3REID

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiD00
5AVBD 4X23C 5DNMB 4J8VC 1BH8A 1P3PC 3AZED 5B0ZC 1M1AD 1AOIB 1P3BA 4H9SA 5B2JA 4LD9C 1P3BB 1P3MC 1ID3B 2FJ7C 5BS7A 3X1VD 1KX5D 5E5AC 5B32D 4H9QA 1HTAA 5GSUD 4H9QB 3REIC 4ZBJB 4KHAA 2NQBC 3WKJB 3REKA 1ZLAD 1P3FD 3UTAC 5AV9D 3VH5T 3REKB 1N1JA 5CPJD 1AOIC 1EQZD 3NQUB 1N1JB 3LELD 1P3KB 1ID3C 5DNND 3MGSB 3W98A 1P3OD 4YS3C 3W98B 4M6BA 2AROA 1M19A 1KX4D 2AROB 4HGAC 3LZ0C 3B6FC 3KXBD 1M19B 3WA9A 5KDMB 3WKJC 4XUJA 5B40A 3WA9B 3REKC 4XUJB 3AZJA 5B40B 4XZQD 3B0CT 3AZJB 3MGPC 1P3KC 5GT0C 5B24D 4WNNA 3O62A 3KSYA 4G91B 3MGSC 4WNNB 3X1TA 3RELC 3X1TB 3AZKD 5CPIB 1S32D 3AZLA 1M19C 5JRGD 3AZGA 3MGRD 1P34D 3AZLB 4XUJC 5B1LB 4R8PA 1F66D 3AYWC 3KWQD 3UTBD 4R8PB 4WU9D 4G91C 3R45A 4WU8C 1P3GB 3LZ1A 3X1SA 3R45B 4AWLB 4J8UA 3X1TC 3VH5A 3TU4A 3X1SB 5CPIC 3TU4B 2IO5B 4JJNC 3W99A 4QLCD 5GXQB 3AV2D 4ZUXA 2BYMA 5F99D 5AV5D 2RVQC 2CV5B 5AV8A 3REHA 5B1LC 3AZID 1M18D 3AZHA 4KUDC 3B0DB 1TZYD 5FUGA 4Z5TD 1P3GC 5FUGB 3KUYA 2PYOA 3AZNB 3AZFA 3UT9A 4YM6B 1HQ3D 3KUYB 3AZMA 2PYOB 5B0YC 3UT9B 1U35A 3AZMB 3W96C 3A6ND 2NZDD 4J8WD 5GXQC 4X23A 1B67A 4J8VA 1P3LD 3MNNC 2CV5C 1KX3D 3MVDC 3LJAD 1P3PA 5B2ID 3MGQD 5B0ZA 4X23B 1JFIB 5CPKD 5B0ZB 4LD9A 5B33C 3B0DC 1P3MA 4LD9B 2FJ7A 1P3MB 4J8XC 4CAYA 4KGCD 3AZNC 4E44A 5E5AA 4Z66D 4YM6C 3C1CB 4CAYB 5E5AB 3AN2C 3REIA 3AZMC 2F8NA 2NQBA 5CP6C 3WTPC 3REIB 3VH6T 2F8NB 3UTAA 2NQBB 5B31B 1P3AC 2F8NG 3UTAB 5B31G 5DNMD 3REJB 3AV1B 1AOIA 1B6WA 3C1BC 1ID3A 1P3BD 5B2JD 4YS3A 2HIOC 3C1CC 4YS3B 4DRAA 2HUEC 3VH5W 5AVCC 3LZ0A 3B6FA 3AFAC 3WKJA 3B6GC 4HGAB 3LZ0B 3B6FB 5GT3C 5B31C 3V9RA 2LY8A 3REJC 3AV1C 3NQUA 3MGPA 3REKD 1P3KA 5GT0A 3V9RB 1M1AB 3MGPB 5GT0B 5AY8C 3MGSA 3RELA 5AV6C 3RELB 1KX5B 3W98D 3W97C 3B0CW 5B1MC 1WWSA 4H9RA 5KDMA 3X1UC 2AROD 4H9RB 1M19D 5BNXA 5AVBC 5AV9B 3WA9D 4XUJD 5BNXB 5B40D 3AZEC 5CPJB 2CWEA 1M1AC 3AYWA 3LELB 3AZJD 3AYWB 4WU8A 3VH6A 4WU8B 5BT1D 3O62D 3X1VC 1KX5C 5CPIA 3X1TD 5B32C 5GSUC 4JJNA 1KX4B 3KXBB 4JJNB 1ZLAC 1P3FC 5AV9C 3AZLD 5B1LA 5CPJC 3AZGD 4XZQB 4KUDA 1EQZC 3LELC 4CSRA 5B24B 4KUDB 1P3GA 4CSRB 4R8PD 5DNNC 1P3OC 3WAAA 3LZ1D 5B0YA 3X1SD 3WAAB 3W96A 4J8UD 1KX4C 3TU4D 5B0YB 5GXQA 5CHLB 1S32B 3KXBC 3W96B 5JRGB 3MNNA 2CV5A 3MGRB 5GXQD 3MVDA 3W99D 3MNNB 4NE3A 3MVDB 4XZQC 2CV5D 4ZUXD 5B33A 5AV8D 5B24C 5B33B 3REHD 4J8XA 3AZHD 5C3IB 3AZNA 1BH9A 4J8XB 4WV4B 4YM6A 3AZKC 1BH9B 3AN2A 3WAAC 3KUYD 2PYOD 5CP6A 3AZFD 3WTPA 3AN2B 3UT9D 1S32C 3B0BA 3AZMD 5JRGC 3NQJB 5CP6B 3WTPB 4QLCB 3MGRC 1U35D 5AV5B 5F99B 2L5AA 1P34C 1P3AA 1R4VA 1JFIA 2YFWB 1P3AB 3C1BA 4X23D 3AZIB 4J8VD 1F66C 1P3PD 3C1BB 5B0ZD 3KWQC 3UTBC 1TZYB 4WU9C 1TAFA 4LD9D 5C3IC 1H3OA 1TAFB 2HIOA 1P3MD 3C1CA 3VH6W 1H3OB 2FJ7D 2HIOB 5AVCA 3C1CD 3AFAA 2HUEB 5AVCB 5E5AD 4DRBA 3B6GA 5GT3A 5B31A 3AFAB 4QLCC 4J8WB 3AV2C 3B6GB 5AV5C 5F99C 3REID 5GT3B 3REJA 3AV1A 2F8ND 2NQBD 5B2IB 3MGQB 3UTAD 3AZIC 1P3IB 1M18C 5AY8A 1AOID 1TZYC 4Z5TC 5AY8B 5AV6A 1BFMA 1ID3D 5AV6B 3W97A 4Z66B 4E45A 1HQ3C 4YS3D 5B1MA 3W97B 3X1UA 2NZDC 5B1MB 4J8WC 3X1UB 5AVBA 3LZ0D 3B6FD 1P3LC 3WKJD 1KX3C 3LJAC 5B2IC 5AVBB 3MGQC 4H9NB 3AZEA 1M1AA 1P3IC 3AZEB 5CPKC 1BH8B 3MGPD 1P3KD 5GT0D 4Z2MH 5B2JB 3X1VA 1KX5A 3MGSD 4KGCC 5B32A 4Z66C 3RELD 3X1VB 5GSUA 5BO0A 5B32B 5GSUB 5BO0B 1WWIA 5B32G 1ZLAA 1P3FA 5AV9A 1ZLAB 1P3FB 5CPJA 4KHAB 5DNMC 1EQZA 3LELA 1Q9CA 1EQZB 5DNNA 3AYWD 1P3BC 4H9SC 5B2JC 1P3OA 5DNNB 4WU8D 1P3OB 2JSSA 1KX4A 5BS7C 3KXBA 5CPID 4ZBJC 4JJND 4XZQA 4EO5B 2RVQD 2F8NH 4NE5A 5B24A 5B1LD 4KUDD 1A7WA 4G92B 3O62B 3AZKA 1P3GD 3W98C 3AZKB 1S32A 3WAAD 5BNVA 5JRGA 3MGRA 2AROC 5B0YD 1P34A 3W96D 5BNVB 1P34B 3WA9C 4EO5C 3MNND 5B40C 3AZGB 3MVDD 1F66A 3KWQA 3AZJC 3UTBA 1F66B 4WU9A 5G49A 3WTPE 5B33D 3KWQB 3UTBB 4WU9B 4G92C 5G49B 5BT1C 3O62C 4J8XD 3AZND 3LZ1B 4YM6D 4J8UB 3NQJA 4QLCA 3AV2A 3AN2D 5AV5A 5F99A 2F8NK 3AV2B 5CP6D 2YFWA 5JA4A 3WTPD 3AZLC 3AZIA 1KU5A 3W99B 3AZGC 5JA4B 1M18A 1P3AD 4ZUXB 2BYMB 1TZYA 4Z5TA 1M18B 5AV8B 3C1BD 4Z2MG 3REHB 4R8PC 4Z5TB 3AZHB 1HQ3A 4AWLC 4NE6A 3LZ1C 2HIOD 3X1SC 1HQ3B 4J8UC 3A6NA 2NZDA 4J8WA 3TU4C 5AVCD 3AZFB 2IO5C 3A6NB 2NZDB 4UUZA 3AFAD 1P3LA 1KX3A 3LJAA 1U35B 3B6GD 5B2IA 3MGQA 4H9PA 4UUZB 5GT3D 2BYKA 3W99C 5B31D 3LJAB 1P3IA 1P3LB 1KX3B 5CPKA 4ZUXC 4H9PB 3REJD 2BYKB 4J8VB 3AV1D 4H9OA 1P3ID 5AV8C 5CPKB 1P3PB 3REHC 4WZSB 4H9OB 5AY8D 3AZHC 4KGCA 4Z66A 2FJ7B 4KGCB 5AV6D 1F1EA 3KUYC 1ULYA 2PYOC 4NFTA 3W97D 3AZFC 3UT9C 2YFVA 3A6NC 5B1MD 1U35C 3X1UD 2YFVB 4H9NA 5DNMA
