBD 3UT9D 4KHAB 5CP6A 1F66B 2YFWB 4G92B 4H9PB 3WTPA 3AZHA 3W98A 3F6TA 3MGPD 3VH6W 3AV1B 2F8NH 2PYOB 3NQJA 3C1CC 3NQUB 5F99B 5E5AD 5B1MA 5B24A 5DNMC 2CWEA 3X1TB 1ULYA 1M19D 5B0YD 4J8WD 3UTBB 3MGRB 2NQBC 3AFAC 3AZJC 2G5IC 4LD9A 3AZMC 4WJ3C 3AZKA 4Z66A 3KUYB 4Z5TD 5E5AB 5DNNC 3REIB 4XZQC 3LJAC 5JA4B 4X23C 3LZ1B 4QLCD 1P3KC 5B2IB 2BYMA 2F8ND 4KUDC 2ZY3A 3WKJB 3AZEC 3B6FB 2HUEB 1WWIA 4ZUXC 4DRAA 4Z5TB 1T3UA 3REKC 3O62C 4CAYB 3B6GD 1P3GB 3MNND 5GSUD 4H9QB 4H9OB 4WU8D 4WU9B 5B0ZA 1P3PD 2F8NB 3W99C 3LZ0B 3UTAC 3AYWC 4YS3D 3AZFD 2AROC 4J8XD 2Y2QA 3B6GB 3V9RB 1HQ3C 5CP6D 3X1UB 5BO0A 1AOIA 3WTPD 3EPJA 3AZHD 4WU8B 3AV2C 5B24D 5B1MD 3AZGA 2CV5D 5B32C 4AWLC 5CPIC 5FUGB 1TZYD 4KHAA 1KX5D 4JJNC 4J8XB 5B33C 2ZY2A 5CPJA 2YFWA 4H9PA 5JRGC 3AV1A 2FJ7C 2PYOA 3NQUA 5F99A 5AV8D 3AZKD 2J8PA 3H0RC 3AZIC 3KWQC 3MGSB 1U35D 5DNMB 3X1VD 2CV5B 3X1TA 1KX3C 3W96C 3WA9D 1TZYB 3UTBA 1KX5B 2HIOC 1P3IC 4XUJD 3KXBB 3MGRA 3W97C 4J8UD 2F2AC 3AZJB 3B0CW 4HGAB 3AZMB 3LELC 3X1SD 1BH9B 3KUYA 5AV8B 5E5AA 1EQZC 3REIA 2RVQD 5GT0C 5DNNB 4XZQB 3LJAB 5AY8C 5JA4A 3WA9B 4X23B 3LZ1A 1M1AC 5B2IA 4J8UB 1P3KB 4KUDB 1PZRA 2ZY5A 3AZEB 3B6FA 5CPKC 3UT9C 4Z5TA 1ID3C 4CAYA 3REKB 3O62B 5B31D 3MGQC 4H9QA 1M18D 3MGPC 1AOID 3B0BA 4H9OA 4QLCA 5KDMB 4WU9A 1B67A 2F8NA 1P3OD 5B32G 3WAAC 3W99B 3REJC 3LZ0A 5B1LC 5B0YC 3AYWB
chains in the Genus database with same CATH topology
4YM6C 3B6GA 2AROB 3V9RA 1F66D 5B31B 3MNNA 1HQ3B 5GSUA 3C1BC 1M18B 3AZNB 3EG5B 4WU8A 1P3MC 1P3PA 1P3AC 2PYOD 1ZLAD 5F99D 1JFIB 4AWLB 1P3BD 5FUGA 3AZFA 3VH6T 3IP4C 4J8XA 2W8SA 5B33B 3MGRD 3A6NC 5JRGB 3AN2C 4H9SC 2FJ7B 4EO5B 1ZLAB 5AV9C 3KUYD 3MGSA 5AV6C 5DNMA 3KWQB 3REID 3AZIB 2CV5A 1KX3B 4R8PC 1P3BB 3W96B 1TZYA 5GXQC 1KX5A 2HIOB 3LZ1D 3KXBA 3W97B 2Y2JA 3AZLC 4WNNB 3AZJA 5G49B 5B2ID 3WKJD 2NZDC 3LELB 1BH9A 2Y2GA 3VH5A 5AV8A 3B6FD 1EQZB 5DNNA 1U35A 5CP6C 5GT0B 3X1VA 4XZQA 2FFFB 3LJAA 5AY8B 1P3FD 1P3GD 3WA9A 4G91C 5BS7A 1P3LC 4NE6A 3W98C 4XUJA 3REHD 1M1AB 1P3KA 4J8UA 4WU9D 5AVBB 1H3OB 5BT1C 5GT3C 3FDDA 3X1SA 3LZ0D 2Y2IA 5CPKB 3R45B 1S32B 1ID3B 3REKA 3O62A 2JSSA 3X1UD 3MGQB 1P3FB 4LD9C 3REHB 3MVDB 1KX4C 4Z66C 4KGCC 3WAAB 3W99A 3REJB 5B1LB 4UUZB 3AYWA 3TU4D 4YM6B 2AROA 3H0MC 5B31A 1HQ3A 1BH8B 1M18A 5AV5B 3C1BB 3AZNA 2F8NK 1P3OA 1P3MB 1P3AB 2BG1A 3MGSD 1JFIA 5DNMD 4WZSB 1BFMA 1P34C 3TU4B 1F66A 5B33A 3EPHA 3KXBD 5B0ZC 3AFAD 3RELC 3AZJD 5B40C 5JRGA 2FJ7A 3AZMD 1ZLAA 3C1CB 5AV9B 4J8VC 3KWQA 5DNND 5AV6B 1KX3A 3B0CT 3W96A 4XZQD 3LJAD 1P3BA 1AOIC 2HIOA 4X23D 2UWXA 1TAFB 3KFUG 2NQBB 4WNNA 3AZLB 5G49A 3AFAB 1P3KD 4KUDD 1F1EA 3AZGC 3AZED 2NZDB 3LELA 1EQZA 3EPLA 4H9RB 4ZUXD 5GT0A 5CPJC 3REKD 5AY8A 5AVCC 3O62D 4G92C 4G91B 1P3LB 3AV1C 4NFTA 3NQJB 5B2JC 5F99C 5AVBA 1H3OA 3WKJA 3W99D 4NE5A 3X1TC 1S32A 5GT3B 5CPKA 3R45A 4NE3A 3UTAD 3UTBC 3AL0C 4ZUXB 3AYWD 2AROD 1P3FA 1P3GA 1HQ3D 3AZND 4LD9B 3REHA 3MVDA 1KX4B 2IO5C 4Z66B 3VH5T 5E5AC 3REIC 3WAAA 4KGCB 5B1LA 3AV2D 4UUZA 4DRBA 1M19C 5B32D 4J8WC 3UTAB 4WV4B 3VH5W 4JJND 1BH8A 3X1UA 5B33D 5AV5A 3C1BA 2BYMB 1P3MA 5JRGD 2FJ7D 4Z5TC 4Z2MH 2Y2PA 3AZID 3AV2B 3KWQD 1KX3D 5B32B 3W96D 5CPIB 3TU4A 4QLCC 1P34B 2HIOD 4WU9C 4JJNB 1P3ID 3W97D 5B0ZB 2Y2HA 2XD5A 4DQYB 3RELB 2DQNC 4ZBJC 5B40B 3B0DC 4H9SA 3LELD 3C1CA 5AV9A 1EQZD 2Y2LA 4J8VB 3B6GC 5GT0D 3MNNC 5GSUC 2Y2MA 5BO0B 5AY8D 1N1JB 4WU8C 1TAFA 4Z2MG 1P3IB 1P3PC 3AZLA 1M1AD 2NQBA 3AFAA 4UPKA 5AVBD 4CSRB 