3REID

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiD00
1S32C 5F99B 3MGRD 3MGPA 3AV2D 1U35D 5F99A 4XUJC 4QLCC 1P3OB 3REHA 4HGAC 4J8XB 3MGSD 3X1UB 5AY8B 3WA9B 3AZIB 1P3OA 3LZ1B 3X1UA 5AY8A 3B0CW 3WA9A 1P3KA 3LZ1A 2FJ7A 1TAFB 4XZQD 3AFAB 3C1CD 2IO5C 2NQBD 1P3OC 5DNND 4J8XC 1TZYB 3X1UC 3X1TB 1P3GD 5AY8C 1P3FD 3WA9C 3AZIC 3AV1A 3AZFD 3LZ1C 1ZLAA 2BYKB 5B1MD 3X1TA 5B0ZA 5CPJB 3LELD 1BFMA 3KWQC 2BYKA 5GSUA 5BO0A 5CPJA 4M6BA 4J8UA 3AYWC 3UTBB 5CPKD 3AFAC 5JRGA 5GXQD 3UTBA 1TZYC 3X1TC 3REKD 1F66B 3B6FB 1M19D 3AN2D 3MGRB 5CPJC 1P3BD 1F66A 3B6FA 3AV2B 1U35B 3MGRA 3A6ND 3AV2A 3UTBC 1U35A 3MGSB 3B0DB 5DNMD 3MGSA 1P34D 1P3AD 1P3PD 1F66C 3TU4D 4CAYB 5GT3D 3REJC 3AZLD 3MGRC 5BNVB 4CAYA 4XZQB 1WWIA 1U35C 5GT0D 4XZQA 5AVBD 3UT9D 3X1VA 2NQBB 4YM6D 5DNNB 3B6GA 3MGSC 3B0DC 1P3GB 1P3FB 3VH5A 3AZFB 5DNNA 3R45B 5B1MB 1P3MA 2L5AA 5B40C 3WAAD 3KWQD 3LELB 3AZFA 3R45A 5AV6D 4NFTA 5AV8A 3AZND 3AYWD 5CPKB 4XZQC 3VH5T 4NE3A 3C1CC 4WU8D 5GXQB 5CPKA 5B31D 5E5AD 2NQBC 5DNNC 1R4VA 4Z5TA 1P3FC 1P3GC 3REKB 3AZFC 5B1MC 4H9OB 1M19B 3AN2B 3UTAD 1KU5A 3LELC 1P3BB 2PYOC 2HIOD 3W96D 4H9OA 1S32A 3AN2A 1ULYA 4XUJB 1P3BA 3A6NB 3AZHD 5CPKC 1N1JB 1H3OA 4XUJA 2CV5D 4QLCA 3A6NA 4J8VD 5GXQC 1N1JA 5BS7A 1P34B 1P3AB 4WNNB 4KUDD 3AZED 3WKJD 1P3PB 3LJAD 3REKC 3TU4B 1P3AA 5GT3B 1M19C 1P3PA 3AZLB 3AN2C 4H9SC 1P3BC 3TU4A 1AOID 3WTPD 2IO5B 3AZLA 5GT0B 4H9PB 3KXBD 3A6NC 5AVBB 3UT9B 4YM6B 5GT0A 4H9PA 5BS7C 3LZ0D 5DNMC 5AVBA 3UT9A 4H9NB 4YM6A 4J8XA 4ZUXD 3V9RB 5B40D 4WZSB 3AZIA 1P34C 1P3AC 3WAAB 3KWQB 1P3PC 2YFVB 3TU4C 5AV6B 5GT3C 3KWQA 3AZNB 3AZLC 3AYWB 2YFVA 1TAFA 5AV6A 3W98C 3AZNA 5B31G 4WU8B 3AYWA 5GT0C 4X23D 3AFAA 4AWLB 5AVBC 5E5AB 5B31B 3UT9C 4YM6C 