chains in the Genus database with same CATH superfamily
5AVBD 1PZRA 4X23C 5DNMB 4J8VC 1BH8A 1P3PC 3AZED 5B0ZC 1M1AD 1AOIB 2Y2NA 1P3BA 4H9SA 2VQRA 5B2JA 4LD9C 1P3BB 1P3MC 1ID3B 2FJ7C 5BS7A 2DQNC 3X1VD 1KX5D 2XD1A 5E5AC 5B32D 1HTAA 4H9QA 5GSUD 4H9QB 3REIC 3A1KA 4ZBJB 4KHAA 2NQBC 3EPHA 3WKJB 3REKA 1ZLAD 1P3FD 3UTAC 5AV9D 3VH5T 3REKB 1N1JA 5CPJD 1AOIC 1EQZD 3NQUB 1N1JB 3LELD 1P3KB 1ID3C 5DNND 3MGSB 3W98A 1P3OD 2G5HC 4YS3C 3W98B 4M6BA 2AROA 1M19A 1KX4D 2AROB 4HGAC 2RIQA 3LZ0C 3KXBD 3B6FC 1M19B 3WA9A 5KDMB 3WKJC 4XUJA 5B40A 3WA9B 3A1IA 3EPKA 3REKC 4XUJB 3AZJA 5B40B 4XZQD 3B0CT 3AZJB 3MGPC 2JCHA 1P3KC 5GT0C 5B24D 4WNNA 3O62A 3KSYA 4G91B 3MGSC 4WNNB 3X1TA 3RELC 2Y2QA 3X1TB 3AZKD 5CPIB 3H0RC 1S32D 3AZLA 1M19C 5JRGD 3AZGA 3MGRD 1P34D 3AZLB 4XUJC 2ZY5A 5B1LB 4R8PA 1F66D 3AYWC 3KWQD 3UTBD 4R8PB 4WU9D 4G91C 3R45A 4WU8C 1P3GB 3LZ1A 3X1SA 3R45B 4AWLB 4J8UA 3X1TC 3VH5A 3TU4A 3X1SB 5CPIC 3TU4B 2IO5B 4JJNC 2ZM5A 3W99A 4QLCD 5GXQB 3AV2D 4ZUXA 2BYMA 5F99D 5AV5D 2RVQC 2CV5B 5AV8A 3REHA 5B1LC 3AZID 1M18D 3AZHA 4KUDC 3B0DB 1TZYD 5FUGA 4Z5TD 1P3GC 5FUGB 3KUYA 2PYOA 3AZNB 3AZFA 3UT9A 4YM6B 1HQ3D 3KUYB 3AZMA 2PYOB 5B0YC 3UT9B 1U35A 3AZMB 3W96C 3A6ND 2NZDD 4J8WD 5GXQC 4X23A 1B67A 4J8VA 1P3LD 2ZY3A 3MNNC 2CV5C 3MVDC 3LJAD 1P3PA 5B2ID 3MGQD 5B0ZA 4X23B 1JFIB 2BG1A 5CPKD 5B0ZB 4LD9A 5B33C 3B0DC 1P3MA 4UPKA 4LD9B 2FJ7A 1P3MB 4J8XC 4CAYA 4KGCD 3AZNC 4E44A 5E5AA 4Z66D 4YM6C 3C1CB 4CAYB 1W2EA 2UWXA 5E5AB 1KX3D 3AN2C 3REIA 3AZMC 2F8NA 2NQBA 5CP6C 3WTPC 3REIB 3VH6T 2XD5A 2F8NB 3UTAA 2NQBB 5B31B 1P3AC 2F8NG 3UTAB 5B31G 5DNMD 3REJB 3AV1B 1AOIA 1B6WA 3C1BC 1ID3A 1P3BD 5B2JD 4YS3A 2HIOC 3C1CC 4YS3B 4DRAA 2HUEC 3VH5W 5AVCC 3LZ0A 3B6FA 3AFAC 3WKJA 3B6GC 4HGAB 3LZ0B 3B6FB 5GT3C 5B31C 3V9RA 2LY8A 3REJC 3AV1C 3NQUA 3MGPA 3REKD 1P3KA 5GT0A 3V9RB 1M1AB 3MGPB 3P5JB 2Y2OA 5AY8C 5GT0B 3MGSA 2ZY2A 3RELA 5AV6C 3RELB 1KX5B 3W98D 3W97C 3B0CW 5B1MC 5KDMA 1WWSA 4H9RA 2Y2MA 3X1UC 2AROD 4H9RB 1M19D 5BNXA 5AVBC 5AV9B 3WA9D 4XUJD 5BNXB 5B40D 3AZEC 5CPJB 2CWEA 1M1AC 3AYWA 3LELB 3AZJD 4WJ3C 3AYWB 4WU8A 3VH6A 4WU8B 5BT1D 3O62D 3X1VC 1KX5C 5CPIA 3X1TD 5B32C 5GSUC 4JJNA 1KX4B 3KXBB 4JJNB 1ZLAC 1P3FC 5AV9C 3AZLD 2ZY4A 5B1LA 5CPJC 3AZGD 4XZQB 2JE5A 4KUDA 1EQZC 3LELC 4CSRA 5B24B 4KUDB 1P3GA 3H0LC 4CSRB 4R8PD 5DNNC 1P3OC 3WAAA 3LZ1D 5B0YA 3X1SD 3WAAB 3W96A 4J8UD 1KX4C 3TU4D 5B0YB 5GXQA 5CHLB 1S32B 3KXBC 3W96B 5JRGB 3MNNA 2CV5A 3MGRB 5GXQD 3MVDA 3W99D 3MNNB 4NE3A 3MVDB 3EG5B 4XZQC 2CV5D 4ZUXD 5B33A 5AV8D 5B24C 5B33B 3REHD 3EPLA 2G5IC 4J8XA 3AZHD 3AL0C 5C3IB 3AZNA 1BH9A 4J8XB 4WV4B 4YM6A 3AZKC 1BH9B 3AN2A 3WAAC 3KUYD 2PYOD 5CP6A 3AZFD 3WTPA 3AN2B 3UT9D 1S32C 3B0BA 2DF4C 3AZMD 5JRGC 3NQJB 5CP6B 3WTPB 4QLCB 3MGRC 1U35D 5AV5B 5F99B 2L5AA 1P34C 1P3AA 1R4VA 1JFIA 2YFWB 1P3AB 3C1BA 4X23D 3AZIB 4J8VD 1F66C 3KFUG 1P3PD 3C1BB 5B0ZD 3KWQC 3UTBC 1TZYB 4WU9C 1TAFA 4LD9D 5C3IC 1H3OA 1TAFB 2HIOA 1P3MD 2Y2JA 3C1CA 3VH6W 1H3OB 2FJ7D 2HIOB 5AVCA 3IP4C 3C1CD 3AFAA 2HUEB 5AVCB 5E5AD 4DRBA 3B6GA 5GT3A 5B31A 3AFAB 4QLCC 4J8WB 3AV2C 3B6GB 5AV5C 5F99C 3REID 5GT3B 3REJA 3AV1A 2F8ND 2NQBD 1T3UA 5B2IB 3MGQB 3UTAD 3AZIC 1P3IB 1M18C 5AY8A 1Z2CB 1AOID 1TZYC 4Z5TC 5AY8B 5AV6A 1BFMA 1ID3D 5AV6B 3W97A 4Z66B 4E45A 3H0MC 1HQ3C 4YS3D 5B1MA 3W97B 3X1UA 2NZDC 5B1MB 4J8WC 3X1UB 5AVBA 3LZ0D 3B6FD 1P3LC 3WKJD 1KX3C 3LJAC 5B2IC 5AVBB 3MGQC 4H9NB 3AZEA 1M1AA 1P3IC 3AZEB 5CPKC 1BH8B 3MGPD 1P3KD 5GT0D 4Z2MH 5B2JB 3X1VA 1KX5A 3F6TA 3MGSD 4KGCC 5B32A 4Z66C 3RELD 3X1VB 5GSUA 2FFFB 5BO0A 5B32B 5GSUB 2Y2IA 5B32G 1WWIA 5BO0B 1ZLAA 1P3FA 5AV9A 1ZLAB 1P3FB 5CPJA 4KHAB 5DNMC 1EQZA 3LELA 1Q9CA 1EQZB 5DNNA 3AYWD 1P3BC 4H9SC 5B2JC 1P3OA 5DNNB 4WU8D 1P3OB 2JSSA 1KX4A 5BS7C 3KXBA 5CPID 4ZBJC 4JJND 4DQYB 4XZQA 4EO5B 2RVQD 2F8NH 4NE5A 5B24A 2J8PA 5B1LD 2Y2PA 4KUDD 2Y2HA 2Y2KA 1A7WA 4G92B 3O62B 3AZKA 1P3GD 3W98C 3AZKB 1S32A 3WAAD 5BNVA 5JRGA 2Y2GA 3MGRA 2AROC 5B0YD 1P34A 3W96D 5BNVB 3FDDA 1P34B 3WA9C 4EO5C 3MNND 5B40C 3AZGB 3MVDD 1F66A 3KWQA 3AZJC 3UTBA 1F66B 4WU9A 5G49A 3WTPE 5B33D 3KWQB 3UTBB 4WU9B 4G92C 5G49B 5BT1C 3O62C 4J8XD 3AZND 3LZ1B 4YM6D 4J8UB 3NQJA 4QLCA 3AV2A 3AN2D 5AV5A 5F99A 2F8NK 3AV2B 5CP6D 2YFWA 5JA4A 3WTPD 3AZLC 2W8SA 3AZIA 1KU5A 3W99B 3AZGC 2F2AC 5JA4B 1M18A 1P3AD 4ZUXB 2BYMB 1TZYA 4Z5TA 1M18B 5AV8B 3C1BD 4Z2MG 3REHB 4R8PC 4Z5TB 3AZHB 1HQ3A 4AWLC 4NE6A 3LZ1C 2HIOD 2Y2LA 3X1SC 1HQ3B 4J8UC 3A6NA 2NZDA 4J8WA 3TU4C 5AVCD 3AZFB 2IO5C 3A6NB 2NZDB 4UUZA 3AFAD 1P3LA 1KX3A 3LJAA 1U35B 3B6GD 5B2IA 3MGQA 4H9PA 4UUZB 5GT3D 2BYKA 3W99C 5B31D 3LJAB 1P3IA 1P3LB 1KX3B 5CPKA 4ZUXC 4H9PB 3REJD 2BYKB 4J8VB 3AV1D 4H9OA 1P3ID 5AV8C 5CPKB 1P3PB 3REHC 4WZSB 4H9OB 5AY8D 3AZHC 4KGCA 4Z66A 2FJ7B 4KGCB 5AV6D 3EPJA 1F1EA 3KUYC 1ULYA 2PYOC 4NFTA 3W97D 3AZFC 3UT9C 2YFVA 3A6NC 5B1MD 1U35C 3X1UD 2YFVB 4H9NA 5DNMA