3AZGB 3AZMA 1S32D 4YS3C 3AZFC 4H9RA 5CPKD 4J8XC 1ID3D 2Y2KA 5CPJB 5AVCB 3WTPC 1Q9CA 3MGQD 1P3LA 4X23A 3AZHC 3MVDD 2Y2NA 5B2JB 4KUDA 5B24C 5B1MC 3MGSC 3WAAD 3AZEA 2CV5C 5BNVB 5GT3A 3REJD 5B1LD 3EPKA 1TZYC 4ZUXA 1KX5C 3UT9B 3KXBC 2Y2OA 4YM6D 5AV5D 4HGAC 4M6BA 3C1BD 3MGPB 5KDMA 1KX4A 3AZKC 2IO5B 5AV8C 1P3MD 1P3AD 4KGCA 1U35C 1HTAA 3X1VC 2L5AA 1M19B 3UTAA 5B0YB 3WA9C 5BS7C 4J8WB 2F8NG 4XUJC 4J8UC 3H0LC 3A6ND 3X1SC 5C3IC 3AN2D 2RVQC 2YFVB 3C1CD 5AV9D 3AV2A 5AV6D 5B32A 4E45A 4H9NB 3VH6A 4R8PD 5CPIA 5GXQD 1P34A 2XD1A 5BNXB 4QLCB 4JJNA 2NQBD 3AZLD 3RELA 3A6NB 2JCHA 5B40A 4ZBJB 2DF4C 2JE5A 2NZDD 3B0DB 3AN2B 1R4VA 4J8VA 3AZIA 1Z2CB 2G5HC 5B31C 3MNNB 1M18C 5GSUB 3AZNC 4R8PB 1N1JA 2ZY4A 5GXQB 1P3LD 1P3IA 3W98D 1WWSA 3W97A 1P3OC 1P3PB 4CSRA 1A7WA 5BT1D 5GT3D 2VQRA 3A1IA 4YS3B 3AZFB 2ZM5A 1B6WA 2BYKB 1KU5A 3WTPE 3A1KA 1F66C 5CP6B 5AVCA 3WTPB 3AZHB 4LD9D 1M1AA 3W98B 4EO5C 1KX4D 2PYOC 1W2EA 5B2JA 4Z66D 1ZLAC 5B24B 5B1MB 4KGCD 5BNVA 1P3BC 2RIQA 3UT9A 1ID3A 3MGRC 3MGQA 3MGPA 3KSYA 3AZKB 3KUYC 1U35B 3X1VB 3REJA 1M19A 5B0YA 4J8WA 3LZ1C 2LY8A 5CPID 4XUJB 4YM6A 1P34D 5B2IC 5B0ZD 5AVBC 3WKJC 3RELD 1S32C 5B40D 4E44A 5C3IB 3X1SB 2HUEC 3B6FC 5B31G 1P3AA 2YFVA 4J8VD 1P3FC 1P3GC 4H9NA 5BNXA 3REHC 3MVDC 3P5JB 3A6NA 3LZ0C 3AZGD 3AN2A 5CHLB 5AV6A 3X1UC 5AV5C 5CPJD 4R8PA 5AVCD 1AOIB 5GXQA 3AV1D 1P3OB 5B2JD 2NZDA 3X1TD 4YS3A 2BYKA 3TU4C 3UTBD 3UT9D 4KHAB 5CP6A 1F66B 2YFWB 4G92B 4H9PB 3WTPA 3AZHA 3W98A 3F6TA 3MGPD 3VH6W 3AV1B 2F8NH 2PYOB 3NQJA 3C1CC 3NQUB 5F99B 5E5AD 5B1MA 5B24A 5DNMC 2CWEA 3X1TB 1ULYA 1M19D 5B0YD 4J8WD 3UTBB 3MGRB 2NQBC 3AFAC 3AZJC 2G5IC 4LD9A 3AZMC 4WJ3C 3AZKA 4Z66A 3KUYB 4Z5TD 5E5AB 5DNNC 3REIB 4XZQC 3LJAC 5JA4B 4X23C 3LZ1B 4QLCD 1P3KC 5B2IB 2BYMA 2F8ND 4KUDC 2ZY3A 3WKJB 3AZEC 3B6FB 2HUEB 1WWIA 4ZUXC 4DRAA 4Z5TB 1T3UA 3REKC 3O62C 4CAYB 3B6GD 1P3GB 3MNND 5GSUD 4H9QB 4H9OB 4WU8D 4WU9B 5B0ZA 1P3PD 2F8NB 3W99C 3LZ0B 3UTAC 3AYWC 4YS3D 3AZFD 2AROC 4J8XD 2Y2QA 3B6GB 3V9RB 1HQ3C 5CP6D 3X1UB 5BO0A 1AOIA 3WTPD 3EPJA 3AZHD 4WU8B 3AV2C 5B24D 5B1MD 3AZGA 2CV5D 5B32C 4AWLC 5CPIC 5FUGB 1TZYD 4KHAA 1KX5D 4JJNC 4J8XB 5B33C 2ZY2A 5CPJA 2YFWA 4H9PA 5JRGC 3AV1A 2FJ7C 2PYOA 3NQUA 5F99A 5AV8D 3AZKD 2J8PA 3H0RC 3AZIC 3KWQC 3MGSB 1U35D 5DNMB 3X1VD 2CV5B 3X1TA 1KX3C 3W96C 3WA9D 1TZYB 3UTBA 1KX5B 2HIOC 1P3IC 4XUJD 3KXBB 3MGRA 3W97C 4J8UD 2F2AC 3AZJB 3B0CW 4HGAB 3AZMB 3LELC 3X1SD 1BH9B 3KUYA 5AV8B 5E5AA 1EQZC 3REIA 2RVQD 5GT0C 5DNNB 4XZQB 3LJAB 5AY8C 5JA4A 3WA9B 4X23B 3LZ1A 1M1AC 5B2IA 4J8UB 1P3KB 4KUDB 1PZRA 2ZY5A 3AZEB 3B6FA 5CPKC 3UT9C 4Z5TA 1ID3C 4CAYA 3REKB 3O62B 5B31D 3MGQC 4H9QA 1M18D 3MGPC 1AOID 3B0BA 4H9OA 4QLCA 5KDMB 4WU9A 1B67A 2F8NA 1P3OD 5B32G 3WAAC 3W99B 3REJC 3LZ0A 5B1LC 5B0YC 3AYWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 C;  3B6G A;  2ARO B;  3V9R A;  1F66 D;  5B31 B;  3MNN A;  1HQ3 B;  5GSU A;  3C1B C;  1M18 B;  3AZN B;  4WU8 A;  1P3M C;  1P3P A;  1P3A C;  2PYO D;  1ZLA D;  5F99 D;  1JFI B;  4AWL B;  1P3B D;  5FUG A;  3AZF A;  3VH6 T;  4J8X A;  5B33 B;  3MGR D;  3A6N C;  5JRG B;  3AN2 C;  4H9S C;  2FJ7 B;  4EO5 B;  1ZLA B;  5AV9 C;  3KUY D;  3MGS A;  5AV6 C;  5DNM A;  3KWQ B;  3REI D;  3AZI B;  2CV5 A;  1KX3 B;  4R8P C;  1P3B B;  3W96 B;  1TZY A;  5GXQ C;  1KX5 A;  2HIO B;  3LZ1 D;  3KXB A;  3W97 B;  3AZL C;  4WNN B;  3AZJ A;  5G49 B;  5B2I D;  3WKJ D;  2NZD C;  3LEL B;  1BH9 