1M1AD 1M18D 4WU9C 2F8NK 5B31A 5E5AA 1TZYA 5B33D 4EO5B 1KX5D 1KX3D 5B32D 3UTAB 3WAAC 2PYOD 3VH6W 3NQUB 2HIOB 3W96B 4Z2MG 5AV6C 1ID3D 3NQUA 3AZNC 1EQZD 3AZJD 1A7WA 2HIOA 3W96A 3AZHB 2CV5B 4J8VB 4WU8C 3AZHA 4KGCD 3B0CT 4AWLC 5B31C 5E5AC 4J8VA 5BNXB 4KUDB 3AZEB 3WKJB 3LJAB 4Z66D 5BNXA 5B2ID 3W99D 4EO5C 3REJB 3AZEA 4KUDA 4H9RB 3WKJA 3LJAA 3UTAC 3REID 3VH6A 1AOIB 3WTPB 2HIOC 3B0BA 3W96C 4H9RA 3REJA 3KXBB 1AOIA 3WTPA 3AZHC 1P3LD 3MVDD 5BT1D 3KXBA 2CV5C 4J8VC 3LZ0B 4ZUXB 4E44A 2AROD 5B40B 3LZ0A 4KUDC 3AZEC 3WKJC 3LJAC 4G91B 4ZUXA 5B40A 3RELD 2RVQC 5B2JD 5C3IB 1AOIC 3W98D 3WTPC 3C1CB 4KHAB 5BNVA 4H9QB 3KXBC 3W97D 4X23B 5G49B 3C1CA 1M1AB 1M18B 4WU9D 4KHAA 4H9QA 2NQBA 3LZ0C 5B32G 1M1AA 5B33B 3X1SD 1P3FA 1P3GA 1KX5B 4ZUXC 1KX3B 5JA4B 4Z2MH 5B32B 4J8WD 2PYOB 5B33A 5B1MA 2F8ND 4G91C 1KX3A 5JA4A 3MGPD 3LELA 1P3ID 1ID3B 2PYOA 1EQZB 3AZJB 5C3IC 1ID3A 3REHD 4KGCB 4X23C 1M1AC 1M18C 5GXQA 3O62D 3AZMD 1BH8B 1P3KD 4NE5A 5B1LD 4Z66B 4ZBJB 4CSRB 4JJND 5B2IB 5B33C 2HUEC 1KX5C 2FJ7D 3W99B 1BH8A 5B32C 3REKA 1KX3C 5KDMB 3REIB 4Z66A 4CSRA 5B2IA 1M19A 1Q9CA 4H9SA 1ID3C 5KDMA 1EQZC 3AZJC 1P3LB 1HQ3D 3MNND 3MVDB 5DNMB 5AVCD 4KGCC 5CP6D 5CPID 3MVDA 4LD9D 3AV1D 5DNMA 2AROB 1ZLAD 5B0ZD 1P34A 5B0YD 4WNNA 4ZBJC 2AROA 4Z66C 5B2IC 3W99C 2RVQD 5GSUD 3RELB 5B2JB 3REIC 5B24D 5GT3A 4J8UD 3W98B 5B2JA 5JRGD 3W97B 3W98A 1P3LC 4WU9B 3MVDC 2NZDD 5BT1C 3WTPE 3W97A 3AZGD 4WU9A 3X1SB 2F8NG 2AROC 4H9NA 4J8WB 3X1SA 3V9RA 2F8NB 3MGPB 3WAAA 1P3IB 4J8WA 3RELC 2F8NA 5B2JC 1P3IA 3REHB 3MGQD 3W97C 4WV4B 4WU8A 4YS3D 3O62B 3AZMB 1BH9B 1P3KB 5B1LB 3O62A 4JJNB 3AZMA 3X1SC 2FJ7B 1BH9A 5B1LA 4J8WC 4JJNA 3UTAA 3MGPC 1P3IC 4DRBA 5F99C 3C1BD 1HQ3B 3MNNB 3X1VD 3REHC 5AV5D 