chains in the Genus database with same CATH topology
5AVBD 1PZRA 4X23C 5DNMB 4J8VC 1BH8A 1P3PC 3AZED 5B0ZC 1M1AD 1AOIB 2Y2NA 1P3BA 4H9SA 2VQRA 5B2JA 4LD9C 1P3BB 1P3MC 1ID3B 2FJ7C 5BS7A 2DQNC 3X1VD 1KX5D 2XD1A 5E5AC 5B32D 1HTAA 4H9QA 5GSUD 4H9QB 3REIC 3A1KA 4ZBJB 4KHAA 2NQBC 3EPHA 3WKJB 3REKA 1ZLAD 1P3FD 3UTAC 5AV9D 3VH5T 3REKB 1N1JA 5CPJD 1AOIC 1EQZD 3NQUB 1N1JB 3LELD 1P3KB 1ID3C 5DNND 3MGSB 3W98A 1P3OD 2G5HC 4YS3C 3W98B 4M6BA 2AROA 1M19A 1KX4D 2AROB 4HGAC 2RIQA 3LZ0C 3KXBD 3B6FC 1M19B 3WA9A 5KDMB 3WKJC 4XUJA 5B40A 3WA9B 3A1IA 3EPKA 3REKC 4XUJB 3AZJA 5B40B 4XZQD 3B0CT 3AZJB 3MGPC 2JCHA 1P3KC 5GT0C 5B24D 4WNNA 3O62A 3KSYA 4G91B 3MGSC 4WNNB 3X1TA 3RELC 2Y2QA 3X1TB 3AZKD 5CPIB 3H0RC 1S32D 3AZLA 1M19C 5JRGD 3AZGA 3MGRD 1P34D 3AZLB 4XUJC 2ZY5A 5B1LB 4R8PA 1F66D 3AYWC 3KWQD 3UTBD 4R8PB 4WU9D 4G91C 3R45A 4WU8C 1P3GB 3LZ1A 3X1SA 3R45B 4AWLB 4J8UA 3X1TC 3VH5A 3TU4A 3X1SB 5CPIC 3TU4B 2IO5B 4JJNC 2ZM5A 3W99A 4QLCD 5GXQB 3AV2D 4ZUXA 2BYMA 5F99D 5AV5D 2RVQC 2CV5B 5AV8A 3REHA 5B1LC 3AZID 1M18D 3AZHA 4KUDC 3B0DB 1TZYD 5FUGA 4Z5TD 1P3GC 5FUGB 3KUYA 2PYOA 3AZNB 3AZFA 3UT9A 4YM6B 1HQ3D 3KUYB 3AZMA 2PYOB 5B0YC 3UT9B 1U35A 3AZMB 3W96C 3A6ND 2NZDD 4J8WD 5GXQC 4X23A 1B67A 4J8VA 1P3LD 2ZY3A 3MNNC 2CV5C 3MVDC 3LJAD 1P3PA 5B2ID 3MGQD 5B0ZA 4X23B 1JFIB 2BG1A 5CPKD 5B0ZB 4LD9A 5B33C 3B0DC 1P3MA 4UPKA 4LD9B 2FJ7A 1P3MB 4J8XC 4CAYA 4KGCD 3AZNC 4E44A 5E5AA 4Z66D 4YM6C 3C1CB 4CAYB 1W2EA 2UWXA 5E5AB 1KX3D 3AN2C 3REIA 3AZMC 2F8NA 2NQBA 5CP6C 3WTPC 3REIB 3VH6T 2XD5A 2F8NB 3UTAA 2NQBB 5B31B 1P3AC 2F8NG 3UTAB 5B31G 5DNMD 3REJB 3AV1B 1AOIA 1B6WA 3C1BC 1ID3A 1P3BD 5B2JD 4YS3A 2HIOC 3C1CC 4YS3B 4DRAA 2HUEC 3VH5W 5AVCC 3LZ0A 3B6FA 3AFAC 3WKJA 3B6GC 4HGAB 3LZ0B 3B6FB 5GT3C 5B31C 3V9RA 2LY8A 3REJC 3AV1C 3NQUA 3MGPA 3REKD 1P3KA 5GT0A 3V9RB 1M1AB 3MGPB 3P5JB 2Y2OA 5AY8C 5GT0B 3MGSA 2ZY2A 3RELA 5AV6C 3RELB 1KX5B 3W98D 3W97C 3B0CW 5B1MC 5KDMA 1WWSA 4H9RA 2Y2MA 3X1UC 2AROD 4H9RB 1M19D 5BNXA 5AVBC 5AV9B 3WA9D 4XUJD 5BNXB 5B40D 3AZEC 5CPJB 2CWEA 1M1AC 3AYWA 3LELB 3AZJD 4WJ3C 3AYWB 4WU8A 3VH6A 4WU8B 5BT1D 3O62D 3X1VC 1KX5C 5CPIA 3X1TD 5B32C 5GSUC 4JJNA 1KX4B 3KXBB 4JJNB 1ZLAC 1P3FC 5AV9C 3AZLD 2ZY4A 5B1LA 5CPJC 3AZGD 4XZQB 2JE5A 4KUDA 1EQZC 3LELC 4CSRA 5B24B 4KUDB 1P3GA 3H0LC 4CSRB 4R8PD 5DNNC 1P3OC 3WAAA 3LZ1D 5B0YA 3X1SD 3WAAB 3W96A 4J8UD 1KX4C 3TU4D 5B0YB 5GXQA 5CHLB 1S32B 3KXBC 3W96B 5JRGB 3MNNA 2CV5A 3MGRB 5GXQD 3MVDA 3W99D 3MNNB 4NE3A 3MVDB 3EG5B 4XZQC 2CV5D 4ZUXD 5B33A 5AV8D 5B24C 5B33B 3REHD 3EPLA 2G5IC 4J8XA 3AZHD 3AL0C 5C3IB 3AZNA 1BH9A 4J8XB 4WV4B 4YM6A 3AZKC 1BH9B 3AN2A 3WAAC 3KUYD 2PYOD 5CP6A 3AZFD 3WTPA 3AN2B 3UT9D 1S32C 3B0BA 2DF4C 3AZMD 5JRGC 3NQJB 5CP6B 3WTPB 4QLCB 3MGRC 1U35D 5AV5B 5F99B 2L5AA 1P34C 1P3AA 1R4VA 1JFIA 2YFWB 1P3AB 3C1BA 4X23D 3AZIB 4J8VD 1F66C 3KFUG 1P3PD 3C1BB 5B0ZD 3KWQC 3UTBC 1TZYB 4WU9C 1TAFA 4LD9D 5C3IC 1H3OA 1TAFB 2HIOA 1P3MD 2Y2JA 3C1CA 3VH6W 1H3OB 2FJ7D 2HIOB 5AVCA 3IP4C 3C1CD 3AFAA 2HUEB 5AVCB 5E5AD 4DRBA 3B6GA 5GT3A 5B31A 3AFAB 4QLCC 4J8WB 3AV2C 3B6GB 5AV5C 5F99C 3REID 5GT3B 3REJA 3AV1A 2F8ND 2NQBD 1T3UA 5B2IB 3MGQB 3UTAD 3AZIC 1P3IB 1M18C 5AY8A 1Z2CB 1AOID 1TZYC 4Z5TC 5AY8B 5AV6A 1BFMA 1ID3D 5AV6B 3W97A 4Z66B 4E45A 3H0MC 1HQ3C 4YS3D 5B1MA 3W97B 3X1UA 2NZDC 5B1MB 4J8WC 3X1UB 5AVBA 3LZ0D 3B6FD 1P3LC 3WKJD 1KX3C 3LJAC 5B2IC 5AVBB 3MGQC 4H9NB 3AZEA 1M1AA 1P3IC 3AZEB 5CPKC 1BH8B 3MGPD 1P3KD 5GT0D 4Z2MH 5B2JB 3X1VA 1KX5A 3F6TA 3MGSD 4KGCC 5B32A 4Z66C 3RELD 3X1VB 5GSUA 2FFFB 5BO0A 5B32B 5GSUB 2Y2IA 5B32G 1WWIA 5BO0B 1ZLAA 1P3FA 5AV9A 1ZLAB 1P3FB 5CPJA 4KHAB 5DNMC 1EQZA 3LELA 1Q9CA 1EQZB 5DNNA 3AYWD 1P3BC 4H9SC 5B2JC 1P3OA 5DNNB 4WU8D 1P3OB 2JSSA 1KX4A 5BS7C 3KXBA 5CPID 4ZBJC 4JJND 4DQYB 4XZQA 4EO5B 2RVQD 2F8NH 4NE5A 5B24A 2J8PA 5B1LD 2Y2PA 4KUDD 2Y2HA 2Y2KA 1A7WA 4G92B 3O62B 3AZKA 1P3GD 3W98C 3AZKB 1S32A 3WAAD 5BNVA 5JRGA 2Y2GA 3MGRA 2AROC 5B0YD 