3REID

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiD00
5B2IA 5CP6C 3REIB 5DNMA 5JRGB 2AROD 1KX5D 1AOIA 2PYOA 3UT9D 3AZKC 1M18B 1U35A 1WWSA 5AV6A 5AY8A 1TZYC 4ZUXA 5GT0C 1KX3D 5CPKB 1KX4C 2F8NB 3AFAC 3AYWA 5DNNB 3W98A 3MNNA 4YM6C 3MGSA 1H3OA 1F66D 3WTPE 2BYKA 5BS7C 3AN2A 4EO5B 5GT0B 5AV9C 5B40C 3A6NB 3O62C 3NQUA 3B6GC 3AFAB 1EQZC 5B24B 5AVCA 4X23B 2F8NG 4LD9B 5AVBD 3C1BC 5F99D 3W97D 5B1LA 1P3GB 3AV2C 3MGPA 2NQBA 4J8UD 1ZLAC 4H9PA 3MGQD 3UTAD 3REIA 5JRGA 1P3MA 4E44A 1Q9CA 1M18A 5B0YD 4J8WA 4WU9D 3AZLD 4H9NB 5GXQB 1WWIA 3AV2B 5CPKA 5FUGB 1TAFA 3AV1A 5B31G 3AZEB 2F8NA 5CPJC 3AZMD 3W99C 1ID3D 5DNNA 1KX3C 2CV5D 2BYMB 3WKJD 4KHAB 1P3FD 4J8XB 3UT9C 3V9RB 1TZYA 5GT0A 3AZIB 5AV5C 4J8VB 3A6NA 5GT3D 3AFAA 3AZGD 5B24A 3REHC 4Z2MH 4X23A 5CPJB 4LD9A 1KU5A 4XUJB 5C3IB 5AV8D 3AZJB 3B0DB 1P3GA 2CWEA 3AZHB 4H9OB 1P3BC 1F66C 3KWQD 3LJAD 4DRAA 4NFTA 4NE3A 5AV5B 1EQZA 3REHB 3NQJB 1M1AD 3C1CD 4HGAB 1HQ3D 3C1BA 1P3PB 3REJB 5GXQA 5B2IB 3W97C 3AV2A 3WTPD 5FUGA 1S32D 1P3ID 1P3BB 3AZFB 2PYOB 4J8UC 3LELD 3MGQC 3UTAC 2BYMA 5AV6B 4KHAA 5G49B 3V9RA 4XZQD 5B0YC 4KGCD 1A7WA 2FJ7B 3AZIA 3X1VD 4WU9C 3KXBD 3AZLC 4J8VA 4R8PB 4WV4B 4WU8D 5CPJA 4J8UB 1P3LB 3MNNB 5B2JD 4NE5A 3AZMC 1KX3A 3KUYD 3X1SC 3X1UD 3AN2B 4XUJA 3WKJC 4Z2MG 3AZHA 4H9OA 5BNXB 3WA9D 3UT9A 1P3FC 4KUDD 5JA4A 3LZ0C 5B1MB 5AV5A 3MVDD 5B1LB 3B6FB 3MGRD 3REHA 3NQJA 4Z66C 3RELC 3AZGC 1P3PA 3X1SB 3REJA 3B0CW 5AV8C 5B32C 3W96D 1P3BA 4JJNB 3AZFA 5B33D 1B6WA 4WNNB 4QLCB 1P3AC 1P3MB 1P3OD 3LZ0B 3KWQC 5B0ZB 4J8WB 5CPID 3LJAC 3TU4D 4YS3B 2NZDB 1P3KD 5G49A 4H9QB 4Z66B 3RELB 1M1AC 1TAFB 3AV1B 2FJ7A 3C1CC 4AWLB 1HQ3C 2F8NK 4WZSB 5CP6B 5B32B 4R8PA 1S32C 1P3AB 1P3IC 1P3LA 4J8UA 3AZKB 3VH6W 3X1TD 3LELC 1TZYB 3REKD 1JFIA 5BNXA 2L5AA 1KX4B 4XZQC 4KGCC 4Z5TD 4WU9A 5B1MA 3X1VC 3WAAD 4H9SC 3KXBC 4G91C 3B6FA 3R45B 3VH5T 4YM6B 3X1SA 5B2JC 3WKJA 3KUYC 5AV9B 5B40B 5DNMD 1M19D 3AV1C 4JJNA 4WNNA 4QLCA 3O62B 1AOID 3WA9C 3B6GB 3LZ0A 1EQZB 3UTBD 1U35D 3VH5A 5B0ZA 4KGCB 4KUDC 5AY8D 4DRBA 4ZUXD 3C1BB 3MVDC 5KDMB 4YS3A 2NZDA 4H9QA 4Z66A 2YFWB 3LZ1D 3MGRC 4G92C 3RELA 1ZLAB 3AYWD 5CP6A 5AV8A 5B32A 3W98D 3W96C 5GSUD 1P3AA 3AZKA 2RVQD 1P3OC 2AROC 1KX5C 3LJAA 5CPIC 3TU4C 3KSYA 2HIOD 4G92B 1P3KC 1KX4A 5AVCD 1HQ3A 3W99B 2IO5C 1KX3B 5E5AD 3AZND 1P3IA 3R45A 2JSSA 1P3OB 4YM6A 2AROB 1KX5B 2NQBD 1P34D 3UT9B 3X1TC 5BS7A 5JA4B 5AV9A 3REID 5B40A 5BO0B 5JRGD 3O62A 3B6GA 1M18D 4KGCA 3X1VA 3KXBA 3WAAC 3VH6T 5AVBC 5KDMA 5F99C 5CPKD 2YFWA 1F66B 2F8ND 1ZLAA 5DNND 4ZBJC 1R4VA 5DNMC 1M19C 4UUZB 3VH6A 1AOIC 4KUDA 3UTBC 5AY8C 5AVBB 4ZUXC 5F99B 3W97B 3A6ND 3LZ1C 5B24D 4X23D 3W99A 4LD9D 3AYWC 3MGQB 4ZBJB 4E45A 3UTAB 1ID3C 1P3GD 5CHLB 2CV5C 3B0BA 3W98C 5B31D 1P3OA 2AROA 1KX5A 5GSUC 1JFIB 2RVQC 5B0YB 5CPIA 4H9RB 4WU9B 3AZLB 5BO0A 2HIOC 5BT1D 2YFVA 1ULYA 5GT3C 5AVCC 3AZMB 1ID3B 5GXQD 2CV5B 3WKJB 3AV2D 5E5AC 3AZNC 1F66A 3AZED 1P3FB 2NQBC 1P34C 1N1JB 3REIC 5JRGC 4UUZA 4J8XD 5GT3B 3AZGB 1M18C 3AZID 5AVBA 5F99A 3W97A 4J8VD 5AV8B 5CPKC 1BH9B 3WTPC 3KWQB 1F1EA 3MGQA 5DNNC 3UTAA 3LJAB 4XUJD 3AZJD 1M19A 3AZHD 3UTBA 5B0YA 1M1AB 3C1CB 1HQ3B 4H9RA 4EO5C 5AV5D 3AZLA 3WTPB 3LZ1A 3A6NC 5B32G 3REHD 1S32B 1P3IB 5B24C 1P3PD 4X23C 3AZMA 4WU8C 3REJD 3LELB 1ID3A 4LD9C 2CV5A 5B2ID 1P3GC 3X1UC 1P3BD 5GSUA 3AZFD 1BFMA 5B31C 1P3FA 2PYOD 2HUEC 4XZQB 1N1JA 5AV6D 2LY8A 3X1VB 3KXBB 4G91B 2HIOA 5BT1C 5GT3A 3AZGA 4WU8B 1HTAA 2FJ7D 5B2JB 3KUYB 5GXQC 3X1UB 5E5AA 3AZNA 4NE6A 4R8PD 1BH9A 4CAYA 5B31B 3WA9B 1P34A 2HUEB 1P3LD 3MNND 3KWQA 3MGSD 5B33C 3AZEC 4KUDB 3AN2D 3MVDB 3MGRB 3B0CT 4J8XC 1M1AA 3C1CA 1BH8B 4M6BA 5B1MD 3AZIC 5B1LD 4J8VC 3WTPA 3B6FD 1S32A 3W96B 5B33B 3MGPD 3X1SD 3LELA 5CPIB 4XUJC 5C3IC 3TU4B 3AZJC 3B0DC 3REKC 4JJND 4QLCD 3AZHC 1P3MD 1P3KB 3LZ0D 4XZQA 5B0ZD 4J8WD 2YFVB 2IO5B 4Z5TC 4H9SA 4YS3D 2NZDD 4Z66D 3RELD 4WU8A 3AV1D 5BNVB 4HGAC 5B2JA 3X1TB 1P3PC 3KUYA 3REJC 5CP6D 3X1UA 3REKB 5B32D 5B2IC 5B31A 1P3AD 3WA9A 3AZFC 3AZKD 2PYOC 1U35C 4Z5TB 1TZYD 5GT0D 3MVDA 5AV6C 3WAAB 4CSRB 3MGRA 1KX4D 3AFAD 1BH8A 2FJ7C 4H9NA 5DNMB 4R8PC 1M19B 3W96A 4YM6D 3AZEA 5B33A 1AOIB 1P3LC 3MNNC 3MGSC 3UTBB 1U35B 3VH5W 5AV9D 5B40D 5AY8B 3AN2C 4ZUXB 3TU4A 3O62D 4J8XA 1P3KA 3LZ1B 3B6GD 1EQZD 3C1BD 3AYWB 5B1MC 5B1LC 3W98B 3B6FC 5GSUB 3MGSB 1H3OB 5BNVA 3MGPC 1ZLAD 3X1TA 2BYKB 3AZJA 3REKA 2HIOB 2F8NH 4JJNC 4QLCC 1P3MC 1B67A 3NQUB 5AVCB 5B0ZC 4Z5TA 4J8WC 3WAAA 4CSRA 4YS3C 2NZDC 5E5AB 3AZNB 4CAYB 3MGPB 2NQBB 5CPJD 1P34B 3W99D 4H9PB 4AWLC