3B6GD 4NE6A 5AVCB 1HQ3A 5CP6B 5CPIB 3MNNA 2CV5A 4LD9B 3AV1B 3O62C 3AZMC 1ZLAB 5AVCA 3AZKD 5CP6A 5B0ZB 5CPIA 1P3MD 1HTAA 1P3KC 4LD9A 5B1LC 5B0YB 4JJNC 2FJ7C 5GSUB 3KUYD 5BO0B 5AV8D 5B0YA 5B24B 5CHLB 4J8UB 5JRGB 1KX4D 5B24A 1HQ3C 3MNNC 2NZDB 3AZGB 5AV9D 2F8NH 4Z5TD 5AVCC 5CPIC 5CP6C 4LD9C 2NZDA 3AV1C 3AZGA 4E45A 3VH6T 1ZLAC 5B0ZC 4R8PD 5B0YC 1S32D 5GSUC 3NQJB 5B24C 4J8UC 3MGQB 3NQJA 4XUJD 4QLCD 5JRGC 2CWEA 3MGQA 4YS3B 2NZDC 3AZGC 3VH5W 4X23A 5G49A 5FUGB 1M18A 2HUEB 4YS3A 5FUGA 2BYMB 1KX5A 5B32A 3B6FC 5F99D 2BYMA 1JFIB 3C1BB 3X1VB 3AV2C 1EQZA 5AV5B 3MGQC 2JSSA 3AZJA 1JFIA 3B6GB 3C1BA 1WWSA 1P3OD 4J8XD 5AV5A 2YFWB 3X1UD 5AY8D 4YS3C 4KGCA 3WA9D 3AZID 3AZKB 1P3MB 3LZ1D 2YFWA 3AZKA 3KUYB 5AV8B 3W99A 3KUYA 3REIA 4G92B 1KX4B 3C1BC 3AFAD 3X1VC 5AV5C 5AV9B 1KX4A 1P3LA 3B6GC 4Z5TB 1B67A 5AV9A 1TZYD 3X1TD 3KSYA 3AZKC 1P3MC 4R8PB 1S32B 5CPJD 3KUYC 2LY8A 5AV8C 4R8PA 3RELA 4UUZB 1F1EA 1H3OB 4QLCB 4G92C 1KX4C 3UTBD 4HGAB 4UUZA 5AV9C 4Z5TC 4DRAA 1B6WA 1F66D 3B6FD 4R8PC 3REJD
chains in the Genus database with same CATH superfamily
1S32C 5F99B 3MGRD 3MGPA 3AV2D 1U35D 5F99A 4XUJC 4QLCC 1P3OB 3REHA 4HGAC 4J8XB 3MGSD 3X1UB 5AY8B 3WA9B 3AZIB 1P3OA 3LZ1B 3X1UA 5AY8A 3B0CW 3WA9A 1P3KA 3LZ1A 2FJ7A 1TAFB 2ZY5A 4XZQD 3AFAB 3C1CD 2IO5C 3H0LC 2NQBD 1P3OC 5DNND 4J8XC 2F2AC 1TZYB 2G5IC 3X1UC 3X1TB 5AY8C 1P3GD 1P3FD 3WA9C 3AZIC 3AV1A 3AZFD 2Y2HA 3LZ1C 1ZLAA 2BYKB 5B1MD 3X1TA 4WJ3C 5B0ZA 5CPJB 3LELD 1BFMA 2FFFB 3KWQC 2J8PA 2BYKA 5GSUA 5BO0A 5CPJA 4M6BA 4J8UA 3AYWC 3UTBB 5CPKD 2Y2IA 3AFAC 5JRGA 5GXQD 3UTBA 3EPHA 1TZYC 3X1TC 3REKD 1F66B 3B6FB 1M19D 3AN2D 3MGRB 5CPJC 1P3BD 1F66A 3B6FA 3AV2B 1U35B 3MGRA 3A6ND 3AV2A 3UTBC 1U35A 3FDDA 3MGSB 3B0DB 