A;  3VH5 A;  5AV8 A;  3B6F D;  1EQZ B;  5DNN A;  1U35 A;  5CP6 C;  5GT0 B;  3X1V A;  4XZQ A;  3LJA A;  5AY8 B;  1P3F D;  1P3G D;  3WA9 A;  4G91 C;  5BS7 A;  1P3L C;  4NE6 A;  3W98 C;  4XUJ A;  3REH D;  1M1A B;  1P3K A;  4J8U A;  4WU9 D;  5AVB B;  1H3O B;  5BT1 C;  5GT3 C;  3X1S A;  3LZ0 D;  1S32 B;  5CPK B;  3R45 B;  1ID3 B;  3REK A;  3O62 A;  2JSS A;  3X1U D;  3MGQ B;  1P3F B;  4LD9 C;  3REH B;  3MVD B;  1KX4 C;  4Z66 C;  4KGC C;  3WAA B;  3W99 A;  3REJ B;  5B1L B;  4UUZ B;  3AYW A;  3TU4 D;  4YM6 B;  2ARO A;  5B31 A;  1HQ3 A;  1BH8 B;  1M18 A;  5AV5 B;  3C1B B;  3AZN A;  2F8N K;  1P3O A;  1P3M B;  1P3A B;  3MGS D;  1JFI A;  5DNM D;  4WZS B;  1BFM A;  1P34 C;  3TU4 B;  1F66 A;  5B33 A;  3KXB D;  5B0Z C;  3AFA D;  3REL C;  3AZJ D;  5B40 C;  5JRG A;  2FJ7 A;  3AZM D;  1ZLA A;  3C1C B;  5AV9 B;  4J8V C;  3KWQ A;  5DNN D;  5AV6 B;  1KX3 A;  3B0C T;  3W96 A;  4XZQ D;  3LJA D;  1P3B A;  1AOI C;  2HIO A;  4X23 D;  1TAF B;  2NQB B;  4WNN A;  3AZL B;  5G49 A;  3AFA B;  1P3K D;  4KUD D;  1F1E A;  3AZG C;  3AZE D;  2NZD B;  3LEL A;  1EQZ A;  4H9R B;  4ZUX D;  5GT0 A;  5CPJ C;  3REK D;  5AY8 A;  5AVC C;  3O62 D;  4G92 C;  4G91 B;  1P3L B;  3AV1 C;  4NFT A;  3NQJ B;  5B2J C;  5F99 C;  5AVB A;  1H3O A;  3WKJ A;  3W99 D;  4NE5 A;  3X1T C;  1S32 A;  5GT3 B;  5CPK A;  3R45 A;  4NE3 A;  3UTA D;  3UTB C;  4ZUX B;  3AYW D;  2ARO D;  1P3F A;  1P3G A;  1HQ3 D;  3AZN D;  4LD9 B;  3REH A;  3MVD A;  1KX4 B;  2IO5 C;  4Z66 B;  3VH5 T;  5E5A C;  3REI C;  3WAA A;  4KGC B;  5B1L A;  3AV2 D;  4UUZ A;  4DRB A;  1M19 C;  5B32 D;  4J8W C;  3UTA B;  4WV4 B;  3VH5 W;  4JJN D;  1BH8 A;  3X1U A;  5B33 D;  5AV5 A;  3C1B A;  2BYM B;  1P3M A;  5JRG D;  2FJ7 D;  4Z5T C;  4Z2M H;  3AZI D;  3AV2 B;  3KWQ D;  1KX3 D;  5B32 B;  3W96 D;  5CPI B;  3TU4 A;  4QLC C;  1P34 B;  2HIO D;  4WU9 C;  4JJN B;  1P3I D;  3W97 D;  5B0Z B;  3REL B;  4ZBJ C;  5B40 B;  3B0D C;  4H9S A;  3LEL D;  3C1C A;  5AV9 A;  1EQZ D;  4J8V B;  3B6G C;  5GT0 D;  3MNN C;  5GSU C;  5BO0 B;  5AY8 D;  1N1J B;  4WU8 C;  1TAF A;  4Z2M G;  1P3I B;  1P3P C;  3AZL A;  1M1A D;  2NQB A;  3AFA A;  5AVB D;  4CSR B;  3AZG B;  3AZM A;  1S32 D;  4YS3 C;  3AZF C;  4H9R A;  5CPK D;  4J8X C;  1ID3 D;  5CPJ B;  5AVC B;  3WTP C;  1Q9C A;  3MGQ D;  1P3L A;  4X23 A;  3AZH C;  3MVD D;  5B2J B;  4KUD A;  5B24 C;  5B1M C;  3MGS C;  3WAA D;  3AZE A;  2CV5 C;  5BNV B;  5GT3 A;  3REJ D;  5B1L D;  1TZY C;  4ZUX A;  1KX5 C;  3UT9 B;  3KXB C;  4YM6 D;  5AV5 D;  4HGA C;  4M6B A;  3C1B D;  3MGP B;  5KDM A;  1KX4 A;  3AZK C;  2IO5 B;  5AV8 C;  1P3M D;  1P3A D;  4KGC A;  1U35 C;  1HTA A;  3X1V C;  2L5A A;  1M19 B;  3UTA A;  5B0Y B;  3WA9 C;  5BS7 C;  4J8W B;  2F8N G;  4XUJ C;  4J8U C;  3A6N D;  3X1S C;  5C3I C;  3AN2 D;  2RVQ C;  2YFV B;  3C1C D;  5AV9 D;  3AV2 A;  5AV6 D;  5B32 A;  4E45 A;  4H9N B;  3VH6 A;  4R8P D;  5CPI A;  5GXQ D;  1P34 A;  5BNX B;  4QLC B;  4JJN A;  2NQB D;  3AZL D;  3REL A;  3A6N B;  5B40 A;  4ZBJ B;  2NZD D;  3B0D B;  3AN2 B;  1R4V A;  4J8V A;  3AZI A;  5B31 C;  3MNN B;  1M18 C;  5GSU B;  3AZN C;  4R8P B;  1N1J A;  5GXQ B;  1P3L D;  1P3I A;  3W98 D;  1WWS A;  3W97 A;  1P3O C;  1P3P B;  4CSR A;  1A7W A;  5BT1 D;  5GT3 D;  4YS3 B;  3AZF B;  1B6W A;  2BYK B;  1KU5 A;  3WTP E;  1F66 C;  5CP6 B;  5AVC A;  3WTP B;  3AZH B;  4LD9 D;  1M1A A;  3W98 B;  4EO5 C;  