chains in the Genus database with same CATH superfamily
5B2IA 5CP6C 3REIB 5DNMA 5JRGB 2JCHA 2AROD 1KX5D 1AOIA 2PYOA 3AL0C 3UT9D 3AZKC 1M18B 1U35A 1WWSA 5AV6A 5AY8A 1TZYC 4ZUXA 5GT0C 1KX3D 5CPKB 1KX4C 2VQRA 2F8NB 3AFAC 3AYWA 5DNNB 3W98A 3MNNA 4YM6C 3MGSA 1H3OA 1F66D 3WTPE 2BYKA 5BS7C 3AN2A 4EO5B 5GT0B 5AV9C 5B40C 3A6NB 3O62C 2DF4C 3NQUA 3B6GC 3AFAB 1EQZC 5B24B 5AVCA 4X23B 2F8NG 4LD9B 5AVBD 3C1BC 5F99D 3W97D 3H0RC 5B1LA 1P3GB 3AV2C 3MGPA 2NQBA 4J8UD 1ZLAC 4H9PA 1W2EA 3MGQD 3UTAD 3REIA 5JRGA 1P3MA 4E44A 1Q9CA 1M18A 5B0YD 4J8WA 4WU9D 3AZLD 4H9NB 5GXQB 1WWIA 3AV2B 5CPKA 5FUGB 1TAFA 3AV1A 5B31G 3AZEB 2F8NA 5CPJC 3AZMD 3W99C 1ID3D 5DNNA 1KX3C 2CV5D 2BYMB 3WKJD 4KHAB 1P3FD 4J8XB 1Z2CB 3UT9C 3V9RB 1TZYA 5GT0A 3AZIB 4WJ3C 5AV5C 4J8VB 3A6NA 5GT3D 3AFAA 3AZGD 5B24A 3REHC 4Z2MH 4X23A 5CPJB 4LD9A 1KU5A 4XUJB 5C3IB 5AV8D 3AZJB 3B0DB 1P3GA 2CWEA 3AZHB 4H9OB 1P3BC 1F66C 3KWQD 3LJAD 4DRAA 4NFTA 4NE3A 5AV5B 1EQZA 3REHB 3NQJB 1M1AD 3C1CD 4HGAB 1HQ3D 3F6TA 3C1BA 3A1IA 3REJB 1P3PB 5GXQA 5B2IB 3W97C 3AV2A 3WTPD 3FDDA 3KFUG 5FUGA 2G5IC 1S32D 1P3ID 1P3BB 3AZFB 2PYOB 4J8UC 3LELD 3MGQC 3UTAC 2BYMA 5AV6B 4KHAA 5G49B 3V9RA 4XZQD 5B0YC 4KGCD 1A7WA 2FJ7B 3AZIA 3X1VD 4WU9C 3KXBD 3AZLC 4J8VA 4R8PB 2Y2PA 4WV4B 4WU8D 5CPJA 4J8UB 1P3LB 3MNNB 5B2JD 4NE5A 3AZMC 1KX3A 3KUYD 3X1SC 3X1UD 3AN2B 4XUJA 3WKJC 4Z2MG 2Y2QA 3AZHA 4H9OA 5BNXB 3WA9D 3UT9A 1P3FC 4KUDD 5JA4A 3LZ0C 5B1MB 5AV5A 3MVDD 3EPKA 5B1LB 3B6FB 3MGRD 3REHA 3NQJA 4Z66C 3RELC 3AZGC 1P3PA 2ZY4A 3X1SB 3REJA 3B0CW 2Y2GA 5AV8C 2DQNC 5B32C 3W96D 1P3BA 4JJNB 3AZFA 5B33D 1B6WA 4WNNB 4QLCB 1P3AC 1P3MB 1P3OD 3LZ0B 3KWQC 5B0ZB 4J8WB 5CPID 3LJAC 3TU4D 4YS3B 2NZDB 1P3KD 5G49A 4H9QB 4Z66B 3RELB 1M1AC 1TAFB 3AV1B 2FJ7A 3C1CC 4AWLB 1HQ3C 2F8NK 4WZSB 5CP6B 5B32B 4R8PA 1S32C 1P3AB 1P3IC 1P3LA 4J8UA 3AZKB 3VH6W 3X1TD 3LELC 1TZYB 3REKD 1JFIA 5BNXA 2L5AA 2Y2NA 1KX4B 4XZQC 4KGCC 4Z5TD 4WU9A 5B1MA 3X1VC 3WAAD 4H9SC 3KXBC 4G91C 3B6FA 3R45B 3VH5T 4YM6B 2ZY3A 3X1SA 5B2JC 3WKJA 3KUYC 5AV9B 5B40B 5DNMD 1M19D 3AV1C 4JJNA 4WNNA 4QLCA 3O62B 1AOID 3WA9C 3B6GB 3LZ0A 1EQZB 3UTBD 1U35D 3VH5A 5B0ZA 4KGCB 4KUDC 5AY8D 4DRBA 4ZUXD 3C1BB 3MVDC 5KDMB 4YS3A 2NZDA 4H9QA 4Z66A 2YFWB 3LZ1D 3MGRC 4G92C 3RELA 2Y2KA 1ZLAB 3AYWD 5CP6A 5AV8A 5B32A 3W98D 3W96C 5GSUD 1P3AA 3AZKA 2RVQD 1P3OC 1T3UA 2AROC 1KX5C 3LJAA 5CPIC 3TU4C 3KSYA 2HIOD 4G92B 1P3KC 1KX4A 5AVCD 1HQ3A 3W99B 2IO5C 1KX3B 5E5AD 3AZND 1P3IA 3R45A 2JSSA 1P3OB 4YM6A 2AROB 1KX5B 2NQBD 1P34D 3UT9B 2ZY2A 3X1TC 5BS7A 5JA4B 5AV9A 3REID 5B40A 2ZY5A 5BO0B 5JRGD 3O62A 3B6GA 1M18D 4KGCA 3X1VA 3KXBA 3WAAC 3VH6T 2F2AC 5AVBC 5KDMA 5F99C 5CPKD 2YFWA 1F66B 3EPJA 2F8ND 1ZLAA 5DNND 4ZBJC 1R4VA 5DNMC 2FFFB 1M19C 4UUZB 3VH6A 1AOIC 2W8SA 4KUDA 3IP4C 3UTBC 5AY8C 5AVBB 4ZUXC 5F99B 3W97B 2BG1A 3A6ND 3LZ1C 5B24D 4X23D 3W99A 4LD9D 3AYWC 3MGQB 4ZBJB 4E45A 3UTAB 1ID3C 1P3GD 5CHLB 2CV5C 3B0BA 3W98C 5B31D 1P3OA 2AROA 1KX5A 5GSUC 1JFIB 2RVQC 5B0YB 5CPIA 4H9RB 4WU9B 3AZLB 5BO0A 2HIOC 5BT1D 2YFVA 1ULYA 5GT3C 5AVCC 3AZMB 1ID3B 5GXQD 2CV5B 3WKJB 3AV2D 5E5AC 3AZNC 2XD5A 1F66A 3AZED 1P3FB 2NQBC 1P34C 1N1JB 3REIC 4UPKA 2G5HC 5JRGC 4UUZA 2UWXA 4J8XD 5GT3B 3AZGB 1M18C 3AZID 5AVBA 5F99A 3W97A 4J8VD 5AV8B 5CPKC 1BH9B 3WTPC 3KWQB 1F1EA 3MGQA 5DNNC 3UTAA 3LJAB 4XUJD 3AZJD 1M19A 3AZHD 3UTBA 5B0YA 1M1AB 3H0MC 3C1CB 1HQ3B 4H9RA 4EO5C 5AV5D 3AZLA 3WTPB 3LZ1A 3A6NC 5B32G 3REHD 1S32B 1P3IB 5B24C 1P3PD 4X23C 3AZMA 4WU8C 3REJD 3LELB 1ID3A 4LD9C 2CV5A 5B2ID 1P3GC 3X1UC 1P3BD 5GSUA 3AZFD 1BFMA 5B31C 1P3FA 2PYOD 2HUEC 4XZQB 1N1JA 3P5JB 5AV6D 2LY8A 3X1VB 3KXBB 4G91B 2HIOA 5BT1C 5GT3A 3AZGA 4WU8B 1HTAA 2FJ7D 5B2JB 3KUYB 5GXQC 3X1UB 5E5AA 3AZNA 4NE6A 4R8PD 1BH9A 4CAYA 5B31B 3WA9B 1P34A 2HUEB 1P3LD 3MNND 3KWQA 3MGSD 5B33C 3AZEC 4KUDB 3H0LC 3AN2D 3MVDB 4DQYB 2Y2MA 3MGRB 3B0CT 4J8XC 1M1AA 3C1CA 1BH8B 4M6BA 5B1MD 3AZIC 2XD1A 5B1LD 3WTPA 4J8VC 3B6FD 3EPHA 1S32A 2Y2HA 3W96B 2Y2LA 5B33B 3MGPD 3X1SD 3LELA 2JE5A 5CPIB 4XUJC 5C3IC 3TU4B 3AZJC 3B0DC 3REKC 4JJND 4QLCD 3AZHC 1P3MD 1P3KB 3LZ0D 3EPLA 4XZQA 5B0ZD 4J8WD 2YFVB 2IO5B 4Z5TC 4H9SA 4YS3D 2NZDD 4Z66D 2Y2JA 3RELD 4WU8A 3AV1D 5BNVB 1PZRA 4HGAC 5B2JA 3X1TB 1P3PC 3KUYA 3REJC 5CP6D 3X1UA 3REKB 5B32D 5B2IC 5B31A 1P3AD 3WA9A 3AZFC 3AZKD 2PYOC 2J8PA 4Z5TB 1U35C 1TZYD 5GT0D 3MVDA 5AV6C 3WAAB 4CSRB 3MGRA 1KX4D 3AFAD 1BH8A 2FJ7C 4H9NA 5DNMB 4R8PC 1M19B 3W96A 4YM6D 3AZEA 3EG5B 5B33A 1AOIB 1P3LC 3MNNC 3MGSC 3UTBB 1U35B 3VH5W 5AV9D 5B40D 5AY8B 3AN2C 4ZUXB 3TU4A 2RIQA 3O62D 4J8XA 1P3KA 2Y2OA 3LZ1B 1EQZD 3B6GD 3C1BD 3AYWB 5B1MC 5B1LC 3W98B 3B6FC 5GSUB 3MGSB 1H3OB 5BNVA 3MGPC 1ZLAD 3X1TA 2BYKB 3AZJA 3REKA 2ZM5A 2HIOB 2F8NH 4JJNC 4QLCC 1P3MC 1B67A 3NQUB 5AVCB 5B0ZC 4Z5TA 4J8WC 3A1KA 3WAAA 4CSRA 4YS3C 2NZDC 5E5AB 3AZNB 4CAYB 3MGPB 2NQBB 5CPJD 1P34B 3W99D 2Y2IA 4H9PB 4AWLC