1P34A 3W96D 5BNVB 3FDDA 1P34B 3WA9C 4EO5C 3MNND 5B40C 3AZGB 3MVDD 1F66A 3KWQA 3AZJC 3UTBA 1F66B 4WU9A 5G49A 3WTPE 5B33D 3KWQB 3UTBB 4WU9B 4G92C 5G49B 5BT1C 3O62C 4J8XD 3AZND 3LZ1B 4YM6D 4J8UB 3NQJA 4QLCA 3AV2A 3AN2D 5AV5A 5F99A 2F8NK 3AV2B 5CP6D 2YFWA 5JA4A 3WTPD 3AZLC 2W8SA 3AZIA 1KU5A 3W99B 3AZGC 2F2AC 5JA4B 1M18A 1P3AD 4ZUXB 2BYMB 1TZYA 4Z5TA 1M18B 5AV8B 3C1BD 4Z2MG 3REHB 4R8PC 4Z5TB 3AZHB 1HQ3A 4AWLC 4NE6A 3LZ1C 2HIOD 2Y2LA 3X1SC 1HQ3B 4J8UC 3A6NA 2NZDA 4J8WA 3TU4C 5AVCD 3AZFB 2IO5C 3A6NB 2NZDB 4UUZA 3AFAD 1P3LA 1KX3A 3LJAA 1U35B 3B6GD 5B2IA 3MGQA 4H9PA 4UUZB 5GT3D 2BYKA 3W99C 5B31D 3LJAB 1P3IA 1P3LB 1KX3B 5CPKA 4ZUXC 4H9PB 3REJD 2BYKB 4J8VB 3AV1D 4H9OA 1P3ID 5AV8C 5CPKB 1P3PB 3REHC 4WZSB 4H9OB 5AY8D 3AZHC 4KGCA 4Z66A 2FJ7B 4KGCB 5AV6D 3EPJA 1F1EA 3KUYC 1ULYA 2PYOC 4NFTA 3W97D 3AZFC 3UT9C 2YFVA 3A6NC 5B1MD 1U35C 3X1UD 2YFVB 4H9NA 5DNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB D;  4X23 C;  5DNM B;  4J8V C;  1BH8 A;  1P3P C;  3AZE D;  5B0Z C;  1M1A D;  1AOI B;  1P3B A;  4H9S A;  5B2J A;  4LD9 C;  1P3B B;  1P3M C;  1ID3 B;  2FJ7 C;  5BS7 A;  3X1V D;  1KX5 D;  5E5A C;  5B32 D;  4H9Q A;  1HTA A;  5GSU D;  4H9Q B;  3REI C;  4ZBJ B;  4KHA A;  2NQB C;  3WKJ B;  3REK A;  1ZLA D;  1P3F D;  3UTA C;  5AV9 D;  3VH5 T;  3REK B;  1N1J A;  5CPJ D;  1AOI C;  1EQZ D;  3NQU B;  1N1J B;  3LEL D;  1P3K B;  1ID3 C;  5DNN D;  3MGS B;  3W98 A;  1P3O D;  4YS3 C;  3W98 B;  4M6B A;  2ARO A;  1M19 A;  1KX4 D;  2ARO B;  4HGA C;  3LZ0 C;  3B6F C;  3KXB D;  1M19 B;  3WA9 A;  5KDM B;  3WKJ C;  4XUJ A;  5B40 A;  3WA9 B;  3REK C;  4XUJ B;  3AZJ A;  5B40 B;  4XZQ D;  3B0C T;  3AZJ B;  3MGP C;  1P3K C;  5GT0 C;  5B24 D;  4WNN A;  3O62 A;  3KSY A;  4G91 B;  3MGS C;  4WNN B;  3X1T A;  3REL C;  3X1T B;  3AZK D;  5CPI B;  1S32 D;  3AZL A;  1M19 C;  5JRG D;  3AZG A;  3MGR D;  1P34 D;  3AZL B;  4XUJ C;  5B1L B;  4R8P A;  1F66 D;  3AYW C;  3KWQ D;  3UTB D;  4R8P B;  4WU9 D;  4G91 C;  3R45 A;  4WU8 C;  1P3G B;  3LZ1 A;  3X1S A;  3R45 B;  4AWL B;  4J8U A;  3X1T C;  3VH5 A;  3TU4 A;  3X1S B;  5CPI C;  3TU4 B;  2IO5 B;  4JJN C;  3W99 A;  4QLC D;  5GXQ B;  3AV2 D;  4ZUX A;  2BYM A;  5F99 D;  5AV5 D;  2RVQ C;  2CV5 B;  5AV8 A;  3REH A;  5B1L C;  3AZI D;  1M18 D;  3AZH A;  4KUD C;  3B0D B;  1TZY D;  5FUG A;  4Z5T D;  1P3G C;  5FUG B;  3KUY A;  2PYO A;  3AZN B;  3AZF A;  3UT9 A;  4YM6 B;  1HQ3 D;  3KUY B;  3AZM A;  2PYO B;  5B0Y C;  3UT9 B;  1U35 A;  3AZM B;  3W96 C;  3A6N D;  2NZD D;  4J8W D;  5GXQ C;  4X23 A;  1B67 A;  4J8V A;  1P3L D;  3MNN C;  2CV5 C;  1KX3 D;  3MVD C;  3LJA D;  1P3P A;  5B2I D;  3MGQ D;  5B0Z A;  4X23 B;  1JFI B;  5CPK D;  5B0Z B;  4LD9 A;  5B33 C;  3B0D C;  1P3M A;  4LD9 B;  2FJ7 A;  1P3M B;  4J8X C;  4CAY A;  4KGC D;  3AZN C;  4E44 A;  5E5A A;  4Z66 D;  4YM6 C;  3C1C B;  4CAY B;  5E5A B;  3AN2 C;  3REI A;  3AZM C;  2F8N A;  2NQB A;  5CP6 C;  3WTP C;  3REI B;  3VH6 T;  2F8N B;  3UTA A;  2NQB B;  5B31 B;  1P3A C;  2F8N G;  3UTA B;  5B31 G;  5DNM D;  3REJ B;  3AV1 B;  1AOI A;  1B6W A;  3C1B C;  1ID3 A;  1P3B D;  5B2J D;  4YS3 A;  2HIO C;  3C1C C;  4YS3 B;  4DRA A;  2HUE C;  3VH5 W;  5AVC C;  3LZ0 A;  3B6F A;  3AFA C;  3WKJ A;  3B6G C;  4HGA B;  3LZ0 B;  3B6F B;  5GT3 C;  5B31 C;  3V9R A;  2LY8 A;  3REJ C;  3AV1 C;  3NQU A;  3MGP A;  3REK D;  1P3K A;  5GT0 A;  3V9R B;  1M1A B;  3MGP B;  5GT0 B;  5AY8 C;  3MGS A;  3REL A;  5AV6 C;  3REL B;  1KX5 B;  3W98 D;  3W97 C;  3B0C W;  5B1M C;  1WWS A;  4H9R A;  5KDM A;  3X1U C;  2ARO D;  4H9R B;  1M19 D;  5BNX A;  5AVB C;  5AV9 B;  3WA9 D;  4XUJ D;  5BNX B;  5B40 D;  3AZE C;  5CPJ B;  2CWE A;  1M1A C;  3AYW A;  3LEL B;  3AZJ D;  3AYW B;  4WU8 A;  3VH6 A;  4WU8 B;  5BT1 D;  3O62 D;  3X1V C;  1KX5 C;  5CPI A;  3X1T D;  5B32 C;  5GSU C;  4JJN A;  1KX4 B;  3KXB B;  4JJN B;  1ZLA C;  1P3F C;  5AV9 C;  3AZL D;  5B1L A;  5CPJ C;  3AZG D;  4XZQ B;  4KUD A;  1EQZ C;  3LEL C;  4CSR A;  5B24 B;  4KUD B;  1P3G A;  4CSR B;  4R8P D;  5DNN C;  1P3O C;  3WAA A;  3LZ1 D;  5B0Y A;  3X1S D;  3WAA B;  3W96 A;  4J8U D;  1KX4 C;  3TU4 D;  5B0Y B;  5GXQ A;  5CHL B;  1S32 B;  3KXB C;  3W96 B;  5JRG B;  3MNN A;  2CV5 A;  3MGR B;  5GXQ D;  3MVD A;  3W99 D;  3MNN B;  4NE3 A;  3MVD B;  4XZQ C;  2CV5 D;  4ZUX D;  5B33 A;  5AV8 D;  5B24 C;  5B33 B;  3REH D;  4J8X A;  3AZH D;  5C3I B;  3AZN