3H0MC 5DNMD 3MGSA 1P34D 1P3AD 1P3PD 1F66C 3TU4D 4CAYB 5GT3D 3REJC 3AZLD 3MGRC 2BG1A 5BNVB 4CAYA 4XZQB 1WWIA 1U35C 5GT0D 2DF4C 4XZQA 5AVBD 3UT9D 3X1VA 2NQBB 4YM6D 3A1KA 5DNNB 3B6GA 3MGSC 3B0DC 1P3GB 1P3FB 2W8SA 3VH5A 3AZFB 5DNNA 3R45B 5B1MB 1P3MA 2L5AA 5B40C 3WAAD 3KWQD 3LELB 3AZFA 3R45A 5AV6D 4NFTA 5AV8A 3AZND 3AYWD 5CPKB 2XD1A 4XZQC 3VH5T 2Y2JA 4NE3A 3C1CC 4WU8D 5GXQB 5CPKA 5B31D 5E5AD 2NQBC 5DNNC 1R4VA 4Z5TA 2Y2KA 1P3GC 1P3FC 3REKB 3AZFC 5B1MC 2JE5A 4H9OB 1M19B 3AN2B 3UTAD 1KU5A 3LELC 1P3BB 2PYOC 2HIOD 3W96D 4H9OA 1S32A 3AN2A 1ULYA 4XUJB 1P3BA 3A6NB 3AZHD 5CPKC 3P5JB 1N1JB 1H3OA 4XUJA 2CV5D 4QLCA 3A6NA 4J8VD 5GXQC 1N1JA 5BS7A 1P34B 1P3AB 4WNNB 4KUDD 3AZED 3WKJD 1P3PB 3LJAD 3REKC 3TU4B 1P3AA 5GT3B 1M19C 1P3PA 3AZLB 3AN2C 4H9SC 1P3BC 3TU4A 1AOID 3WTPD 2IO5B 3AZLA 5GT0B 4H9PB 3KXBD 3A6NC 2G5HC 5AVBB 3UT9B 4YM6B 5GT0A 4H9PA 5BS7C 3LZ0D 2RIQA 5DNMC 5AVBA 3UT9A 4H9NB 4YM6A 4J8XA 4ZUXD 3V9RB 5B40D 4WZSB 3AZIA 1P34C 1P3AC 3WAAB 3KWQB 1P3PC 2VQRA 2YFVB 3TU4C 5AV6B 5GT3C 3KWQA 3AZNB 3AZLC 3AYWB 2YFVA 1TAFA 5AV6A 3W98C 3AZNA 5B31G 4WU8B 3AYWA 5GT0C 4X23D 3AFAA 4AWLB 5AVBC 5E5AB 5B31B 3UT9C 4YM6C 1M1AD 3EPLA 1M18D 4WU9C 2F8NK 5B31A 2Y2PA 5E5AA 1TZYA 5B33D 3A1IA 4EO5B 1KX5D 1KX3D 5B32D 3UTAB 3WAAC 2PYOD 3VH6W 3NQUB 2HIOB 3W96B 4Z2MG 5AV6C 1ID3D 3NQUA 3AZNC 1EQZD 3AZJD 3IP4C 1A7WA 2HIOA 3W96A 3AZHB 2XD5A 2CV5B 4J8VB 4WU8C 3AZHA 4KGCD 1T3UA 3B0CT 4AWLC 5B31C 5E5AC 4J8VA 5BNXB 4KUDB 3AZEB 3WKJB 3LJAB 4Z66D 5BNXA 2Y2GA 5B2ID 2ZY2A 3W99D 4EO5C 3REJB 3AZEA 4H9RB 3WKJA 4KUDA 3LJAA 3UTAC 3REID 3VH6A 1AOIB 3WTPB 2HIOC 3B0BA 3W96C 4H9RA 3REJA 3KXBB 1AOIA 3WTPA 3AZHC 1P3LD 3MVDD 5BT1D 3KXBA 2CV5C 4J8VC 3LZ0B 4ZUXB 4E44A 2AROD 