chains in the Genus database with same CATH topology
5B2IA 5CP6C 3REIB 5DNMA 5JRGB 2JCHA 2AROD 1KX5D 1AOIA 2PYOA 3AL0C 3UT9D 3AZKC 1M18B 1U35A 1WWSA 5AV6A 5AY8A 1TZYC 4ZUXA 5GT0C 1KX3D 5CPKB 1KX4C 2VQRA 2F8NB 3AFAC 3AYWA 5DNNB 3W98A 3MNNA 4YM6C 3MGSA 1H3OA 1F66D 3WTPE 2BYKA 5BS7C 3AN2A 4EO5B 5GT0B 5AV9C 5B40C 3A6NB 3O62C 2DF4C 3NQUA 3B6GC 3AFAB 1EQZC 5B24B 5AVCA 4X23B 2F8NG 4LD9B 5AVBD 3C1BC 5F99D 3W97D 3H0RC 5B1LA 1P3GB 3AV2C 3MGPA 2NQBA 4J8UD 1ZLAC 4H9PA 1W2EA 3MGQD 3UTAD 3REIA 5JRGA 1P3MA 4E44A 1Q9CA 1M18A 5B0YD 4J8WA 4WU9D 3AZLD 4H9NB 5GXQB 1WWIA 3AV2B 5CPKA 5FUGB 1TAFA 3AV1A 5B31G 3AZEB 2F8NA 5CPJC 3AZMD 3W99C 1ID3D 5DNNA 1KX3C 2CV5D 2BYMB 3WKJD 4KHAB 1P3FD 4J8XB 1Z2CB 3UT9C 3V9RB 1TZYA 5GT0A 3AZIB 4WJ3C 5AV5C 4J8VB 3A6NA 5GT3D 3AFAA 3AZGD 5B24A 3REHC 4Z2MH 4X23A 5CPJB 4LD9A 1KU5A 4XUJB 5C3IB 5AV8D 3AZJB 3B0DB 1P3GA 2CWEA 3AZHB 4H9OB 1P3BC 1F66C 3KWQD 3LJAD 4DRAA 4NFTA 4NE3A 5AV5B 1EQZA 3REHB 3NQJB 1M1AD 3C1CD 4HGAB 1HQ3D 3F6TA 3C1BA 3A1IA 3REJB 1P3PB 5GXQA 5B2IB 3W97C 3AV2A 3WTPD 3FDDA 3KFUG 5FUGA 2G5IC 1S32D 1P3ID 1P3BB 3AZFB 2PYOB 4J8UC 3LELD 3MGQC 3UTAC 2BYMA 5AV6B 4KHAA 5G49B 3V9RA 4XZQD 5B0YC 4KGCD 1A7WA 2FJ7B 3AZIA 3X1VD 4WU9C 3KXBD 3AZLC 4J8VA 4R8PB 2Y2PA 4WV4B 4WU8D 5CPJA 4J8UB 1P3LB 3MNNB 5B2JD 4NE5A 3AZMC 1KX3A 3KUYD 3X1SC 3X1UD 3AN2B 4XUJA 3WKJC 4Z2MG 2Y2QA 3AZHA 4H9OA 5BNXB 3WA9D 3UT9A 1P3FC 4KUDD 5JA4A 3LZ0C 5B1MB 5AV5A 3MVDD 3EPKA 5B1LB 3B6FB 3MGRD 3REHA 3NQJA 4Z66C 3RELC 3AZGC 1P3PA 2ZY4A 3X1SB 3REJA 3B0CW 2Y2GA 5AV8C 2DQNC 5B32C 3W96D 1P3BA 4JJNB 3AZFA 5B33D 1B6WA 4WNNB 4QLCB 1P3AC 1P3MB 1P3OD 3LZ0B 3KWQC 5B0ZB 4J8WB 5CPID 3LJAC 3TU4D 4YS3B 2NZDB 1P3KD 5G49A 4H9QB 4Z66B 3RELB 1M1AC 1TAFB 3AV1B 2FJ7A 3C1CC 4AWLB 1HQ3C 2F8NK 4WZSB 5CP6B 5B32B 4R8PA 1S32C 1P3AB 1P3IC 1P3LA 4J8UA 3AZKB 3VH6W 3X1TD 3LELC 1TZYB 3REKD 1JFIA 5BNXA 2L5AA 2Y2NA 1KX4B 4XZQC 4KGCC 4Z5TD 4WU9A 5B1MA 3X1VC 3WAAD 4H9SC 3KXBC 4G91C 3B6FA 3R45B 3VH5T 4YM6B 2ZY3A 3X1SA 5B2JC 3WKJA 3KUYC 5AV9B 5B40B 5DNMD 1M19D 3AV1C 4JJNA 4WNNA 4QLCA 3O62B 1AOID 3WA9C 3B6GB 3LZ0A 1EQZB 3UTBD 1U35D 3VH5A 5B0ZA 4KGCB 4KUDC 5AY8D 4DRBA 4ZUXD 3C1BB 3MVDC 5KDMB 4YS3A 2NZDA 4H9QA 4Z66A 2YFWB 3LZ1D 3MGRC 4G92C 3RELA 2Y2KA 1ZLAB 3AYWD 5CP6A 5AV8A 5B32A 3W98D 3W96C 5GSUD 1P3AA 3AZKA 2RVQD 1P3OC 1T3UA 2AROC 1KX5C 3LJAA 5CPIC 3TU4C 3KSYA 2HIOD 4G92B 1P3KC 1KX4A 5AVCD 1HQ3A 3W99B 2IO5C 1KX3B 5E5AD 3AZND 1P3IA 3R45A 2JSSA 1P3OB 4YM6A 2AROB 1KX5B 2NQBD 1P34D 3UT9B 2ZY2A 3X1TC 5BS7A 5JA4B 5AV9A 3REID 5B40A 2ZY5A 5BO0B 5JRGD 3O62A 3B6GA 1M18D 4KGCA 3X1VA 3KXBA 3WAAC 3VH6T 2F2AC 5AVBC 5KDMA 5F99C 5CPKD 2YFWA 1F66B 3EPJA 2F8ND 1ZLAA 5DNND 4ZBJC 1R4VA 5DNMC 2FFFB 1M19C 4UUZB 3VH6A 1AOIC 2W8SA 4KUDA 3IP4C 3UTBC 5AY8C 5AVBB 4ZUXC 5F99B 3W97B 2BG1A 3A6ND 3LZ1C 5B24D 4X23D 3W99A 4LD9D 3AYWC 3MGQB 4ZBJB 4E45A 3UTAB 1ID3C 1P3GD 5CHLB 2CV5C 3B0BA 3W98C 5B31D 1P3OA 2AROA 1KX5A 5GSUC 1JFIB 2RVQC 5B0YB 5CPIA 4H9RB 4WU9B 3AZLB 5BO0A 2HIOC 5BT1D 2YFVA 1ULYA 5GT3C 5AVCC 3AZMB 1ID3B 5GXQD 2CV5B 3WKJB 3AV2D 5E5AC 3AZNC 2XD5A 1F66A 3AZED 1P3FB 2NQBC 1P34C 1N1JB 3REIC 4UPKA 2G5HC 5JRGC 4UUZA 2UWXA 4J8XD 5GT3B 3AZGB 1M18C 3AZID 5AVBA 5F99A 3W97A 4J8VD 5AV8B 5CPKC 1BH9B 3WTPC 3KWQB 1F1EA 3MGQA 5DNNC 3UTAA 3LJAB 4XUJD 3AZJD 1M19A 3AZHD 3UTBA 5B0YA 1M1AB 3H0MC 3C1CB 1HQ3B 4H9RA 4EO5C 5AV5D 3AZLA 3WTPB 3LZ1A 3A6NC 5B32G 3REHD 1S32B 1P3IB 5B24C 1P3PD 4X23C 3AZMA 4WU8C 3REJD 3LELB 1ID3A 4LD9C 2CV5A 5B2ID 1P3GC 3X1UC 1P3BD 5GSUA 3AZFD 1BFMA 5B31C 1P3FA 2PYOD 2HUEC 4XZQB 1N1JA 3P5JB 5AV6D 2LY8A 3X1VB 3KXBB 4G91B 2HIOA 5BT1C 5GT3A 3AZGA 4WU8B 1HTAA 2FJ7D 5B2JB 3KUYB 5GXQC 3X1UB 5E5AA 3AZNA 4NE6A 4R8PD 1BH9A 4CAYA 5B31B 3WA9B 1P34A 2HUEB 1P3LD 3MNND 3KWQA 3MGSD 5B33C 3AZEC 4KUDB 3H0LC 3AN2D 3MVDB 4DQYB 2Y2MA 3MGRB 3B0CT 4J8XC 1M1AA 3C1CA 1BH8B 4M6BA 5B1MD 3AZIC 2XD1A 5B1LD 3WTPA 4J8VC 3B6FD 3EPHA 1S32A 2Y2HA 