A;  1BH9 A;  4J8X B;  4WV4 B;  4YM6 A;  3AZK C;  1BH9 B;  3AN2 A;  3WAA C;  3KUY D;  2PYO D;  5CP6 A;  3AZF D;  3WTP A;  3AN2 B;  3UT9 D;  1S32 C;  3B0B A;  3AZM D;  5JRG C;  3NQJ B;  5CP6 B;  3WTP B;  4QLC B;  3MGR C;  1U35 D;  5AV5 B;  5F99 B;  2L5A A;  1P34 C;  1P3A A;  1R4V A;  1JFI A;  2YFW B;  1P3A B;  3C1B A;  4X23 D;  3AZI B;  4J8V D;  1F66 C;  1P3P D;  3C1B B;  5B0Z D;  3KWQ C;  3UTB C;  1TZY B;  4WU9 C;  1TAF A;  4LD9 D;  5C3I C;  1H3O A;  1TAF B;  2HIO A;  1P3M D;  3C1C A;  3VH6 W;  1H3O B;  2FJ7 D;  2HIO B;  5AVC A;  3C1C D;  3AFA A;  2HUE B;  5AVC B;  5E5A D;  4DRB A;  3B6G A;  5GT3 A;  5B31 A;  3AFA B;  4QLC C;  4J8W B;  3AV2 C;  3B6G B;  5AV5 C;  5F99 C;  3REI D;  5GT3 B;  3REJ A;  3AV1 A;  2F8N D;  2NQB D;  5B2I B;  3MGQ B;  3UTA D;  3AZI C;  1P3I B;  1M18 C;  5AY8 A;  1AOI D;  1TZY C;  4Z5T C;  5AY8 B;  5AV6 A;  1BFM A;  1ID3 D;  5AV6 B;  3W97 A;  4Z66 B;  4E45 A;  1HQ3 C;  4YS3 D;  5B1M A;  3W97 B;  3X1U A;  2NZD C;  5B1M B;  4J8W C;  3X1U B;  5AVB A;  3LZ0 D;  3B6F D;  1P3L C;  3WKJ D;  1KX3 C;  3LJA C;  5B2I C;  5AVB B;  3MGQ C;  4H9N B;  3AZE A;  1M1A A;  1P3I C;  3AZE B;  5CPK C;  1BH8 B;  3MGP D;  1P3K D;  5GT0 D;  4Z2M H;  5B2J B;  3X1V A;  1KX5 A;  3MGS D;  4KGC C;  5B32 A;  4Z66 C;  3REL D;  3X1V B;  5GSU A;  5BO0 A;  5B32 B;  5GSU B;  5BO0 B;  1WWI A;  5B32 G;  1ZLA A;  1P3F A;  5AV9 A;  1ZLA B;  1P3F B;  5CPJ A;  4KHA B;  5DNM C;  1EQZ A;  3LEL A;  1Q9C A;  1EQZ B;  5DNN A;  3AYW D;  1P3B C;  4H9S C;  5B2J C;  1P3O A;  5DNN B;  4WU8 D;  1P3O B;  2JSS A;  1KX4 A;  5BS7 C;  3KXB A;  5CPI D;  4ZBJ C;  4JJN D;  4XZQ A;  4EO5 B;  2RVQ D;  2F8N H;  4NE5 A;  5B24 A;  5B1L D;  4KUD D;  1A7W A;  4G92 B;  3O62 B;  3AZK A;  1P3G D;  3W98 C;  3AZK B;  1S32 A;  3WAA D;  5BNV A;  5JRG A;  3MGR A;  2ARO C;  5B0Y D;  1P34 A;  3W96 D;  5BNV B;  1P34 B;  3WA9 C;  4EO5 C;  3MNN D;  5B40 C;  3AZG B;  3MVD D;  1F66 A;  3KWQ A;  3AZJ C;  3UTB A;  1F66 B;  4WU9 A;  5G49 A;  3WTP E;  5B33 D;  3KWQ B;  3UTB B;  4WU9 B;  4G92 C;  5G49 B;  5BT1 C;  3O62 C;  4J8X D;  3AZN D;  3LZ1 B;  4YM6 D;  4J8U B;  3NQJ A;  4QLC A;  3AV2 A;  3AN2 D;  5AV5 A;  5F99 A;  2F8N K;  3AV2 B;  5CP6 D;  2YFW A;  5JA4 A;  3WTP D;  3AZL C;  3AZI A;  1KU5 A;  3W99 B;  3AZG C;  5JA4 B;  1M18 A;  1P3A D;  4ZUX B;  2BYM B;  1TZY A;  4Z5T A;  1M18 B;  5AV8 B;  3C1B D;  4Z2M G;  3REH B;  4R8P C;  4Z5T B;  3AZH B;  1HQ3 A;  4AWL C;  4NE6 A;  3LZ1 C;  2HIO D;  3X1S C;  1HQ3 B;  4J8U C;  3A6N A;  2NZD A;  4J8W A;  3TU4 C;  5AVC D;  3AZF B;  2IO5 C;  3A6N B;  2NZD B;  4UUZ A;  3AFA D;  1P3L A;  1KX3 A;  3LJA A;  1U35 B;  3B6G D;  5B2I A;  3MGQ A;  4H9P A;  4UUZ B;  5GT3 D;  2BYK A;  3W99 C;  5B31 D;  3LJA B;  1P3I A;  1P3L B;  1KX3 B;  5CPK A;  4ZUX C;  4H9P B;  3REJ D;  2BYK B;  4J8V B;  3AV1 D;  4H9O A;  1P3I D;  5AV8 C;  5CPK B;  1P3P B;  3REH C;  4WZS B;  4H9O B;  5AY8 D;  3AZH C;  4KGC A;  4Z66 A;  2FJ7 B;  4KGC B;  5AV6 D;  1F1E A;  3KUY C;  1ULY A;  2PYO C;  4NFT A;  3W97 D;  3AZF C;  3UT9 C;  2YFV A;  3A6N C;  5B1M D;  1U35 C;  3X1U D;  2YFV B;  4H9N A;  5DNM A; 
#chains in the Genus database with same CATH topology
 5AVB D;  1PZR A;  4X23 C;  5DNM B;  4J8V C;  1BH8 A;  1P3P C;  3AZE D;  5B0Z C;  1M1A D;  1AOI B;  2Y2N A;  1P3B A;  4H9S A;  2VQR A;  5B2J A;  4LD9 C;  1P3B B;  1P3M C;  1ID3 B;  2FJ7 C;  5BS7 A;  2DQN C;  3X1V D;  1KX5 D;  2XD1 A;  5E5A C;  5B32 D;  1HTA A;  4H9Q A;  5GSU D;  4H9Q B;  3REI C;  3A1K A;  4ZBJ B;  4KHA A;  2NQB C;  3EPH A;  3WKJ B;  3REK A;  1ZLA D;  1P3F D;  3UTA C;  5AV9 D;  3VH5 T;  3REK B;  1N1J A;  5CPJ D;  1AOI C;  1EQZ D;  3NQU B;  1N1J B;  3LEL D;  1P3K B;  1ID3 C;  5DNN D;  3MGS B;  3W98 A;  1P3O D;  2G5H C;  4YS3 C;  3W98 B;  4M6B A;  2ARO A;  1M19 A;  1KX4 D;  2ARO B;  4HGA C;  2RIQ A;  3LZ0 C;  3KXB D;  3B6F C;  1M19 B;  3WA9 A;  5KDM B;  3WKJ C;  4XUJ A;  5B40 A;  3WA9 B;  3A1I A;  3EPK A;  3REK C;  4XUJ B;  3AZJ A;  5B40 B;  4XZQ D;  3B0C T;  3AZJ B;  3MGP C;  2JCH A;  1P3K C;  5GT0 C;  5B24 D;  4WNN A;  3O62 A;  3KSY A;  4G91 B;  3MGS C;  4WNN B;  3X1T A;  3REL C;  2Y2Q A;  3X1T B;  3AZK D;  5CPI B;  3H0R C;  1S32 D;  3AZL A;  1M19 C;  5JRG D;  3AZG A;  3MGR D;  1P34 D;  3AZL B;  4XUJ C;  2ZY5 A;  5B1L B;  4R8P A;  1F66 D;  3AYW C;  3KWQ D;  3UTB D;  4R8P B;  4WU9 D;  