5B40B 3LZ0A 4KUDC 3AZEC 2Y2OA 3WKJC 3LJAC 1W2EA 4G91B 4ZUXA 5B40A 3RELD 2RVQC 5B2JD 5C3IB 1AOIC 3W98D 3WTPC 3C1CB 3H0RC 4KHAB 5BNVA 4H9QB 3KXBC 3W97D 4X23B 5G49B 3C1CA 1M1AB 1M18B 4WU9D 4KHAA 4H9QA 2NQBA 3LZ0C 5B32G 1M1AA 5B33B 3X1SD 1P3FA 1P3GA 1KX5B 4ZUXC 1KX3B 5JA4B 4Z2MH 5B32B 4J8WD 2PYOB 5B33A 5B1MA 2F8ND 4G91C 1KX3A 5JA4A 3MGPD 3LELA 1P3ID 1ID3B 2PYOA 1EQZB 3AZJB 5C3IC 1ID3A 3REHD 4KGCB 4X23C 1M1AC 1M18C 5GXQA 3O62D 3AZMD 1BH8B 1P3KD 4NE5A 5B1LD 4Z66B 4ZBJB 4CSRB 4JJND 5B2IB 5B33C 2HUEC 1KX5C 2FJ7D 3W99B 1BH8A 5B32C 2ZY3A 3REKA 1KX3C 5KDMB 3REIB 4Z66A 4CSRA 5B2IA 1M19A 1Q9CA 4H9SA 1ID3C 5KDMA 1EQZC 3AZJC 1P3LB 1HQ3D 3MNND 3MVDB 5DNMB 5AVCD 4KGCC 5CP6D 5CPID 3MVDA 4LD9D 3AV1D 5DNMA 2AROB 1ZLAD 5B0ZD 1P34A 5B0YD 4WNNA 4ZBJC 2AROA 4Z66C 5B2IC 3W99C 2RVQD 5GSUD 3RELB 5B2JB 3REIC 5B24D 5GT3A 4J8UD 3W98B 5B2JA 5JRGD 3W97B 3W98A 1P3LC 4WU9B 3MVDC 2NZDD 5BT1C 3WTPE 3W97A 3AZGD 1Z2CB 4WU9A 3X1SB 1PZRA 2F8NG 2AROC 4H9NA 2UWXA 4J8WB 3X1SA 3V9RA 2F8NB 3EPKA 3MGPB 3WAAA 3EPJA 1P3IB 4J8WA 3RELC 2F8NA 5B2JC 2Y2MA 1P3IA 3REHB 3MGQD 3W97C 4WV4B 4WU8A 4YS3D 3O62B 3AZMB 1BH9B 1P3KB 5B1LB 2DQNC 3O62A 4JJNB 3AZMA 3X1SC 2FJ7B 1BH9A 5B1LA 4J8WC 4JJNA 2Y2QA 3UTAA 3MGPC 1P3IC 4DRBA 5F99C 3C1BD 1HQ3B 3MNNB 3X1VD 3REHC 5AV5D 3B6GD 4NE6A 5AVCB 1HQ3A 5CP6B 5CPIB 3MNNA 2CV5A 4LD9B 3AV1B 3O62C 3AZMC 1ZLAB 5AVCA 3AZKD 5CP6A 5B0ZB 5CPIA 1P3MD 1HTAA 1P3KC 4LD9A 5B1LC 5B0YB 4JJNC 2FJ7C 5GSUB 3KUYD 5BO0B 5AV8D 5B0YA 5B24B 5CHLB 4J8UB 2JCHA 5JRGB 1KX4D 5B24A 1HQ3C 3MNNC 2NZDB 3AZGB 5AV9D 2F8NH 4Z5TD 5AVCC 5CPIC 5CP6C 4LD9C 2NZDA 3AV1C 3AZGA 4E45A 3VH6T 1ZLAC 5B0ZC 4R8PD 5B0YC 2ZY4A 1S32D 5GSUC 3F6TA 3NQJB 5B24C 4J8UC 3MGQB 3NQJA 4XUJD 