3W96B 2Y2LA 5B33B 3MGPD 3X1SD 3LELA 2JE5A 5CPIB 4XUJC 5C3IC 3TU4B 3AZJC 3B0DC 3REKC 4JJND 4QLCD 3AZHC 1P3MD 1P3KB 3LZ0D 3EPLA 4XZQA 5B0ZD 4J8WD 2YFVB 2IO5B 4Z5TC 4H9SA 4YS3D 2NZDD 4Z66D 2Y2JA 3RELD 4WU8A 3AV1D 5BNVB 1PZRA 4HGAC 5B2JA 3X1TB 1P3PC 3KUYA 3REJC 5CP6D 3X1UA 3REKB 5B32D 5B2IC 5B31A 1P3AD 3WA9A 3AZFC 3AZKD 2PYOC 2J8PA 4Z5TB 1U35C 1TZYD 5GT0D 3MVDA 5AV6C 3WAAB 4CSRB 3MGRA 1KX4D 3AFAD 1BH8A 2FJ7C 4H9NA 5DNMB 4R8PC 1M19B 3W96A 4YM6D 3AZEA 3EG5B 5B33A 1AOIB 1P3LC 3MNNC 3MGSC 3UTBB 1U35B 3VH5W 5AV9D 5B40D 5AY8B 3AN2C 4ZUXB 3TU4A 2RIQA 3O62D 4J8XA 1P3KA 2Y2OA 3LZ1B 1EQZD 3B6GD 3C1BD 3AYWB 5B1MC 5B1LC 3W98B 3B6FC 5GSUB 3MGSB 1H3OB 5BNVA 3MGPC 1ZLAD 3X1TA 2BYKB 3AZJA 3REKA 2ZM5A 2HIOB 2F8NH 4JJNC 4QLCC 1P3MC 1B67A 3NQUB 5AVCB 5B0ZC 4Z5TA 4J8WC 3A1KA 3WAAA 4CSRA 4YS3C 2NZDC 5E5AB 3AZNB 4CAYB 3MGPB 2NQBB 5CPJD 1P34B 3W99D 2Y2IA 4H9PB 4AWLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2I A;  5CP6 C;  3REI B;  5DNM A;  5JRG B;  2ARO D;  1KX5 D;  1AOI A;  2PYO A;  3UT9 D;  3AZK C;  1M18 B;  1U35 A;  1WWS A;  5AV6 A;  5AY8 A;  1TZY C;  4ZUX A;  5GT0 C;  1KX3 D;  5CPK B;  1KX4 C;  2F8N B;  3AFA C;  3AYW A;  5DNN B;  3W98 A;  3MNN A;  4YM6 C;  3MGS A;  1H3O A;  1F66 D;  3WTP E;  2BYK A;  5BS7 C;  3AN2 A;  4EO5 B;  5GT0 B;  5AV9 C;  5B40 C;  3A6N B;  3O62 C;  3NQU A;  3B6G C;  3AFA B;  1EQZ C;  5B24 B;  5AVC A;  4X23 B;  2F8N G;  4LD9 B;  5AVB D;  3C1B C;  5F99 D;  3W97 D;  5B1L A;  1P3G B;  3AV2 C;  3MGP A;  2NQB A;  4J8U D;  1ZLA C;  4H9P A;  3MGQ D;  3UTA D;  3REI A;  5JRG A;  1P3M A;  4E44 A;  1Q9C A;  1M18 A;  5B0Y D;  4J8W A;  4WU9 D;  3AZL D;  4H9N B;  5GXQ B;  1WWI A;  3AV2 B;  5CPK A;  5FUG B;  1TAF A;  3AV1 A;  5B31 G;  3AZE B;  2F8N A;  5CPJ C;  3AZM D;  3W99 C;  1ID3 D;  5DNN A;  1KX3 C;  2CV5 D;  2BYM B;  3WKJ D;  4KHA B;  1P3F D;  4J8X B;  3UT9 C;  3V9R B;  1TZY A;  5GT0 A;  3AZI B;  5AV5 C;  4J8V B;  3A6N A;  5GT3 D;  3AFA A;  3AZG D;  5B24 A;  3REH C;  4Z2M H;  4X23 A;  5CPJ B;  4LD9 A;  1KU5 A;  4XUJ B;  5C3I B;  5AV8 D;  3AZJ B;  3B0D B;  1P3G A;  2CWE A;  3AZH B;  4H9O B;  1P3B C;  1F66 C;  3KWQ D;  3LJA D;  4DRA A;  4NFT A;  4NE3 A;  5AV5 B;  1EQZ A;  3REH B;  3NQJ B;  1M1A D;  3C1C D;  4HGA B;  1HQ3 D;  3C1B A;  1P3P B;  3REJ B;  5GXQ A;  5B2I B;  3W97 C;  3AV2 A;  3WTP D;  5FUG A;  1S32 D;  1P3I D;  1P3B B;  3AZF B;  2PYO B;  4J8U C;  3LEL D;  3MGQ C;  3UTA C;  2BYM A;  5AV6 B;  4KHA A;  5G49 B;  3V9R A;  4XZQ D;  5B0Y C;  4KGC D;  1A7W A;  2FJ7 B;  3AZI A;  3X1V D;  4WU9 C;  3KXB D;  3AZL C;  4J8V A;  4R8P B;  4WV4 B;  4WU8 D;  5CPJ A;  4J8U B;  1P3L B;  3MNN B;  5B2J D;  4NE5 A;  3AZM C;  1KX3 A;  3KUY D;  3X1S C;  3X1U D;  3AN2 B;  4XUJ A;  3WKJ C;  4Z2M G;  3AZH A;  4H9O A;  5BNX B;  3WA9 D;  3UT9 A;  1P3F C;  4KUD D;  5JA4 A;  3LZ0 C;  5B1M B;  5AV5 A;  3MVD D;  5B1L B;  3B6F B;  3MGR D;  3REH A;  3NQJ A;  4Z66 C;  3REL C;  3AZG C;  1P3P A;  3X1S B;  3REJ A;  3B0C W;  5AV8 C;  5B32 C;  3W96 D;  1P3B A;  4JJN B;  3AZF A;  5B33 D;  1B6W A;  4WNN B;  4QLC B;  1P3A C;  1P3M B;  1P3O D;  3LZ0 B;  3KWQ C;  5B0Z B;  4J8W B;  5CPI D;  3LJA C;  3TU4 D;  4YS3 B;  2NZD B;  1P3K D;  5G49 A;  4H9Q B;  4Z66 B;  3REL B;  1M1A C;  1TAF B;  3AV1 B;  2FJ7 A;  3C1C C;  4AWL B;  1HQ3 C;  2F8N K;  4WZS B;  5CP6 B;  5B32 B;  4R8P A;  1S32 C;  1P3A B;  1P3I C;  1P3L A;  4J8U A;  3AZK B;  3VH6 W;  3X1T D;  3LEL C;  1TZY B;  3REK D;  1JFI A;  5BNX A;  2L5A A;  1KX4 B;  4XZQ C;  4KGC C;  4Z5T D;  4WU9 A;  5B1M A;  3X1V C;  3WAA D;  4H9S C;  3KXB C;  4G91 C;  3B6F A;  3R45 B;  3VH5 T;  4YM6 B;  3X1S A;  5B2J C;  3WKJ A;  3KUY C;  5AV9 B;  5B40 B;  5DNM D;  1M19 D;  3AV1 C;  4JJN A;  4WNN A;  4QLC A;  3O62 B;  1AOI D;  3WA9 C;  3B6G B;  3LZ0 A;  1EQZ B;  3UTB D;  1U35 D;  3VH5 A;  5B0Z A;  4KGC B;  4KUD C;  5AY8 D;  4DRB A;  4ZUX D;  3C1B B;  3MVD C;  5KDM B;  4YS3 A;  2NZD A;  4H9Q A;  4Z66 A;  2YFW B;  3LZ1 D;  3MGR C;  4G92 C;  3REL A;  1ZLA B;  3AYW D;  5CP6 A;  5AV8 A;  5B32 A;  3W98 D;  3W96 C;  5GSU D;  1P3A A;  3AZK A;  2RVQ D;  1P3O C;  2ARO C;  1KX5 C;  3LJA A;  5CPI C;  3TU4 C;  3KSY A;  2HIO D;  4G92 B;  1P3K C;  1KX4 A;  5AVC D;  1HQ3 A;  3W99 B;  2IO5 C;  1KX3 B;  5E5A D;  3AZN D;  1P3I A;  3R45 A;  2JSS A;  1P3O B;  4YM6 A;  2ARO B;  1KX5 B;  2NQB D;  1P34 D;  3UT9 B;  3X1T