4G91 C;  3R45 A;  4WU8 C;  1P3G B;  3LZ1 A;  3X1S A;  3R45 B;  4AWL B;  4J8U A;  3X1T C;  3VH5 A;  3TU4 A;  3X1S B;  5CPI C;  3TU4 B;  2IO5 B;  4JJN C;  2ZM5 A;  3W99 A;  4QLC D;  5GXQ B;  3AV2 D;  4ZUX A;  2BYM A;  5F99 D;  5AV5 D;  2RVQ C;  2CV5 B;  5AV8 A;  3REH A;  5B1L C;  3AZI D;  1M18 D;  3AZH A;  4KUD C;  3B0D B;  1TZY D;  5FUG A;  4Z5T D;  1P3G C;  5FUG B;  3KUY A;  2PYO A;  3AZN B;  3AZF A;  3UT9 A;  4YM6 B;  1HQ3 D;  3KUY B;  3AZM A;  2PYO B;  5B0Y C;  3UT9 B;  1U35 A;  3AZM B;  3W96 C;  3A6N D;  2NZD D;  4J8W D;  5GXQ C;  4X23 A;  1B67 A;  4J8V A;  1P3L D;  2ZY3 A;  3MNN C;  2CV5 C;  3MVD C;  3LJA D;  1P3P A;  5B2I D;  3MGQ D;  5B0Z A;  4X23 B;  1JFI B;  2BG1 A;  5CPK D;  5B0Z B;  4LD9 A;  5B33 C;  3B0D C;  1P3M A;  4UPK A;  4LD9 B;  2FJ7 A;  1P3M B;  4J8X C;  4CAY A;  4KGC D;  3AZN C;  4E44 A;  5E5A A;  4Z66 D;  4YM6 C;  3C1C B;  4CAY B;  1W2E A;  2UWX A;  5E5A B;  1KX3 D;  3AN2 C;  3REI A;  3AZM C;  2F8N A;  2NQB A;  5CP6 C;  3WTP C;  3REI B;  3VH6 T;  2XD5 A;  2F8N B;  3UTA A;  2NQB B;  5B31 B;  1P3A C;  2F8N G;  3UTA B;  5B31 G;  5DNM D;  3REJ B;  3AV1 B;  1AOI A;  1B6W A;  3C1B C;  1ID3 A;  1P3B D;  5B2J D;  4YS3 A;  2HIO C;  3C1C C;  4YS3 B;  4DRA A;  2HUE C;  3VH5 W;  5AVC C;  3LZ0 A;  3B6F A;  3AFA C;  3WKJ A;  3B6G C;  4HGA B;  3LZ0 B;  3B6F B;  5GT3 C;  5B31 C;  3V9R A;  2LY8 A;  3REJ C;  3AV1 C;  3NQU A;  3MGP A;  3REK D;  1P3K A;  5GT0 A;  3V9R B;  1M1A B;  3MGP B;  3P5J B;  2Y2O A;  5AY8 C;  5GT0 B;  3MGS A;  2ZY2 A;  3REL A;  5AV6 C;  3REL B;  1KX5 B;  3W98 D;  3W97 C;  3B0C W;  5B1M C;  5KDM A;  1WWS A;  4H9R A;  2Y2M A;  3X1U C;  2ARO D;  4H9R B;  1M19 D;  5BNX A;  5AVB C;  5AV9 B;  3WA9 D;  4XUJ D;  5BNX B;  5B40 D;  3AZE C;  5CPJ B;  2CWE A;  1M1A C;  3AYW A;  3LEL B;  3AZJ D;  4WJ3 C;  3AYW B;  4WU8 A;  3VH6 A;  4WU8 B;  5BT1 D;  3O62 D;  3X1V C;  1KX5 C;  5CPI A;  3X1T D;  5B32 C;  5GSU C;  4JJN A;  1KX4 B;  3KXB B;  4JJN B;  1ZLA C;  1P3F C;  5AV9 C;  3AZL D;  2ZY4 A;  5B1L A;  5CPJ C;  3AZG D;  4XZQ B;  2JE5 A;  4KUD A;  1EQZ C;  3LEL C;  4CSR A;  5B24 B;  4KUD B;  1P3G A;  3H0L C;  4CSR B;  4R8P D;  5DNN C;  1P3O C;  3WAA A;  3LZ1 D;  5B0Y A;  3X1S D;  3WAA B;  3W96 A;  4J8U D;  1KX4 C;  3TU4 D;  5B0Y B;  5GXQ A;  5CHL B;  1S32 B;  3KXB C;  3W96 B;  5JRG B;  3MNN A;  2CV5 A;  3MGR B;  5GXQ D;  3MVD A;  3W99 D;  3MNN B;  4NE3 A;  3MVD B;  3EG5 B;  4XZQ C;  2CV5 D;  4ZUX D;  5B33 A;  5AV8 D;  5B24 C;  5B33 B;  3REH D;  3EPL A;  2G5I C;  4J8X A;  3AZH D;  3AL0 C;  5C3I B;  3AZN A;  1BH9 A;  4J8X B;  4WV4 B;  4YM6 A;  3AZK C;  1BH9 B;  3AN2 A;  3WAA C;  3KUY D;  2PYO D;  5CP6 A;  3AZF D;  3WTP A;  3AN2 B;  3UT9 D;  1S32 C;  3B0B A;  2DF4 C;  3AZM D;  5JRG C;  3NQJ B;  5CP6 B;  3WTP B;  4QLC B;  3MGR C;  1U35 D;  5AV5 B;  5F99 B;  2L5A A;  1P34 C;  1P3A A;  1R4V A;  1JFI A;  2YFW B;  1P3A B;  3C1B A;  4X23 D;  3AZI B;  4J8V D;  1F66 C;  3KFU G;  1P3P D;  3C1B B;  5B0Z D;  3KWQ C;  3UTB C;  1TZY B;  4WU9 C;  1TAF A;  4LD9 D;  5C3I C;  1H3O A;  1TAF B;  2HIO A;  1P3M D;  2Y2J A;  3C1C A;  3VH6 W;  1H3O B;  2FJ7 D;  2HIO B;  5AVC A;  3IP4 C;  3C1C D;  3AFA A;  2HUE B;  5AVC B;  5E5A D;  4DRB A;  3B6G A;  5GT3 A;  5B31 A;  3AFA B;  4QLC C;  4J8W B;  3AV2 C;  3B6G B;  5AV5 C;  5F99 C;  3REI D;  5GT3 B;  3REJ A;  3AV1 A;  2F8N D;  2NQB D;  1T3U A;  5B2I B;  3MGQ B;  3UTA D;  3AZI C;  1P3I B;  1M18 C;  5AY8 A;  1Z2C B;  1AOI D;  1TZY C;  4Z5T C;  5AY8 B;  5AV6 A;  1BFM A;  1ID3 D;  5AV6 B;  3W97 A;  4Z66 B;  4E45 A;  3H0M C;  1HQ3 C;  4YS3 D;  5B1M A;  3W97 B;  3X1U A;  2NZD C;  5B1M B;  4J8W C;  3X1U B;  5AVB A;  3LZ0 D;  3B6F D;  1P3L C;  3WKJ D;  1KX3 C;  3LJA C;  5B2I C;  5AVB B;  3MGQ C;  4H9N B;  3AZE A;  1M1A A;  1P3I C;  3AZE B;  5CPK C;  1BH8 B;  3MGP D;  1P3K D;  5GT0 D;  4Z2M H;  5B2J B;  3X1V A;  1KX5 A;  3F6T A;  3MGS D;  4KGC C;  5B32 A;  4Z66 C;  3REL D;  3X1V B;  5GSU A;  2FFF B;  5BO0 A;  5B32 B;  5GSU B;  2Y2I A;  5B32 G;  1WWI A;  5BO0 B;  1ZLA A;  1P3F A;  5AV9 A;  1ZLA B;  1P3F B;  5CPJ A;  4KHA B;  5DNM C;  1EQZ A;  3LEL A;  1Q9C A;  1EQZ B;  5DNN A;  3AYW D;  1P3B C;  4H9S C;  5B2J C;  1P3O A;  5DNN B;  4WU8 D;  1P3O B;  2JSS A;  1KX4 A;  5BS7 C;  3KXB A;  5CPI D;  4ZBJ C;  4JJN D;  4DQY B;  4XZQ A;  4EO5 B;  2RVQ D;  2F8N H;  4NE5 A;  5B24 