1KX4 D;  2PYO C;  5B2J A;  4Z66 D;  1ZLA C;  5B24 B;  5B1M B;  4KGC D;  5BNV A;  1P3B C;  3UT9 A;  1ID3 A;  3MGR C;  3MGQ A;  3MGP A;  3KSY A;  3AZK B;  3KUY C;  1U35 B;  3X1V B;  3REJ A;  1M19 A;  5B0Y A;  4J8W A;  3LZ1 C;  2LY8 A;  5CPI D;  4XUJ B;  4YM6 A;  1P34 D;  5B2I C;  5B0Z D;  5AVB C;  3WKJ C;  3REL D;  1S32 C;  5B40 D;  4E44 A;  5C3I B;  3X1S B;  2HUE C;  3B6F C;  5B31 G;  1P3A A;  2YFV A;  4J8V D;  1P3F C;  1P3G C;  4H9N A;  5BNX A;  3REH C;  3MVD C;  3A6N A;  3LZ0 C;  3AZG D;  3AN2 A;  5CHL B;  5AV6 A;  3X1U C;  5AV5 C;  5CPJ D;  4R8P A;  5AVC D;  1AOI B;  5GXQ A;  3AV1 D;  1P3O B;  5B2J D;  2NZD A;  3X1T D;  4YS3 A;  2BYK A;  3TU4 C;  3UTB D;  3UT9 D;  4KHA B;  5CP6 A;  1F66 B;  2YFW B;  4G92 B;  4H9P B;  3WTP A;  3AZH A;  3W98 A;  3MGP D;  3VH6 W;  3AV1 B;  2F8N H;  2PYO B;  3NQJ A;  3C1C C;  3NQU B;  5F99 B;  5E5A D;  5B1M A;  5B24 A;  5DNM C;  2CWE A;  3X1T B;  1ULY A;  1M19 D;  5B0Y D;  4J8W D;  3UTB B;  3MGR B;  2NQB C;  3AFA C;  3AZJ C;  4LD9 A;  3AZM C;  3AZK A;  4Z66 A;  3KUY B;  4Z5T D;  5E5A B;  5DNN C;  3REI B;  4XZQ C;  3LJA C;  5JA4 B;  4X23 C;  3LZ1 B;  4QLC D;  1P3K C;  5B2I B;  2BYM A;  2F8N D;  4KUD C;  3WKJ B;  3AZE C;  3B6F B;  2HUE B;  1WWI A;  4ZUX C;  4DRA A;  4Z5T B;  3REK C;  3O62 C;  4CAY B;  3B6G D;  1P3G B;  3MNN D;  5GSU D;  4H9Q B;  4H9O B;  4WU8 D;  4WU9 B;  5B0Z A;  1P3P D;  2F8N B;  3W99 C;  3LZ0 B;  3UTA C;  3AYW C;  4YS3 D;  3AZF D;  2ARO C;  4J8X D;  3B6G B;  3V9R B;  1HQ3 C;  5CP6 D;  3X1U B;  5BO0 A;  1AOI A;  3WTP D;  3AZH D;  4WU8 B;  3AV2 C;  5B24 D;  5B1M D;  3AZG A;  2CV5 D;  5B32 C;  4AWL C;  5CPI C;  5FUG B;  1TZY D;  4KHA A;  1KX5 D;  4JJN C;  4J8X B;  5B33 C;  5CPJ A;  2YFW A;  4H9P A;  5JRG C;  3AV1 A;  2FJ7 C;  2PYO A;  3NQU A;  5F99 A;  5AV8 D;  3AZK D;  3AZI C;  3KWQ C;  3MGS B;  1U35 D;  5DNM B;  3X1V D;  2CV5 B;  3X1T A;  1KX3 C;  3W96 C;  3WA9 D;  1TZY B;  3UTB A;  1KX5 B;  2HIO C;  1P3I C;  4XUJ D;  3KXB B;  3MGR A;  3W97 C;  4J8U D;  3AZJ B;  3B0C W;  4HGA B;  3AZM B;  3LEL C;  3X1S D;  1BH9 B;  3KUY A;  5AV8 B;  5E5A A;  1EQZ C;  3REI A;  2RVQ D;  5GT0 C;  5DNN B;  4XZQ B;  3LJA B;  5AY8 C;  5JA4 A;  3WA9 B;  4X23 B;  3LZ1 A;  1M1A C;  5B2I A;  4J8U B;  1P3K B;  4KUD B;  3AZE B;  3B6F A;  5CPK C;  3UT9 C;  4Z5T A;  1ID3 C;  4CAY A;  3REK B;  3O62 B;  5B31 D;  3MGQ C;  4H9Q A;  1M18 D;  3MGP C;  1AOI D;  3B0B A;  4H9O A;  4QLC A;  5KDM B;  4WU9 A;  1B67 A;  2F8N A;  1P3O D;  5B32 G;  3WAA C;  3W99 B;  3REJ C;  3LZ0 A;  5B1L C;  5B0Y C;  3AYW B; 
#chains in the Genus database with same CATH topology
 4YM6 C;  3B6G A;  2ARO B;  3V9R A;  1F66 D;  5B31 B;  3MNN A;  1HQ3 B;  5GSU A;  3C1B C;  1M18 B;  3AZN B;  3EG5 B;  4WU8 A;  1P3M C;  1P3P A;  1P3A C;  2PYO D;  1ZLA D;  5F99 D;  1JFI B;  4AWL B;  1P3B D;  5FUG A;  3AZF A;  3VH6 T;  3IP4 C;  4J8X A;  2W8S A;  5B33 B;  3MGR D;  3A6N C;  5JRG B;  3AN2 C;  4H9S C;  2FJ7 B;  4EO5 B;  1ZLA B;  5AV9 C;  3KUY D;  3MGS A;  5AV6 C;  5DNM A;  3KWQ B;  3REI D;  3AZI B;  2CV5 A;  1KX3 B;  4R8P C;  1P3B B;  3W96 B;  1TZY A;  5GXQ C;  1KX5 A;  2HIO B;  3LZ1 D;  3KXB A;  3W97 B;  2Y2J A;  3AZL C;  4WNN B;  3AZJ A;  5G49 B;  5B2I D;  3WKJ D;  2NZD C;  3LEL B;  1BH9 A;  2Y2G A;  3VH5 A;  5AV8 A;  3B6F D;  1EQZ B;  5DNN A;  1U35 A;  5CP6 C;  5GT0 B;  3X1V A;  4XZQ A;  