C;  5BS7 A;  5JA4 B;  5AV9 A;  3REI D;  5B40 A;  5BO0 B;  5JRG D;  3O62 A;  3B6G A;  1M18 D;  4KGC A;  3X1V A;  3KXB A;  3WAA C;  3VH6 T;  5AVB C;  5KDM A;  5F99 C;  5CPK D;  2YFW A;  1F66 B;  2F8N D;  1ZLA A;  5DNN D;  4ZBJ C;  1R4V A;  5DNM C;  1M19 C;  4UUZ B;  3VH6 A;  1AOI C;  4KUD A;  3UTB C;  5AY8 C;  5AVB B;  4ZUX C;  5F99 B;  3W97 B;  3A6N D;  3LZ1 C;  5B24 D;  4X23 D;  3W99 A;  4LD9 D;  3AYW C;  3MGQ B;  4ZBJ B;  4E45 A;  3UTA B;  1ID3 C;  1P3G D;  5CHL B;  2CV5 C;  3B0B A;  3W98 C;  5B31 D;  1P3O A;  2ARO A;  1KX5 A;  5GSU C;  1JFI B;  2RVQ C;  5B0Y B;  5CPI A;  4H9R B;  4WU9 B;  3AZL B;  5BO0 A;  2HIO C;  5BT1 D;  2YFV A;  1ULY A;  5GT3 C;  5AVC C;  3AZM B;  1ID3 B;  5GXQ D;  2CV5 B;  3WKJ B;  3AV2 D;  5E5A C;  3AZN C;  1F66 A;  3AZE D;  1P3F B;  2NQB C;  1P34 C;  1N1J B;  3REI C;  5JRG C;  4UUZ A;  4J8X D;  5GT3 B;  3AZG B;  1M18 C;  3AZI D;  5AVB A;  5F99 A;  3W97 A;  4J8V D;  5AV8 B;  5CPK C;  1BH9 B;  3WTP C;  3KWQ B;  1F1E A;  3MGQ A;  5DNN C;  3UTA A;  3LJA B;  4XUJ D;  3AZJ D;  1M19 A;  3AZH D;  3UTB A;  5B0Y A;  1M1A B;  3C1C B;  1HQ3 B;  4H9R A;  4EO5 C;  5AV5 D;  3AZL A;  3WTP B;  3LZ1 A;  3A6N C;  5B32 G;  3REH D;  1S32 B;  1P3I B;  5B24 C;  1P3P D;  4X23 C;  3AZM A;  4WU8 C;  3REJ D;  3LEL B;  1ID3 A;  4LD9 C;  2CV5 A;  5B2I D;  1P3G C;  3X1U C;  1P3B D;  5GSU A;  3AZF D;  1BFM A;  5B31 C;  1P3F A;  2PYO D;  2HUE C;  4XZQ B;  1N1J A;  5AV6 D;  2LY8 A;  3X1V B;  3KXB B;  4G91 B;  2HIO A;  5BT1 C;  5GT3 A;  3AZG A;  4WU8 B;  1HTA A;  2FJ7 D;  5B2J B;  3KUY B;  5GXQ C;  3X1U B;  5E5A A;  3AZN A;  4NE6 A;  4R8P D;  1BH9 A;  4CAY A;  5B31 B;  3WA9 B;  1P34 A;  2HUE B;  1P3L D;  3MNN D;  3KWQ A;  3MGS D;  5B33 C;  3AZE C;  4KUD B;  3AN2 D;  3MVD B;  3MGR B;  3B0C T;  4J8X C;  1M1A A;  3C1C A;  1BH8 B;  4M6B A;  5B1M D;  3AZI C;  5B1L D;  4J8V C;  3WTP A;  3B6F D;  1S32 A;  3W96 B;  5B33 B;  3MGP D;  3X1S D;  3LEL A;  5CPI B;  4XUJ C;  5C3I C;  3TU4 B;  3AZJ C;  3B0D C;  3REK C;  4JJN D;  4QLC D;  3AZH C;  1P3M D;  1P3K B;  3LZ0 D;  4XZQ A;  5B0Z D;  4J8W D;  2YFV B;  2IO5 B;  4Z5T C;  4H9S A;  4YS3 D;  2NZD D;  4Z66 D;  3REL D;  4WU8 A;  3AV1 D;  5BNV B;  4HGA C;  5B2J A;  3X1T B;  1P3P C;  3KUY A;  3REJ C;  5CP6 D;  3X1U A;  3REK B;  5B32 D;  5B2I C;  5B31 A;  1P3A D;  3WA9 A;  3AZF C;  3AZK D;  2PYO C;  1U35 C;  4Z5T B;  1TZY D;  5GT0 D;  3MVD A;  5AV6 C;  3WAA B;  4CSR B;  3MGR A;  1KX4 D;  3AFA D;  1BH8 A;  2FJ7 C;  4H9N A;  5DNM B;  4R8P C;  1M19 B;  3W96 A;  4YM6 D;  3AZE A;  5B33 A;  1AOI B;  1P3L C;  3MNN C;  3MGS C;  3UTB B;  1U35 B;  3VH5 W;  5AV9 D;  5B40 D;  5AY8 B;  3AN2 C;  4ZUX B;  3TU4 A;  3O62 D;  4J8X A;  1P3K A;  3LZ1 B;  3B6G D;  1EQZ D;  3C1B D;  3AYW B;  5B1M C;  5B1L C;  3W98 B;  3B6F C;  5GSU B;  3MGS B;  1H3O B;  5BNV A;  3MGP C;  1ZLA D;  3X1T A;  2BYK B;  3AZJ A;  3REK A;  2HIO B;  2F8N H;  4JJN C;  4QLC C;  1P3M C;  1B67 A;  3NQU B;  5AVC B;  5B0Z C;  4Z5T A;  4J8W C;  3WAA A;  4CSR A;  4YS3 C;  2NZD C;  5E5A B;  3AZN B;  4CAY B;  3MGP B;  2NQB B;  5CPJ D;  1P34 B;  3W99 D;  4H9P B;  4AWL C; 
#chains in the Genus database with same CATH topology
 5B2I A;  5CP6 C;  3REI B;  5DNM A;  5JRG B;  2JCH A;  2ARO D;  1KX5 D;  1AOI A;  2PYO A;  3AL0 C;  3UT9 D;  3AZK C;  1M18 B;  1U35 A;  1WWS A;  5AV6 A;  5AY8 A;  1TZY C;  4ZUX A;  5GT0 C;  1KX3 D;  5CPK B;  1KX4 C;  2VQR A;  2F8N B;  3AFA C;  3AYW A;  5DNN B;  3W98 A;  3MNN A;  4YM6 C;  3MGS A;  1H3O A;  1F66 D;  3WTP E;  2BYK A;  5BS7 C;  3AN2 A;  4EO5 B;  5GT0 B;  5AV9 C;  5B40 C;  3A6N B;  3O62 C;  2DF4 C;  3NQU A;  3B6G C;  3AFA B;  1EQZ C;  5B24 B;  5AVC A;  4X23 B;  2F8N G;  4LD9 B;  5AVB D;  3C1B C;  5F99 D;  3W97 D;  3H0R C;  5B1L A;  1P3G B;  3AV2 C;  3MGP A;  2NQB A;  4J8U D;  1ZLA C;  4H9P A;  1W2E A;  3MGQ D;  3UTA D;  3REI A;  5JRG A;  1P3M A;  4E44 A;  1Q9C A;  1M18 A;  5B0Y D;  4J8W A;  4WU9 D;  3AZL D;  4H9N B;  5GXQ B;  1WWI A;  3AV2 B;  5CPK A;  5FUG B;  1TAF A;  3AV1 A;  5B31 G;  3AZE B;  2F8N A;  5CPJ C;  3AZM D;  3W99 C;  1ID3 D;  5DNN A;  1KX3 C;  2CV5 D;  2BYM B;  3WKJ D;  4KHA B;  1P3F D;  4J8X B;  1Z2C B;  3UT9 C;  3V9R B;  1TZY A;  5GT0 A;  3AZI B;  4WJ3 C;  5AV5 C;  4J8V B;  3A6N A;  5GT3 D;  3AFA A;  3AZG D;  5B24 A;  3REH C;  4Z2M H;  4X23 A;  5CPJ B;  4LD9 A;  1KU5 A;  