A;  2J8P A;  5B1L D;  2Y2P A;  4KUD D;  2Y2H A;  2Y2K A;  1A7W A;  4G92 B;  3O62 B;  3AZK A;  1P3G D;  3W98 C;  3AZK B;  1S32 A;  3WAA D;  5BNV A;  5JRG A;  2Y2G A;  3MGR A;  2ARO C;  5B0Y D;  1P34 A;  3W96 D;  5BNV B;  3FDD A;  1P34 B;  3WA9 C;  4EO5 C;  3MNN D;  5B40 C;  3AZG B;  3MVD D;  1F66 A;  3KWQ A;  3AZJ C;  3UTB A;  1F66 B;  4WU9 A;  5G49 A;  3WTP E;  5B33 D;  3KWQ B;  3UTB B;  4WU9 B;  4G92 C;  5G49 B;  5BT1 C;  3O62 C;  4J8X D;  3AZN D;  3LZ1 B;  4YM6 D;  4J8U B;  3NQJ A;  4QLC A;  3AV2 A;  3AN2 D;  5AV5 A;  5F99 A;  2F8N K;  3AV2 B;  5CP6 D;  2YFW A;  5JA4 A;  3WTP D;  3AZL C;  2W8S A;  3AZI A;  1KU5 A;  3W99 B;  3AZG C;  2F2A C;  5JA4 B;  1M18 A;  1P3A D;  4ZUX B;  2BYM B;  1TZY A;  4Z5T A;  1M18 B;  5AV8 B;  3C1B D;  4Z2M G;  3REH B;  4R8P C;  4Z5T B;  3AZH B;  1HQ3 A;  4AWL C;  4NE6 A;  3LZ1 C;  2HIO D;  2Y2L A;  3X1S C;  1HQ3 B;  4J8U C;  3A6N A;  2NZD A;  4J8W A;  3TU4 C;  5AVC D;  3AZF B;  2IO5 C;  3A6N B;  2NZD B;  4UUZ A;  3AFA D;  1P3L A;  1KX3 A;  3LJA A;  1U35 B;  3B6G D;  5B2I A;  3MGQ A;  4H9P A;  4UUZ B;  5GT3 D;  2BYK A;  3W99 C;  5B31 D;  3LJA B;  1P3I A;  1P3L B;  1KX3 B;  5CPK A;  4ZUX C;  4H9P B;  3REJ D;  2BYK B;  4J8V B;  3AV1 D;  4H9O A;  1P3I D;  5AV8 C;  5CPK B;  1P3P B;  3REH C;  4WZS B;  4H9O B;  5AY8 D;  3AZH C;  4KGC A;  4Z66 A;  2FJ7 B;  4KGC B;  5AV6 D;  3EPJ A;  1F1E A;  3KUY C;  1ULY A;  2PYO C;  4NFT A;  3W97 D;  3AZF C;  3UT9 C;  2YFV A;  3A6N C;  5B1M D;  1U35 C;  3X1U D;  2YFV B;  4H9N A;  5DNM A; 
#chains in the Genus database with same CATH homology
 5AVB D;  1PZR A;  4X23 C;  5DNM B;  4J8V C;  1BH8 A;  1P3P C;  3AZE D;  5B0Z C;  1M1A D;  1AOI B;  2Y2N A;  1P3B A;  4H9S A;  2VQR A;  5B2J A;  4LD9 C;  1P3B B;  1P3M C;  1ID3 B;  2FJ7 C;  5BS7 A;  2DQN C;  3X1V D;  1KX5 D;  2XD1 A;  5E5A C;  5B32 D;  1HTA A;  4H9Q A;  5GSU D;  4H9Q B;  3REI C;  3A1K A;  4ZBJ B;  4KHA A;  2NQB C;  3EPH A;  3WKJ B;  3REK A;  1ZLA D;  1P3F D;  3UTA C;  5AV9 D;  3VH5 T;  3REK B;  1N1J A;  5CPJ D;  1AOI C;  1EQZ D;  3NQU B;  1N1J B;  3LEL D;  1P3K B;  1ID3 C;  5DNN D;  3MGS B;  3W98 A;  1P3O D;  2G5H C;  4YS3 C;  3W98 B;  4M6B A;  2ARO A;  1M19 A;  1KX4 D;  2ARO B;  4HGA C;  2RIQ A;  3LZ0 C;  3KXB D;  3B6F C;  1M19 B;  3WA9 A;  5KDM B;  3WKJ C;  4XUJ A;  5B40 A;  3WA9 B;  3A1I A;  3EPK A;  3REK C;  4XUJ B;  3AZJ A;  5B40 B;  4XZQ D;  3B0C T;  3AZJ B;  3MGP C;  2JCH A;  1P3K C;  5GT0 C;  5B24 D;  4WNN A;  3O62 A;  3KSY A;  4G91 B;  3MGS C;  4WNN B;  3X1T A;  3REL C;  2Y2Q A;  3X1T B;  3AZK D;  5CPI B;  3H0R C;  1S32 D;  3AZL A;  1M19 C;  5JRG D;  3AZG A;  3MGR D;  1P34 D;  3AZL B;  4XUJ C;  2ZY5 A;  5B1L B;  4R8P A;  1F66 D;  3AYW C;  3KWQ D;  3UTB D;  4R8P B;  4WU9 D;  4G91 C;  3R45 A;  4WU8 C;  1P3G B;  3LZ1 A;  3X1S A;  3R45 B;  4AWL B;  4J8U A;  3X1T C;  3VH5 A;  3TU4 A;  3X1S B;  5CPI C;  3TU4 B;  2IO5 B;  4JJN C;  2ZM5 A;  3W99 A;  4QLC D;  5GXQ B;  3AV2 D;  4ZUX A;  2BYM A;  5F99 D;  5AV5 D;  2RVQ C;  2CV5 B;  5AV8 A;  3REH A;  5B1L C;  3AZI D;  1M18 D;  3AZH A;  4KUD C;  3B0D B;  1TZY D;  5FUG A;  4Z5T D;  1P3G C;  5FUG B;  3KUY A;  2PYO A;  3AZN B;  3AZF A;  3UT9 A;  4YM6 B;  1HQ3 D;  3KUY B;  3AZM A;  2PYO B;  5B0Y C;  3UT9 B;  1U35 A;  3AZM B;  3W96 C;  3A6N D;  2NZD D;  4J8W D;  5GXQ C;  4X23 A;  1B67 A;  4J8V A;  1P3L D;  2ZY3 A;  3MNN C;  2CV5 C;  3MVD C;  3LJA D;  1P3P A;  5B2I D;  3MGQ D;  5B0Z A;  4X23 B;  1JFI B;  2BG1 A;  5CPK D;  5B0Z B;  4LD9 A;  5B33 C;  3B0D C;  1P3M A;  4UPK A;  4LD9 B;  2FJ7 A;  1P3M B;  4J8X C;  4CAY A;  4KGC D;  3AZN C;  4E44 A;  5E5A A;  4Z66 D;  4YM6 C;  3C1C B;  4CAY B;  1W2E A;  2UWX A;  5E5A B;  1KX3 D;  3AN2 C;  3REI A;  3AZM C;  2F8N A;  2NQB A;  5CP6 C;  3WTP C;  3REI B;  3VH6 T;  2XD5 A;  2F8N B;  3UTA A;  2NQB B;  5B31 B;  1P3A C;  2F8N G;  3UTA B;  5B31 G;  5DNM D;  3REJ B;  3AV1 B;  1AOI A;  1B6W A;  3C1B C;  1ID3 A;  1P3B D;  5B2J D;  4YS3 A;  2HIO C;  3C1C C;  4YS3 B;  4DRA A;  2HUE C;  3VH5 W;  5AVC C;  3LZ0 A;  3B6F A;  3AFA C;  3WKJ A;  3B6G C;  4HGA B;  3LZ0 B;  3B6F B;  5GT3 C;  5B31 C;  3V9R A;  2LY8 A;  3REJ C;  3AV1 C;  3NQU A;  3MGP A;  3REK D;  1P3K A;  5GT0 A;  3V9R B;  1M1A B;  3MGP B;  3P5J B;  2Y2O A;  5AY8 C;  5GT0 B;  3MGS A;  2ZY2 A;  3REL A;  5AV6 C;  3REL B;  1KX5 B;  3W98 D;  3W97 C;  