2FFF B;  3LJA A;  5AY8 B;  1P3F D;  1P3G D;  3WA9 A;  4G91 C;  5BS7 A;  1P3L C;  4NE6 A;  3W98 C;  4XUJ A;  3REH D;  1M1A B;  1P3K A;  4J8U A;  4WU9 D;  5AVB B;  1H3O B;  5BT1 C;  5GT3 C;  3FDD A;  3X1S A;  3LZ0 D;  2Y2I A;  5CPK B;  3R45 B;  1S32 B;  1ID3 B;  3REK A;  3O62 A;  2JSS A;  3X1U D;  3MGQ B;  1P3F B;  4LD9 C;  3REH B;  3MVD B;  1KX4 C;  4Z66 C;  4KGC C;  3WAA B;  3W99 A;  3REJ B;  5B1L B;  4UUZ B;  3AYW A;  3TU4 D;  4YM6 B;  2ARO A;  3H0M C;  5B31 A;  1HQ3 A;  1BH8 B;  1M18 A;  5AV5 B;  3C1B B;  3AZN A;  2F8N K;  1P3O A;  1P3M B;  1P3A B;  2BG1 A;  3MGS D;  1JFI A;  5DNM D;  4WZS B;  1BFM A;  1P34 C;  3TU4 B;  1F66 A;  5B33 A;  3EPH A;  3KXB D;  5B0Z C;  3AFA D;  3REL C;  3AZJ D;  5B40 C;  5JRG A;  2FJ7 A;  3AZM D;  1ZLA A;  3C1C B;  5AV9 B;  4J8V C;  3KWQ A;  5DNN D;  5AV6 B;  1KX3 A;  3B0C T;  3W96 A;  4XZQ D;  3LJA D;  1P3B A;  1AOI C;  2HIO A;  4X23 D;  2UWX A;  1TAF B;  3KFU G;  2NQB B;  4WNN A;  3AZL B;  5G49 A;  3AFA B;  1P3K D;  4KUD D;  1F1E A;  3AZG C;  3AZE D;  2NZD B;  3LEL A;  1EQZ A;  3EPL A;  4H9R B;  4ZUX D;  5GT0 A;  5CPJ C;  3REK D;  5AY8 A;  5AVC C;  3O62 D;  4G92 C;  4G91 B;  1P3L B;  3AV1 C;  4NFT A;  3NQJ B;  5B2J C;  5F99 C;  5AVB A;  1H3O A;  3WKJ A;  3W99 D;  4NE5 A;  3X1T C;  1S32 A;  5GT3 B;  5CPK A;  3R45 A;  4NE3 A;  3UTA D;  3UTB C;  3AL0 C;  4ZUX B;  3AYW D;  2ARO D;  1P3F A;  1P3G A;  1HQ3 D;  3AZN D;  4LD9 B;  3REH A;  3MVD A;  1KX4 B;  2IO5 C;  4Z66 B;  3VH5 T;  5E5A C;  3REI C;  3WAA A;  4KGC B;  5B1L A;  3AV2 D;  4UUZ A;  4DRB A;  1M19 C;  5B32 D;  4J8W C;  3UTA B;  4WV4 B;  3VH5 W;  4JJN D;  1BH8 A;  3X1U A;  5B33 D;  5AV5 A;  3C1B A;  2BYM B;  1P3M A;  5JRG D;  2FJ7 D;  4Z5T C;  4Z2M H;  2Y2P A;  3AZI D;  3AV2 B;  3KWQ D;  1KX3 D;  5B32 B;  3W96 D;  5CPI B;  3TU4 A;  4QLC C;  1P34 B;  2HIO D;  4WU9 C;  4JJN B;  1P3I D;  3W97 D;  5B0Z B;  2Y2H A;  2XD5 A;  4DQY B;  3REL B;  2DQN C;  4ZBJ C;  5B40 B;  3B0D C;  4H9S A;  3LEL D;  3C1C A;  5AV9 A;  1EQZ D;  2Y2L A;  4J8V B;  3B6G C;  5GT0 D;  3MNN C;  5GSU C;  2Y2M A;  5BO0 B;  5AY8 D;  1N1J B;  4WU8 C;  1TAF A;  4Z2M G;  1P3I B;  1P3P C;  3AZL A;  1M1A D;  2NQB A;  3AFA A;  4UPK A;  5AVB D;  4CSR B;  3AZG B;  3AZM A;  1S32 D;  4YS3 C;  3AZF C;  4H9R A;  5CPK D;  4J8X C;  1ID3 D;  2Y2K A;  5CPJ B;  5AVC B;  3WTP C;  1Q9C A;  3MGQ D;  1P3L A;  4X23 A;  3AZH C;  3MVD D;  2Y2N A;  5B2J B;  4KUD A;  5B24 C;  5B1M C;  3MGS C;  3WAA D;  3AZE A;  2CV5 C;  5BNV B;  5GT3 A;  3REJ D;  5B1L D;  3EPK A;  1TZY C;  4ZUX A;  1KX5 C;  3UT9 B;  3KXB C;  2Y2O A;  4YM6 D;  5AV5 D;  4HGA C;  4M6B A;  3C1B D;  3MGP B;  5KDM A;  1KX4 A;  3AZK C;  2IO5 B;  5AV8 C;  1P3M D;  1P3A D;  4KGC A;  1U35 C;  1HTA A;  3X1V C;  2L5A A;  1M19 B;  3UTA A;  5B0Y B;  3WA9 C;  5BS7 C;  4J8W B;  2F8N G;  4XUJ C;  4J8U C;  3H0L C;  3A6N D;  3X1S C;  5C3I C;  3AN2 D;  2RVQ C;  2YFV B;  3C1C D;  5AV9 D;  3AV2 A;  5AV6 D;  5B32 A;  4E45 A;  4H9N B;  3VH6 A;  4R8P D;  5CPI A;  5GXQ D;  1P34 A;  2XD1 A;  5BNX B;  4QLC B;  4JJN A;  2NQB D;  3AZL D;  3REL A;  3A6N B;  2JCH A;  5B40 A;  4ZBJ B;  2DF4 C;  2JE5 A;  2NZD D;  3B0D B;  3AN2 B;  1R4V A;  4J8V A;  3AZI A;  1Z2C B;  2G5H C;  5B31 C;  3MNN B;  1M18 C;  5GSU B;  3AZN C;  4R8P B;  1N1J A;  2ZY4 A;  5GXQ B;  1P3L D;  1P3I A;  3W98 D;  1WWS A;  3W97 A;  1P3O C;  