4XUJ B;  5C3I B;  5AV8 D;  3AZJ B;  3B0D B;  1P3G A;  2CWE A;  3AZH B;  4H9O B;  1P3B C;  1F66 C;  3KWQ D;  3LJA D;  4DRA A;  4NFT A;  4NE3 A;  5AV5 B;  1EQZ A;  3REH B;  3NQJ B;  1M1A D;  3C1C D;  4HGA B;  1HQ3 D;  3F6T A;  3C1B A;  3A1I A;  3REJ B;  1P3P B;  5GXQ A;  5B2I B;  3W97 C;  3AV2 A;  3WTP D;  3FDD A;  3KFU G;  5FUG A;  2G5I C;  1S32 D;  1P3I D;  1P3B B;  3AZF B;  2PYO B;  4J8U C;  3LEL D;  3MGQ C;  3UTA C;  2BYM A;  5AV6 B;  4KHA A;  5G49 B;  3V9R A;  4XZQ D;  5B0Y C;  4KGC D;  1A7W A;  2FJ7 B;  3AZI A;  3X1V D;  4WU9 C;  3KXB D;  3AZL C;  4J8V A;  4R8P B;  2Y2P A;  4WV4 B;  4WU8 D;  5CPJ A;  4J8U B;  1P3L B;  3MNN B;  5B2J D;  4NE5 A;  3AZM C;  1KX3 A;  3KUY D;  3X1S C;  3X1U D;  3AN2 B;  4XUJ A;  3WKJ C;  4Z2M G;  2Y2Q A;  3AZH A;  4H9O A;  5BNX B;  3WA9 D;  3UT9 A;  1P3F C;  4KUD D;  5JA4 A;  3LZ0 C;  5B1M B;  5AV5 A;  3MVD D;  3EPK A;  5B1L B;  3B6F B;  3MGR D;  3REH A;  3NQJ A;  4Z66 C;  3REL C;  3AZG C;  1P3P A;  2ZY4 A;  3X1S B;  3REJ A;  3B0C W;  2Y2G A;  5AV8 C;  2DQN C;  5B32 C;  3W96 D;  1P3B A;  4JJN B;  3AZF A;  5B33 D;  1B6W A;  4WNN B;  4QLC B;  1P3A C;  1P3M B;  1P3O D;  3LZ0 B;  3KWQ C;  5B0Z B;  4J8W B;  5CPI D;  3LJA C;  3TU4 D;  4YS3 B;  2NZD B;  1P3K D;  5G49 A;  4H9Q B;  4Z66 B;  3REL B;  1M1A C;  1TAF B;  3AV1 B;  2FJ7 A;  3C1C C;  4AWL B;  1HQ3 C;  2F8N K;  4WZS B;  5CP6 B;  5B32 B;  4R8P A;  1S32 C;  1P3A B;  1P3I C;  1P3L A;  4J8U A;  3AZK B;  3VH6 W;  3X1T D;  3LEL C;  1TZY B;  3REK D;  1JFI A;  5BNX A;  2L5A A;  2Y2N A;  1KX4 B;  4XZQ C;  4KGC C;  4Z5T D;  4WU9 A;  5B1M A;  3X1V C;  3WAA D;  4H9S C;  3KXB C;  4G91 C;  3B6F A;  3R45 B;  3VH5 T;  4YM6 B;  2ZY3 A;  3X1S A;  5B2J C;  3WKJ A;  3KUY C;  5AV9 B;  5B40 B;  5DNM D;  1M19 D;  3AV1 C;  4JJN A;  4WNN A;  4QLC A;  3O62 B;  1AOI D;  3WA9 C;  3B6G B;  3LZ0 A;  1EQZ B;  3UTB D;  1U35 D;  3VH5 A;  5B0Z A;  4KGC B;  4KUD C;  5AY8 D;  4DRB A;  4ZUX D;  3C1B B;  3MVD C;  5KDM B;  4YS3 A;  2NZD A;  4H9Q A;  4Z66 A;  2YFW B;  3LZ1 D;  3MGR C;  4G92 C;  3REL A;  2Y2K A;  1ZLA B;  3AYW D;  5CP6 A;  5AV8 A;  5B32 A;  3W98 D;  3W96 C;  5GSU D;  1P3A A;  3AZK A;  2RVQ D;  1P3O C;  1T3U A;  2ARO C;  1KX5 C;  3LJA A;  5CPI C;  3TU4 C;  3KSY A;  2HIO D;  4G92 B;  1P3K C;  1KX4 A;  5AVC D;  1HQ3 A;  3W99 B;  2IO5 C;  1KX3 B;  5E5A D;  3AZN D;  1P3I A;  3R45 A;  2JSS A;  1P3O B;  4YM6 A;  2ARO B;  1KX5 B;  2NQB D;  1P34 D;  3UT9 B;  2ZY2 A;  3X1T C;  5BS7 A;  5JA4 B;  5AV9 A;  3REI D;  5B40 A;  2ZY5 A;  5BO0 B;  5JRG D;  3O62 A;  3B6G A;  1M18 D;  4KGC A;  3X1V A;  3KXB A;  3WAA C;  3VH6 T;  2F2A C;  5AVB C;  5KDM A;  5F99 C;  5CPK D;  2YFW A;  1F66 B;  3EPJ A;  2F8N D;  1ZLA A;  5DNN D;  4ZBJ C;  1R4V A;  5DNM C;  2FFF B;  1M19 C;  4UUZ B;  3VH6 A;  1AOI C;  2W8S A;  4KUD A;  3IP4 C;  3UTB C;  5AY8 C;  5AVB B;  4ZUX C;  5F99 B;  3W97 B;  2BG1 A;  3A6N D;  3LZ1 C;  5B24 D;  4X23 D;  3W99 A;  4LD9 D;  3AYW C;  3MGQ B;  4ZBJ B;  4E45 A;  3UTA B;  1ID3 C;  1P3G D;  5CHL B;  2CV5 C;  3B0B A;  3W98 C;  5B31 D;  1P3O A;  2ARO A;  1KX5 A;  5GSU C;  1JFI B;  2RVQ C;  5B0Y B;  5CPI A;  4H9R B;  4WU9 B;  3AZL B;  5BO0 A;  2HIO C;  5BT1 D;  2YFV A;  1ULY A;  5GT3 C;  5AVC C;  3AZM B;  1ID3 B;  5GXQ D;  2CV5 B;  3WKJ B;  3AV2 D;  5E5A C;  3AZN C;  2XD5 A;  1F66 A;  3AZE D;  1P3F B;  2NQB C;  1P34 C;  1N1J B;  3REI C;  4UPK A;  2G5H C;  5JRG C;  4UUZ A;  2UWX A;  4J8X D;  5GT3 B;  3AZG B;  1M18 C;  3AZI D;  5AVB A;  5F99 A;  3W97 A;  4J8V D;  5AV8 B;  5CPK C;  1BH9 B;  3WTP C;  3KWQ B;  1F1E A;  3MGQ A;  5DNN C;  3UTA A;  3LJA B;  4XUJ D;  3AZJ D;  1M19 A;  3AZH D;  3UTB A;  5B0Y A;  1M1A B;  3H0M C;  3C1C B;  1HQ3 B;  4H9R A;  4EO5 C;  5AV5 D;  3AZL A;  3WTP B;  3LZ1 A;  3A6N C;  5B32 G;  3REH D;  1S32 B;  1P3I B;  5B24 C;  1P3P D;  4X23 C;  3AZM A;  4WU8 C;  3REJ D;  3LEL B;  1ID3 A;  4LD9 C;  2CV5 A;  5B2I D;  1P3G C;  3X1U C;  1P3B D;  5GSU A;  3AZF D;  1BFM A;  5B31 C;  1P3F A;  2PYO D;  2HUE C;  4XZQ B;  1N1J A;  3P5J B;  5AV6 D;  2LY8 A;  3X1V B;  3KXB B;  4G91 B;  2HIO A;  5BT1 C;  5GT3 A;  3AZG A;  4WU8 B;  1HTA A;  2FJ7 D;  5B2J B;  3KUY B;  5GXQ C;  3X1U B;  5E5A A;  3AZN A;  4NE6 A;  4R8P D;  1BH9 A;  4CAY A;  5B31 B;  3WA9 B;  1P34 A;  2HUE B;  1P3L D;  3MNN D;  3KWQ A;  3MGS D;  5B33 C;  3AZE C;  4KUD B;  3H0L