4QLCD 5JRGC 2CWEA 3MGQA 3KFUG 4YS3B 2NZDC 3AZGC 3VH5W 4X23A 5G49A 5FUGB 1M18A 2HUEB 4YS3A 5FUGA 2BYMB 2ZM5A 1KX5A 5B32A 3B6FC 5F99D 2BYMA 1JFIB 3C1BB 3X1VB 3AV2C 1EQZA 5AV5B 3MGQC 2JSSA 3AZJA 1JFIA 3B6GB 3C1BA 1WWSA 1P3OD 4J8XD 5AV5A 2YFWB 3X1UD 5AY8D 4YS3C 4KGCA 3EG5B 3AZID 3AZKB 2Y2LA 1P3MB 3WA9D 2Y2NA 3LZ1D 2YFWA 3AZKA 3KUYB 5AV8B 3W99A 3KUYA 3REIA 4G92B 1KX4B 3C1BC 3AFAD 3AL0C 3X1VC 5AV5C 5AV9B 1KX4A 1P3LA 3B6GC 4Z5TB 4UPKA 1B67A 5AV9A 1TZYD 3X1TD 3KSYA 3AZKC 1P3MC 4R8PB 1S32B 5CPJD 3KUYC 2LY8A 5AV8C 4R8PA 4DQYB 3RELA 4UUZB 1F1EA 1H3OB 4QLCB 4G92C 1KX4C 3UTBD 4HGAB 4UUZA 5AV9C 4Z5TC 4DRAA 1B6WA 1F66D 3B6FD 4R8PC 3REJD
chains in the Genus database with same CATH topology
1S32C 5F99B 3MGRD 3MGPA 3AV2D 1U35D 5F99A 4XUJC 4QLCC 1P3OB 3REHA 4HGAC 4J8XB 3MGSD 3X1UB 5AY8B 3WA9B 3AZIB 1P3OA 3LZ1B 3X1UA 5AY8A 3B0CW 3WA9A 1P3KA 3LZ1A 2FJ7A 1TAFB 2ZY5A 4XZQD 3AFAB 3C1CD 2IO5C 3H0LC 2NQBD 1P3OC 5DNND 4J8XC 2F2AC 1TZYB 2G5IC 3X1UC 3X1TB 5AY8C 1P3GD 1P3FD 3WA9C 3AZIC 3AV1A 3AZFD 2Y2HA 3LZ1C 1ZLAA 2BYKB 5B1MD 3X1TA 4WJ3C 5B0ZA 5CPJB 3LELD 1BFMA 2FFFB 3KWQC 2J8PA 2BYKA 5GSUA 5BO0A 5CPJA 4M6BA 4J8UA 3AYWC 3UTBB 5CPKD 2Y2IA 3AFAC 5JRGA 5GXQD 3UTBA 3EPHA 1TZYC 3X1TC 3REKD 1F66B 3B6FB 1M19D 3AN2D 3MGRB 5CPJC 1P3BD 1F66A 3B6FA 3AV2B 1U35B 3MGRA 3A6ND 3AV2A 3UTBC 1U35A 3FDDA 3MGSB 3B0DB 3H0MC 5DNMD 3MGSA 1P34D 1P3AD 1P3PD 1F66C 3TU4D 4CAYB 5GT3D 3REJC 3AZLD 3MGRC 2BG1A 5BNVB 4CAYA 4XZQB 1WWIA 1U35C 5GT0D 2DF4C 4XZQA 5AVBD 3UT9D 3X1VA 2NQBB 4YM6D 3A1KA 5DNNB 3B6GA 3MGSC 3B0DC 1P3GB 1P3FB 2W8SA 3VH5A 3AZFB 5DNNA 3R45B 5B1MB 1P3MA 2L5AA 5B40C 3WAAD 3KWQD 3LELB 3AZFA 3R45A 5AV6D 4NFTA 5AV8A 3AZND 3AYWD 5CPKB 2XD1A 4XZQC 3VH5T 