1P3P B;  4CSR A;  1A7W A;  5BT1 D;  5GT3 D;  2VQR A;  3A1I A;  4YS3 B;  3AZF B;  2ZM5 A;  1B6W A;  2BYK B;  1KU5 A;  3WTP E;  3A1K A;  1F66 C;  5CP6 B;  5AVC A;  3WTP B;  3AZH B;  4LD9 D;  1M1A A;  3W98 B;  4EO5 C;  1KX4 D;  2PYO C;  1W2E A;  5B2J A;  4Z66 D;  1ZLA C;  5B24 B;  5B1M B;  4KGC D;  5BNV A;  1P3B C;  2RIQ A;  3UT9 A;  1ID3 A;  3MGR C;  3MGQ A;  3MGP A;  3KSY A;  3AZK B;  3KUY C;  1U35 B;  3X1V B;  3REJ A;  1M19 A;  5B0Y A;  4J8W A;  3LZ1 C;  2LY8 A;  5CPI D;  4XUJ B;  4YM6 A;  1P34 D;  5B2I C;  5B0Z D;  5AVB C;  3WKJ C;  3REL D;  1S32 C;  5B40 D;  4E44 A;  5C3I B;  3X1S B;  2HUE C;  3B6F C;  5B31 G;  1P3A A;  2YFV A;  4J8V D;  1P3F C;  1P3G C;  4H9N A;  5BNX A;  3REH C;  3MVD C;  3P5J B;  3A6N A;  3LZ0 C;  3AZG D;  3AN2 A;  5CHL B;  5AV6 A;  3X1U C;  5AV5 C;  5CPJ D;  4R8P A;  5AVC D;  1AOI B;  5GXQ A;  3AV1 D;  1P3O B;  5B2J D;  2NZD A;  3X1T D;  4YS3 A;  2BYK A;  3TU4 C;  3UTB D;  3UT9 D;  4KHA B;  5CP6 A;  1F66 B;  2YFW B;  4G92 B;  4H9P B;  3WTP A;  3AZH A;  3W98 A;  3F6T A;  3MGP D;  3VH6 W;  3AV1 B;  2F8N H;  2PYO B;  3NQJ A;  3C1C C;  3NQU B;  5F99 B;  5E5A D;  5B1M A;  5B24 A;  5DNM C;  2CWE A;  3X1T B;  1ULY A;  1M19 D;  5B0Y D;  4J8W D;  3UTB B;  3MGR B;  2NQB C;  3AFA C;  3AZJ C;  2G5I C;  4LD9 A;  3AZM C;  4WJ3 C;  3AZK A;  4Z66 A;  3KUY B;  4Z5T D;  5E5A B;  5DNN C;  3REI B;  4XZQ C;  3LJA C;  5JA4 B;  4X23 C;  3LZ1 B;  4QLC D;  1P3K C;  5B2I B;  2BYM A;  2F8N D;  4KUD C;  2ZY3 A;  3WKJ B;  3AZE C;  3B6F B;  2HUE B;  1WWI A;  4ZUX C;  4DRA A;  4Z5T B;  1T3U A;  3REK C;  3O62 C;  4CAY B;  3B6G D;  1P3G B;  3MNN D;  5GSU D;  4H9Q B;  4H9O B;  4WU8 D;  4WU9 B;  5B0Z A;  1P3P D;  2F8N B;  3W99 C;  3LZ0 B;  3UTA C;  3AYW C;  4YS3 D;  3AZF D;  2ARO C;  4J8X D;  2Y2Q A;  3B6G B;  3V9R B;  1HQ3 C;  5CP6 D;  3X1U B;  5BO0 A;  1AOI A;  3WTP D;  3EPJ A;  3AZH D;  4WU8 B;  3AV2 C;  5B24 D;  5B1M D;  3AZG A;  2CV5 D;  5B32 C;  4AWL C;  5CPI C;  5FUG B;  1TZY D;  4KHA A;  1KX5 D;  4JJN C;  4J8X B;  5B33 C;  2ZY2 A;  5CPJ A;  2YFW A;  4H9P A;  5JRG C;  3AV1 A;  2FJ7 C;  2PYO A;  3NQU A;  5F99 A;  5AV8 D;  3AZK D;  2J8P A;  3H0R C;  3AZI C;  3KWQ C;  3MGS B;  1U35 D;  5DNM B;  3X1V D;  2CV5 B;  3X1T A;  1KX3 C;  3W96 C;  3WA9 D;  1TZY B;  3UTB A;  1KX5 B;  2HIO C;  1P3I C;  4XUJ D;  3KXB B;  3MGR A;  3W97 C;  4J8U D;  2F2A C;  3AZJ B;  3B0C W;  4HGA B;  3AZM B;  3LEL C;  3X1S D;  1BH9 B;  3KUY A;  5AV8 B;  5E5A A;  1EQZ C;  3REI A;  2RVQ D;  5GT0 C;  5DNN B;  4XZQ B;  3LJA B;  5AY8 C;  5JA4 A;  3WA9 B;  4X23 B;  3LZ1 A;  1M1A C;  5B2I A;  4J8U B;  1P3K B;  4KUD B;  1PZR A;  2ZY5 A;  3AZE B;  3B6F A;  5CPK C;  3UT9 C;  4Z5T A;  1ID3 C;  4CAY A;  3REK B;  3O62 B;  5B31 D;  3MGQ C;  4H9Q A;  1M18 D;  3MGP C;  1AOI D;  3B0B A;  4H9O A;  4QLC A;  5KDM B;  4WU9 A;  1B67 A;  2F8N A;  1P3O D;  5B32 G;  3WAA C;  3W99 B;  3REJ C;  3LZ0 A;  5B1L C;  5B0Y C;  3AYW B; 
#chains in the Genus database with same CATH homology