C;  3AN2 D;  3MVD B;  4DQY B;  2Y2M A;  3MGR B;  3B0C T;  4J8X C;  1M1A A;  3C1C A;  1BH8 B;  4M6B A;  5B1M D;  3AZI C;  2XD1 A;  5B1L D;  3WTP A;  4J8V C;  3B6F D;  3EPH A;  1S32 A;  2Y2H A;  3W96 B;  2Y2L A;  5B33 B;  3MGP D;  3X1S D;  3LEL A;  2JE5 A;  5CPI B;  4XUJ C;  5C3I C;  3TU4 B;  3AZJ C;  3B0D C;  3REK C;  4JJN D;  4QLC D;  3AZH C;  1P3M D;  1P3K B;  3LZ0 D;  3EPL A;  4XZQ A;  5B0Z D;  4J8W D;  2YFV B;  2IO5 B;  4Z5T C;  4H9S A;  4YS3 D;  2NZD D;  4Z66 D;  2Y2J A;  3REL D;  4WU8 A;  3AV1 D;  5BNV B;  1PZR A;  4HGA C;  5B2J A;  3X1T B;  1P3P C;  3KUY A;  3REJ C;  5CP6 D;  3X1U A;  3REK B;  5B32 D;  5B2I C;  5B31 A;  1P3A D;  3WA9 A;  3AZF C;  3AZK D;  2PYO C;  2J8P A;  4Z5T B;  1U35 C;  1TZY D;  5GT0 D;  3MVD A;  5AV6 C;  3WAA B;  4CSR B;  3MGR A;  1KX4 D;  3AFA D;  1BH8 A;  2FJ7 C;  4H9N A;  5DNM B;  4R8P C;  1M19 B;  3W96 A;  4YM6 D;  3AZE A;  3EG5 B;  5B33 A;  1AOI B;  1P3L C;  3MNN C;  3MGS C;  3UTB B;  1U35 B;  3VH5 W;  5AV9 D;  5B40 D;  5AY8 B;  3AN2 C;  4ZUX B;  3TU4 A;  2RIQ A;  3O62 D;  4J8X A;  1P3K A;  2Y2O A;  3LZ1 B;  1EQZ D;  3B6G D;  3C1B D;  3AYW B;  5B1M C;  5B1L C;  3W98 B;  3B6F C;  5GSU B;  3MGS B;  1H3O B;  5BNV A;  3MGP C;  1ZLA D;  3X1T A;  2BYK B;  3AZJ A;  3REK A;  2ZM5 A;  2HIO B;  2F8N H;  4JJN C;  4QLC C;  1P3M C;  1B67 A;  3NQU B;  5AVC B;  5B0Z C;  4Z5T A;  4J8W C;  3A1K A;  3WAA A;  4CSR A;  4YS3 C;  2NZD C;  5E5A B;  3AZN B;  4CAY B;  3MGP B;  2NQB B;  5CPJ D;  1P34 B;  3W99 D;  2Y2I A;  4H9P B;  4AWL C; 
#chains in the Genus database with same CATH homology
 5B2I A;  5CP6 C;  3REI B;  5DNM A;  5JRG B;  2JCH A;  2ARO D;  1KX5 D;  1AOI A;  2PYO A;  3AL0 C;  3UT9 D;  3AZK C;  1M18 B;  1U35 A;  1WWS A;  5AV6 A;  5AY8 A;  1TZY C;  4ZUX A;  5GT0 C;  1KX3 D;  5CPK B;  1KX4 C;  2VQR A;  2F8N B;  3AFA C;  3AYW A;  5DNN B;  3W98 A;  3MNN A;  4YM6 C;  3MGS A;  1H3O A;  1F66 D;  3WTP E;  2BYK A;  5BS7 C;  3AN2 A;  4EO5 B;  5GT0 B;  5AV9 C;  5B40 C;  3A6N B;  3O62 C;  2DF4 C;  3NQU A;  3B6G C;  3AFA B;  1EQZ C;  5B24 B;  5AVC A;  4X23 B;  2F8N G;  4LD9 B;  5AVB D;  3C1B C;  5F99 D;  3W97 D;  3H0R C;  5B1L A;  1P3G B;  3AV2 C;  3MGP A;  2NQB A;  4J8U D;  1ZLA C;  4H9P A;  1W2E A;  3MGQ D;  3UTA D;  3REI A;  5JRG A;  1P3M A;  4E44 A;  1Q9C A;  1M18 A;  5B0Y D;  4J8W A;  4WU9 D;  3AZL D;  4H9N B;  5GXQ B;  1WWI A;  3AV2 B;  5CPK A;  5FUG B;  1TAF A;  3AV1 A;  5B31 G;  3AZE B;  2F8N A;  5CPJ C;  3AZM D;  3W99 C;  1ID3 D;  5DNN A;  1KX3 C;  2CV5 D;  2BYM B;  3WKJ D;  4KHA B;  1P3F D;  4J8X B;  1Z2C B;  3UT9 C;  3V9R B;  1TZY A;  5GT0 A;  3AZI B;  4WJ3 C;  5AV5 C;  4J8V B;  3A6N A;  5GT3 D;  3AFA A;  3AZG D;  5B24 A;  3REH C;  4Z2M H;  4X23 A;  5CPJ B;  4LD9 A;  1KU5 A;  4XUJ B;  5C3I B;  5AV8 D;  3AZJ B;  3B0D B;  1P3G A;  2CWE A;  3AZH B;  4H9O B;  1P3B C;  1F66 C;  3KWQ D;  3LJA D;  4DRA A;  4NFT A;  4NE3 A;  5AV5 B;  1EQZ A;  3REH B;  3NQJ B;  1M1A D;  3C1C D;  4HGA B;  1HQ3 D;  3F6T A;  3C1B A;  3A1I A;  3REJ B;  1P3P B;  5GXQ A;  5B2I B;  3W97 C;  3AV2 A;  3WTP D;  3FDD A;  3KFU G;  5FUG A;  2G5I C;  1S32 D;  1P3I D;  1P3B B;  3AZF B;  2PYO B;  4J8U C;  3LEL D;  3MGQ C;  3UTA C;  2BYM A;  5AV6 B;  4KHA A;  5G49 B;  3V9R A;  4XZQ D;  5B0Y C;  4KGC D;  1A7W A;  2FJ7 B;  3AZI A;  3X1V D;  4WU9 C;  3KXB D;  3AZL C;  4J8V A;  4R8P B;  2Y2P A;  4WV4 B;  4WU8 D;  5CPJ A;  4J8U B;  1P3L B;  3MNN B;  5B2J D;  4NE5 A;  3AZM C;  1KX3 A;  3KUY D;  3X1S C;  3X1U D;  3AN2 B;  4XUJ A;  3WKJ C;  4Z2M G;  2Y2Q A;  3AZH A;  4H9O A;  5BNX B;  3WA9 D;  3UT9 A;  1P3F C;  4KUD D;  5JA4 A;  3LZ0 C;  5B1M B;  5AV5 A;  3MVD D;  3EPK A;  5B1L B;  3B6F B;  3MGR D;  3REH A;  3NQJ A;  4Z66 C;  3REL C;  3AZG C;  1P3P A;  2ZY4 A;  3X1S B;  3REJ A;  3B0C W;  2Y2G A;  5AV8 C;  2DQN C;  5B32 C;  3W96 D;  1P3B A;  4JJN B;  3AZF A;  5B33 D;  1B6W A;  4WNN B;  4QLC B;  1P3A C;  1P3M B;  1P3O D;  3LZ0 B;  3KWQ C;  5B0Z B;  4J8W B;  5CPI D;  3LJA C;  3TU4 D;  4YS3 B;  2NZD B;  1P3K D;  5G49 A;  4H9Q B;  4Z66 B;  3REL B;  1M1A C;  1TAF B;  3AV1 B;  2FJ7 A;  3C1C C;  4AWL B;  1HQ3 C;  2F8N K;  4WZS B;  5CP6 B;  5B32 B;  4R8P A;  1S32 C;  1P3A B;  1P3I C;  1P3L A;  4J8U A;  3AZK B;  3VH6 W;  3X1T D;  3LEL C;  1TZY B;  3REK D;  1JFI A;  5BNX A;  2L5A A;  2Y2N A;  1KX4 B;  4XZQ C;  4KGC C;  4Z5T D;  