3B0C W;  5B1M C;  5KDM A;  1WWS A;  4H9R A;  2Y2M A;  3X1U C;  2ARO D;  4H9R B;  1M19 D;  5BNX A;  5AVB C;  5AV9 B;  3WA9 D;  4XUJ D;  5BNX B;  5B40 D;  3AZE C;  5CPJ B;  2CWE A;  1M1A C;  3AYW A;  3LEL B;  3AZJ D;  4WJ3 C;  3AYW B;  4WU8 A;  3VH6 A;  4WU8 B;  5BT1 D;  3O62 D;  3X1V C;  1KX5 C;  5CPI A;  3X1T D;  5B32 C;  5GSU C;  4JJN A;  1KX4 B;  3KXB B;  4JJN B;  1ZLA C;  1P3F C;  5AV9 C;  3AZL D;  2ZY4 A;  5B1L A;  5CPJ C;  3AZG D;  4XZQ B;  2JE5 A;  4KUD A;  1EQZ C;  3LEL C;  4CSR A;  5B24 B;  4KUD B;  1P3G A;  3H0L C;  4CSR B;  4R8P D;  5DNN C;  1P3O C;  3WAA A;  3LZ1 D;  5B0Y A;  3X1S D;  3WAA B;  3W96 A;  4J8U D;  1KX4 C;  3TU4 D;  5B0Y B;  5GXQ A;  5CHL B;  1S32 B;  3KXB C;  3W96 B;  5JRG B;  3MNN A;  2CV5 A;  3MGR B;  5GXQ D;  3MVD A;  3W99 D;  3MNN B;  4NE3 A;  3MVD B;  3EG5 B;  4XZQ C;  2CV5 D;  4ZUX D;  5B33 A;  5AV8 D;  5B24 C;  5B33 B;  3REH D;  3EPL A;  2G5I C;  4J8X A;  3AZH D;  3AL0 C;  5C3I B;  3AZN A;  1BH9 A;  4J8X B;  4WV4 B;  4YM6 A;  3AZK C;  1BH9 B;  3AN2 A;  3WAA C;  3KUY D;  2PYO D;  5CP6 A;  3AZF D;  3WTP A;  3AN2 B;  3UT9 D;  1S32 C;  3B0B A;  2DF4 C;  3AZM D;  5JRG C;  3NQJ B;  5CP6 B;  3WTP B;  4QLC B;  3MGR C;  1U35 D;  5AV5 B;  5F99 B;  2L5A A;  1P34 C;  1P3A A;  1R4V A;  1JFI A;  2YFW B;  1P3A B;  3C1B A;  4X23 D;  3AZI B;  4J8V D;  1F66 C;  3KFU G;  1P3P D;  3C1B B;  5B0Z D;  3KWQ C;  3UTB C;  1TZY B;  4WU9 C;  1TAF A;  4LD9 D;  5C3I C;  1H3O A;  1TAF B;  2HIO A;  1P3M D;  2Y2J A;  3C1C A;  3VH6 W;  1H3O B;  2FJ7 D;  2HIO B;  5AVC A;  3IP4 C;  3C1C D;  3AFA A;  2HUE B;  5AVC B;  5E5A D;  4DRB A;  3B6G A;  5GT3 A;  5B31 A;  3AFA B;  4QLC C;  4J8W B;  3AV2 C;  3B6G B;  5AV5 C;  5F99 C;  3REI D;  5GT3 B;  3REJ A;  3AV1 A;  2F8N D;  2NQB D;  1T3U A;  5B2I B;  3MGQ B;  3UTA D;  3AZI C;  1P3I B;  1M18 C;  5AY8 A;  1Z2C B;  1AOI D;  1TZY C;  4Z5T C;  5AY8 B;  5AV6 A;  1BFM A;  1ID3 D;  5AV6 B;  3W97 A;  4Z66 B;  4E45 A;  3H0M C;  1HQ3 C;  4YS3 D;  5B1M A;  3W97 B;  3X1U A;  2NZD C;  5B1M B;  4J8W C;  3X1U B;  5AVB A;  3LZ0 D;  3B6F D;  1P3L C;  3WKJ D;  1KX3 C;  3LJA C;  5B2I C;  5AVB B;  3MGQ C;  4H9N B;  3AZE A;  1M1A A;  1P3I C;  3AZE B;  5CPK C;  1BH8 B;  3MGP D;  1P3K D;  5GT0 D;  4Z2M H;  5B2J B;  3X1V A;  1KX5 A;  3F6T A;  3MGS D;  4KGC C;  5B32 A;  4Z66 C;  3REL D;  3X1V B;  5GSU A;  2FFF B;  5BO0 A;  5B32 B;  5GSU B;  2Y2I A;  5B32 G;  1WWI A;  5BO0 B;  1ZLA A;  1P3F A;  5AV9 A;  1ZLA B;  1P3F B;  5CPJ A;  4KHA B;  5DNM C;  1EQZ A;  3LEL A;  1Q9C A;  1EQZ B;  5DNN A;  3AYW D;  1P3B C;  4H9S C;  5B2J C;  1P3O A;  5DNN B;  4WU8 D;  1P3O B;  2JSS A;  1KX4 A;  5BS7 C;  3KXB A;  5CPI D;  4ZBJ C;  4JJN D;  4DQY B;  4XZQ A;  4EO5 B;  2RVQ D;  2F8N H;  4NE5 A;  5B24 A;  2J8P A;  5B1L D;  2Y2P A;  4KUD D;  2Y2H A;  2Y2K A;  1A7W A;  4G92 B;  3O62 B;  3AZK A;  1P3G D;  3W98 C;  3AZK B;  1S32 A;  3WAA D;  5BNV A;  5JRG A;  2Y2G A;  3MGR A;  2ARO C;  5B0Y D;  1P34 A;  3W96 D;  5BNV B;  3FDD A;  1P34 B;  3WA9 C;  4EO5 C;  3MNN D;  5B40 C;  3AZG B;  3MVD D;  1F66 A;  3KWQ A;  3AZJ C;  3UTB A;  1F66 B;  4WU9 A;  5G49 A;  3WTP E;  5B33 D;  3KWQ B;  3UTB B;  4WU9 B;  4G92 C;  5G49 B;  5BT1 C;  3O62 C;  4J8X D;  3AZN D;  3LZ1 B;  4YM6 D;  4J8U B;  3NQJ A;  4QLC A;  3AV2 A;  3AN2 D;  5AV5 A;  5F99 A;  2F8N K;  3AV2 B;  5CP6 D;  2YFW A;  5JA4 A;  3WTP D;  3AZL C;  2W8S A;  3AZI A;  1KU5 A;  3W99 B;  3AZG C;  2F2A C;  5JA4 B;  1M18 A;  1P3A D;  4ZUX B;  2BYM B;  1TZY A;  4Z5T A;  1M18 B;  5AV8 B;  3C1B D;  4Z2M G;  3REH B;  4R8P C;  4Z5T B;  3AZH B;  1HQ3 A;  4AWL C;  4NE6 A;  3LZ1 C;  2HIO D;  2Y2L A;  3X1S C;  1HQ3 B;  4J8U C;  3A6N A;  2NZD A;  4J8W A;  3TU4 C;  5AVC D;  3AZF B;  2IO5 C;  3A6N B;  2NZD B;  4UUZ A;  3AFA D;  1P3L A;  1KX3 A;  3LJA A;  1U35 B;  3B6G D;  5B2I A;  3MGQ A;  4H9P A;  4UUZ B;  5GT3 D;  2BYK A;  3W99 C;  5B31 D;  3LJA B;  1P3I A;  1P3L B;  1KX3 B;  5CPK A;  4ZUX C;  4H9P B;  3REJ D;  2BYK B;  4J8V B;  3AV1 D;  4H9O A;  1P3I D;  5AV8 C;  5CPK B;  1P3P B;  3REH C;  4WZS B;  4H9O B;  5AY8 D;  3AZH C;  4KGC A;  4Z66 A;  2FJ7 B;  4KGC B;  5AV6 D;  3EPJ A;  1F1E A;  3KUY C;  1ULY A;  2PYO C;  4NFT A;  3W97 D;  3AZF C;  3UT9 C;  2YFV A;  3A6N C;  5B1M D;  1U35 C;  3X1U D;  2YFV B;  4H9N A;  5DNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...