 4YM6 C;  3B6G A;  2ARO B;  3V9R A;  1F66 D;  5B31 B;  3MNN A;  1HQ3 B;  5GSU A;  3C1B C;  1M18 B;  3AZN B;  3EG5 B;  4WU8 A;  1P3M C;  1P3P A;  1P3A C;  2PYO D;  1ZLA D;  5F99 D;  1JFI B;  4AWL B;  1P3B D;  5FUG A;  3AZF A;  3VH6 T;  3IP4 C;  4J8X A;  2W8S A;  5B33 B;  3MGR D;  3A6N C;  5JRG B;  3AN2 C;  4H9S C;  2FJ7 B;  4EO5 B;  1ZLA B;  5AV9 C;  3KUY D;  3MGS A;  5AV6 C;  5DNM A;  3KWQ B;  3REI D;  3AZI B;  2CV5 A;  1KX3 B;  4R8P C;  1P3B B;  3W96 B;  1TZY A;  5GXQ C;  1KX5 A;  2HIO B;  3LZ1 D;  3KXB A;  3W97 B;  2Y2J A;  3AZL C;  4WNN B;  3AZJ A;  5G49 B;  5B2I D;  3WKJ D;  2NZD C;  3LEL B;  1BH9 A;  2Y2G A;  3VH5 A;  5AV8 A;  3B6F D;  1EQZ B;  5DNN A;  1U35 A;  5CP6 C;  5GT0 B;  3X1V A;  4XZQ A;  2FFF B;  3LJA A;  5AY8 B;  1P3F D;  1P3G D;  3WA9 A;  4G91 C;  5BS7 A;  1P3L C;  4NE6 A;  3W98 C;  4XUJ A;  3REH D;  1M1A B;  1P3K A;  4J8U A;  4WU9 D;  5AVB B;  1H3O B;  5BT1 C;  5GT3 C;  3FDD A;  3X1S A;  3LZ0 D;  2Y2I A;  5CPK B;  3R45 B;  1S32 B;  1ID3 B;  3REK A;  3O62 A;  2JSS A;  3X1U D;  3MGQ B;  1P3F B;  4LD9 C;  3REH B;  3MVD B;  1KX4 C;  4Z66 C;  4KGC C;  3WAA B;  3W99 A;  3REJ B;  5B1L B;  4UUZ B;  3AYW A;  3TU4 D;  4YM6 B;  2ARO A;  3H0M C;  5B31 A;  1HQ3 A;  1BH8 B;  1M18 A;  5AV5 B;  3C1B B;  3AZN A;  2F8N K;  1P3O A;  1P3M B;  1P3A B;  2BG1 A;  3MGS D;  1JFI A;  5DNM D;  4WZS B;  1BFM A;  1P34 C;  3TU4 B;  1F66 A;  5B33 A;  3EPH A;  3KXB D;  5B0Z C;  3AFA D;  3REL C;  3AZJ D;  5B40 C;  5JRG A;  2FJ7 A;  3AZM D;  1ZLA A;  3C1C B;  5AV9 B;  4J8V C;  3KWQ A;  5DNN D;  5AV6 B;  1KX3 A;  3B0C T;  3W96 A;  4XZQ D;  3LJA D;  1P3B A;  1AOI C;  2HIO A;  4X23 D;  2UWX A;  1TAF B;  3KFU G;  2NQB B;  4WNN A;  3AZL B;  5G49 A;  3AFA B;  1P3K D;  4KUD D;  1F1E A;  3AZG C;  3AZE D;  2NZD B;  3LEL A;  1EQZ A;  3EPL A;  4H9R B;  4ZUX D;  5GT0 A;  5CPJ C;  3REK D;  5AY8 A;  5AVC C;  3O62 D;  4G92 C;  4G91 B;  1P3L B;  3AV1 C;  4NFT A;  3NQJ B;  5B2J C;  5F99 C;  5AVB A;  1H3O A;  3WKJ A;  3W99 D;  4NE5 A;  3X1T C;  1S32 A;  5GT3 B;  5CPK A;  3R45 A;  4NE3 A;  3UTA D;  3UTB C;  3AL0 C;  4ZUX B;  3AYW D;  2ARO D;  1P3F A;  1P3G A;  1HQ3 D;  3AZN D;  4LD9 B;  3REH A;  3MVD A;  1KX4 B;  2IO5 C;  4Z66 B;  3VH5 T;  5E5A C;  3REI C;  3WAA A;  4KGC B;  5B1L A;  3AV2 D;  4UUZ A;  4DRB A;  1M19 C;  5B32 D;  4J8W C;  3UTA B;  4WV4 B;  3VH5 W;  4JJN D;  1BH8 A;  3X1U A;  5B33 D;  5AV5 A;  3C1B A;  2BYM B;  1P3M A;  5JRG D;  2FJ7 D;  4Z5T C;  4Z2M H;  2Y2P A;  3AZI D;  3AV2 B;  3KWQ D;  1KX3 D;  5B32 B;  3W96 D;  5CPI B;  3TU4 A;  4QLC C;  1P34 B;  2HIO D;  4WU9 C;  4JJN B;  1P3I D;  3W97 D;  5B0Z B;  2Y2H A;  2XD5 A;  4DQY B;  3REL B;  2DQN C;  4ZBJ C;  5B40 B;  3B0D C;  4H9S A;  3LEL D;  3C1C A;  5AV9 A;  1EQZ D;  2Y2L A;  4J8V B;  3B6G C;  5GT0 D;  3MNN C;  5GSU C;  2Y2M A;  5BO0 B;  5AY8 D;  1N1J B;  4WU8 C;  1TAF A;  4Z2M G;  1P3I B;  1P3P C;  3AZL A;  1M1A D;  2NQB A;  3AFA A;  4UPK A;  5AVB D;  4CSR B;  3AZG B;  3AZM A;  1S32 D;  4YS3 C;  3AZF C;  4H9R A;  5CPK D;  4J8X C;  1ID3 D;  2Y2K A;  5CPJ B;  5AVC B;  3WTP C;  1Q9C A;  3MGQ D;  1P3L A;  4X23 A;  3AZH C;  3MVD D;  2Y2N A;  5B2J B;  4KUD A;  5B24 C;  5B1M C;  3MGS C;  3WAA D;  3AZE A;  2CV5 C;  5BNV B;  5GT3 A;  3REJ D;  5B1L D;  3EPK A;  1TZY C;  4ZUX A;  1KX5 C;  3UT9 B;  3KXB C;  2Y2O A;  4YM6 D;  5AV5 D;  4HGA C;  4M6B A;  3C1B D;  3MGP B;  5KDM A;  1KX4 A;  3AZK C;  2IO5 B;  5AV8 C;  1P3M D;  1P3A D;  4KGC A;  1U35 C;  1HTA A;  3X1V C;  2L5A A;  1M19 B;  3UTA A;  5B0Y B;  3WA9 C;  5BS7 C;  4J8W B;  2F8N G;  4XUJ C;  4J8U C;  3H0L C;  3A6N D;  3X1S C;  5C3I C;  3AN2 D;  2RVQ C;  2YFV B;  3C1C D;  5AV9 D;  3AV2 A;  5AV6 D;  5B32 A;  4E45 A;  4H9N B;  3VH6 A;  4R8P