4WU9 A;  5B1M A;  3X1V C;  3WAA D;  4H9S C;  3KXB C;  4G91 C;  3B6F A;  3R45 B;  3VH5 T;  4YM6 B;  2ZY3 A;  3X1S A;  5B2J C;  3WKJ A;  3KUY C;  5AV9 B;  5B40 B;  5DNM D;  1M19 D;  3AV1 C;  4JJN A;  4WNN A;  4QLC A;  3O62 B;  1AOI D;  3WA9 C;  3B6G B;  3LZ0 A;  1EQZ B;  3UTB D;  1U35 D;  3VH5 A;  5B0Z A;  4KGC B;  4KUD C;  5AY8 D;  4DRB A;  4ZUX D;  3C1B B;  3MVD C;  5KDM B;  4YS3 A;  2NZD A;  4H9Q A;  4Z66 A;  2YFW B;  3LZ1 D;  3MGR C;  4G92 C;  3REL A;  2Y2K A;  1ZLA B;  3AYW D;  5CP6 A;  5AV8 A;  5B32 A;  3W98 D;  3W96 C;  5GSU D;  1P3A A;  3AZK A;  2RVQ D;  1P3O C;  1T3U A;  2ARO C;  1KX5 C;  3LJA A;  5CPI C;  3TU4 C;  3KSY A;  2HIO D;  4G92 B;  1P3K C;  1KX4 A;  5AVC D;  1HQ3 A;  3W99 B;  2IO5 C;  1KX3 B;  5E5A D;  3AZN D;  1P3I A;  3R45 A;  2JSS A;  1P3O B;  4YM6 A;  2ARO B;  1KX5 B;  2NQB D;  1P34 D;  3UT9 B;  2ZY2 A;  3X1T C;  5BS7 A;  5JA4 B;  5AV9 A;  3REI D;  5B40 A;  2ZY5 A;  5BO0 B;  5JRG D;  3O62 A;  3B6G A;  1M18 D;  4KGC A;  3X1V A;  3KXB A;  3WAA C;  3VH6 T;  2F2A C;  5AVB C;  5KDM A;  5F99 C;  5CPK D;  2YFW A;  1F66 B;  3EPJ A;  2F8N D;  1ZLA A;  5DNN D;  4ZBJ C;  1R4V A;  5DNM C;  2FFF B;  1M19 C;  4UUZ B;  3VH6 A;  1AOI C;  2W8S A;  4KUD A;  3IP4 C;  3UTB C;  5AY8 C;  5AVB B;  4ZUX C;  5F99 B;  3W97 B;  2BG1 A;  3A6N D;  3LZ1 C;  5B24 D;  4X23 D;  3W99 A;  4LD9 D;  3AYW C;  3MGQ B;  4ZBJ B;  4E45 A;  3UTA B;  1ID3 C;  1P3G D;  5CHL B;  2CV5 C;  3B0B A;  3W98 C;  5B31 D;  1P3O A;  2ARO A;  1KX5 A;  5GSU C;  1JFI B;  2RVQ C;  5B0Y B;  5CPI A;  4H9R B;  4WU9 B;  3AZL B;  5BO0 A;  2HIO C;  5BT1 D;  2YFV A;  1ULY A;  5GT3 C;  5AVC C;  3AZM B;  1ID3 B;  5GXQ D;  2CV5 B;  3WKJ B;  3AV2 D;  5E5A C;  3AZN C;  2XD5 A;  1F66 A;  3AZE D;  1P3F B;  2NQB C;  1P34 C;  1N1J B;  3REI C;  4UPK A;  2G5H C;  5JRG C;  4UUZ A;  2UWX A;  4J8X D;  5GT3 B;  3AZG B;  1M18 C;  3AZI D;  5AVB A;  5F99 A;  3W97 A;  4J8V D;  5AV8 B;  5CPK C;  1BH9 B;  3WTP C;  3KWQ B;  1F1E A;  3MGQ A;  5DNN C;  3UTA A;  3LJA B;  4XUJ D;  3AZJ D;  1M19 A;  3AZH D;  3UTB A;  5B0Y A;  1M1A B;  3H0M C;  3C1C B;  1HQ3 B;  4H9R A;  4EO5 C;  5AV5 D;  3AZL A;  3WTP B;  3LZ1 A;  3A6N C;  5B32 G;  3REH D;  1S32 B;  1P3I B;  5B24 C;  1P3P D;  4X23 C;  3AZM A;  4WU8 C;  3REJ D;  3LEL B;  1ID3 A;  4LD9 C;  2CV5 A;  5B2I D;  1P3G C;  3X1U C;  1P3B D;  5GSU A;  3AZF D;  1BFM A;  5B31 C;  1P3F A;  2PYO D;  2HUE C;  4XZQ B;  1N1J A;  3P5J B;  5AV6 D;  2LY8 A;  3X1V B;  3KXB B;  4G91 B;  2HIO A;  5BT1 C;  5GT3 A;  3AZG A;  4WU8 B;  1HTA A;  2FJ7 D;  5B2J B;  3KUY B;  5GXQ C;  3X1U B;  5E5A A;  3AZN A;  4NE6 A;  4R8P D;  1BH9 A;  4CAY A;  5B31 B;  3WA9 B;  1P34 A;  2HUE B;  1P3L D;  3MNN D;  3KWQ A;  3MGS D;  5B33 C;  3AZE C;  4KUD B;  3H0L C;  3AN2 D;  3MVD B;  4DQY B;  2Y2M A;  3MGR B;  3B0C T;  4J8X C;  1M1A A;  3C1C A;  1BH8 B;  4M6B A;  5B1M D;  3AZI C;  2XD1 A;  5B1L D;  3WTP A;  4J8V C;  3B6F D;  3EPH A;  1S32 A;  2Y2H A;  3W96 B;  2Y2L A;  5B33 B;  3MGP D;  3X1S D;  3LEL A;  2JE5 A;  5CPI B;  4XUJ C;  5C3I C;  3TU4 B;  3AZJ C;  3B0D C;  3REK C;  4JJN D;  4QLC D;  3AZH C;  1P3M D;  1P3K B;  3LZ0 D;  3EPL A;  4XZQ A;  5B0Z D;  4J8W D;  2YFV B;  2IO5 B;  4Z5T C;  4H9S A;  4YS3 D;  2NZD D;  4Z66 D;  2Y2J A;  3REL D;  4WU8 A;  3AV1 D;  5BNV B;  1PZR A;  4HGA C;  5B2J A;  3X1T B;  1P3P C;  3KUY A;  3REJ C;  5CP6 D;  3X1U A;  3REK B;  5B32 D;  5B2I C;  5B31 A;  1P3A D;  3WA9 A;  3AZF C;  3AZK D;  2PYO C;  2J8P A;  4Z5T B;  1U35 C;  1TZY D;  5GT0 D;  3MVD A;  5AV6 C;  3WAA B;  4CSR B;  3MGR A;  1KX4 D;  3AFA D;  1BH8 A;  2FJ7 C;  4H9N A;  5DNM B;  4R8P C;  1M19 B;  3W96 A;  4YM6 D;  3AZE A;  3EG5 B;  5B33 A;  1AOI B;  1P3L C;  3MNN C;  3MGS C;  3UTB B;  1U35 B;  3VH5 W;  5AV9 D;  5B40 D;  5AY8 B;  3AN2 C;  4ZUX B;  3TU4 A;  2RIQ A;  3O62 D;  4J8X A;  1P3K A;  2Y2O A;  3LZ1 B;  1EQZ D;  3B6G D;  3C1B D;  3AYW B;  5B1M C;  5B1L C;  3W98 B;  3B6F C;  5GSU B;  3MGS B;  1H3O B;  5BNV A;  3MGP C;  1ZLA D;  3X1T A;  2BYK B;  3AZJ A;  3REK A;  2ZM5 A;  2HIO B;  2F8N H;  4JJN C;  4QLC C;  1P3M C;  1B67 A;  3NQU B;  5AVC B;  5B0Z C;  4Z5T A;  4J8W C;  3A1K A;  3WAA A;  4CSR A;  4YS3 C;  2NZD C;  5E5A B;  3AZN B;  4CAY B;  3MGP B;  2NQB B;  5CPJ D;  1P34 B;  3W99 D;  2Y2I A;  4H9P B;  4AWL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...