D;  5CPI A;  5GXQ D;  1P34 A;  2XD1 A;  5BNX B;  4QLC B;  4JJN A;  2NQB D;  3AZL D;  3REL A;  3A6N B;  2JCH A;  5B40 A;  4ZBJ B;  2DF4 C;  2JE5 A;  2NZD D;  3B0D B;  3AN2 B;  1R4V A;  4J8V A;  3AZI A;  1Z2C B;  2G5H C;  5B31 C;  3MNN B;  1M18 C;  5GSU B;  3AZN C;  4R8P B;  1N1J A;  2ZY4 A;  5GXQ B;  1P3L D;  1P3I A;  3W98 D;  1WWS A;  3W97 A;  1P3O C;  1P3P B;  4CSR A;  1A7W A;  5BT1 D;  5GT3 D;  2VQR A;  3A1I A;  4YS3 B;  3AZF B;  2ZM5 A;  1B6W A;  2BYK B;  1KU5 A;  3WTP E;  3A1K A;  1F66 C;  5CP6 B;  5AVC A;  3WTP B;  3AZH B;  4LD9 D;  1M1A A;  3W98 B;  4EO5 C;  1KX4 D;  2PYO C;  1W2E A;  5B2J A;  4Z66 D;  1ZLA C;  5B24 B;  5B1M B;  4KGC D;  5BNV A;  1P3B C;  2RIQ A;  3UT9 A;  1ID3 A;  3MGR C;  3MGQ A;  3MGP A;  3KSY A;  3AZK B;  3KUY C;  1U35 B;  3X1V B;  3REJ A;  1M19 A;  5B0Y A;  4J8W A;  3LZ1 C;  2LY8 A;  5CPI D;  4XUJ B;  4YM6 A;  1P34 D;  5B2I C;  5B0Z D;  5AVB C;  3WKJ C;  3REL D;  1S32 C;  5B40 D;  4E44 A;  5C3I B;  3X1S B;  2HUE C;  3B6F C;  5B31 G;  1P3A A;  2YFV A;  4J8V D;  1P3F C;  1P3G C;  4H9N A;  5BNX A;  3REH C;  3MVD C;  3P5J B;  3A6N A;  3LZ0 C;  3AZG D;  3AN2 A;  5CHL B;  5AV6 A;  3X1U C;  5AV5 C;  5CPJ D;  4R8P A;  5AVC D;  1AOI B;  5GXQ A;  3AV1 D;  1P3O B;  5B2J D;  2NZD A;  3X1T D;  4YS3 A;  2BYK A;  3TU4 C;  3UTB D;  3UT9 D;  4KHA B;  5CP6 A;  1F66 B;  2YFW B;  4G92 B;  4H9P B;  3WTP A;  3AZH A;  3W98 A;  3F6T A;  3MGP D;  3VH6 W;  3AV1 B;  2F8N H;  2PYO B;  3NQJ A;  3C1C C;  3NQU B;  5F99 B;  5E5A D;  5B1M A;  5B24 A;  5DNM C;  2CWE A;  3X1T B;  1ULY A;  1M19 D;  5B0Y D;  4J8W D;  3UTB B;  3MGR B;  2NQB C;  3AFA C;  3AZJ C;  2G5I C;  4LD9 A;  3AZM C;  4WJ3 C;  3AZK A;  4Z66 A;  3KUY B;  4Z5T D;  5E5A B;  5DNN C;  3REI B;  4XZQ C;  3LJA C;  5JA4 B;  4X23 C;  3LZ1 B;  4QLC D;  1P3K C;  5B2I B;  2BYM A;  2F8N D;  4KUD C;  2ZY3 A;  3WKJ B;  3AZE C;  3B6F B;  2HUE B;  1WWI A;  4ZUX C;  4DRA A;  4Z5T B;  1T3U A;  3REK C;  3O62 C;  4CAY B;  3B6G D;  1P3G B;  3MNN D;  5GSU D;  4H9Q B;  4H9O B;  4WU8 D;  4WU9 B;  5B0Z A;  1P3P D;  2F8N B;  3W99 C;  3LZ0 B;  3UTA C;  3AYW C;  4YS3 D;  3AZF D;  2ARO C;  4J8X D;  2Y2Q A;  3B6G B;  3V9R B;  1HQ3 C;  5CP6 D;  3X1U B;  5BO0 A;  1AOI A;  3WTP D;  3EPJ A;  3AZH D;  4WU8 B;  3AV2 C;  5B24 D;  5B1M D;  3AZG A;  2CV5 D;  5B32 C;  4AWL C;  5CPI C;  5FUG B;  1TZY D;  4KHA A;  1KX5 D;  4JJN C;  4J8X B;  5B33 C;  2ZY2 A;  5CPJ A;  2YFW A;  4H9P A;  5JRG C;  3AV1 A;  2FJ7 C;  2PYO A;  3NQU A;  5F99 A;  5AV8 D;  3AZK D;  2J8P A;  3H0R C;  3AZI C;  3KWQ C;  3MGS B;  1U35 D;  5DNM B;  3X1V D;  2CV5 B;  3X1T A;  1KX3 C;  3W96 C;  3WA9 D;  1TZY B;  3UTB A;  1KX5 B;  2HIO C;  1P3I C;  4XUJ D;  3KXB B;  3MGR A;  3W97 C;  4J8U D;  2F2A C;  3AZJ B;  3B0C W;  4HGA B;  3AZM B;  3LEL C;  3X1S D;  1BH9 B;  3KUY A;  5AV8 B;  5E5A A;  1EQZ C;  3REI A;  2RVQ D;  5GT0 C;  5DNN B;  4XZQ B;  3LJA B;  5AY8 C;  5JA4 A;  3WA9 B;  4X23 B;  3LZ1 A;  1M1A C;  5B2I A;  4J8U B;  1P3K B;  4KUD B;  1PZR A;  2ZY5 A;  3AZE B;  3B6F A;  5CPK C;  3UT9 C;  4Z5T A;  1ID3 C;  4CAY A;  3REK B;  3O62 B;  5B31 D;  3MGQ C;  4H9Q A;  1M18 D;  3MGP C;  1AOI D;  3B0B A;  4H9O A;  4QLC A;  5KDM B;  4WU9 A;  1B67 A;  2F8N A;  1P3O D;  5B32 G;  3WAA C;  3W99 B;  3REJ C;  3LZ0 A;  5B1L C;  5B0Y C;  3AYW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...