2Y2JA 4NE3A 3C1CC 4WU8D 5GXQB 5CPKA 5B31D 5E5AD 2NQBC 5DNNC 1R4VA 4Z5TA 2Y2KA 1P3GC 1P3FC 3REKB 3AZFC 5B1MC 2JE5A 4H9OB 1M19B 3AN2B 3UTAD 1KU5A 3LELC 1P3BB 2PYOC 2HIOD 3W96D 4H9OA 1S32A 3AN2A 1ULYA 4XUJB 1P3BA 3A6NB 3AZHD 5CPKC 3P5JB 1N1JB 1H3OA 4XUJA 2CV5D 4QLCA 3A6NA 4J8VD 5GXQC 1N1JA 5BS7A 1P34B 1P3AB 4WNNB 4KUDD 3AZED 3WKJD 1P3PB 3LJAD 3REKC 3TU4B 1P3AA 5GT3B 1M19C 1P3PA 3AZLB 3AN2C 4H9SC 1P3BC 3TU4A 1AOID 3WTPD 2IO5B 3AZLA 5GT0B 4H9PB 3KXBD 3A6NC 2G5HC 5AVBB 3UT9B 4YM6B 5GT0A 4H9PA 5BS7C 3LZ0D 2RIQA 5DNMC 5AVBA 3UT9A 4H9NB 4YM6A 4J8XA 4ZUXD 3V9RB 5B40D 4WZSB 3AZIA 1P34C 1P3AC 3WAAB 3KWQB 1P3PC 2VQRA 2YFVB 3TU4C 5AV6B 5GT3C 3KWQA 3AZNB 3AZLC 3AYWB 2YFVA 1TAFA 5AV6A 3W98C 3AZNA 5B31G 4WU8B 3AYWA 5GT0C 4X23D 3AFAA 4AWLB 5AVBC 5E5AB 5B31B 3UT9C 4YM6C 1M1AD 3EPLA 1M18D 4WU9C 2F8NK 5B31A 2Y2PA 5E5AA 1TZYA 5B33D 3A1IA 4EO5B 1KX5D 1KX3D 5B32D 3UTAB 3WAAC 2PYOD 3VH6W 3NQUB 2HIOB 3W96B 4Z2MG 5AV6C 1ID3D 3NQUA 3AZNC 1EQZD 3AZJD 3IP4C 1A7WA 2HIOA 3W96A 3AZHB 2XD5A 2CV5B 4J8VB 4WU8C 3AZHA 4KGCD 1T3UA 3B0CT 4AWLC 5B31C 5E5AC 4J8VA 5BNXB 4KUDB 3AZEB 3WKJB 3LJAB 4Z66D 5BNXA 2Y2GA 5B2ID 2ZY2A 3W99D 4EO5C 3REJB 3AZEA 4H9RB 3WKJA 4KUDA 3LJAA 3UTAC 3REID 3VH6A 1AOIB 3WTPB 2HIOC 3B0BA 3W96C 4H9RA 3REJA 3KXBB 1AOIA 3WTPA 3AZHC 1P3LD 3MVDD 5BT1D 3KXBA 2CV5C 4J8VC 3LZ0B 4ZUXB 4E44A 2AROD 5B40B 3LZ0A 4KUDC 3AZEC 2Y2OA 3WKJC 3LJAC 1W2EA 4G91B 4ZUXA 5B40A 3RELD 2RVQC 5B2JD 5C3IB 1AOIC 3W98D 3WTPC 3C1CB 3H0RC 4KHAB 5BNVA 4H9QB 3KXBC 3W97D 4X23B 5G49B 3C1CA 1M1AB 1M18B 4WU9D 4KHAA 4H9QA 2NQBA 3LZ0C 5B32G 1M1AA 5B33B 3X1SD 1P3FA 1P3GA 1KX5B 4ZUXC 1KX3B 5JA4B 4Z2MH 5B32B 4J8WD 2PYOB 5B33A 5B1MA 2F8ND 4G91C 1KX3A 5JA4A 3MGPD 3LELA 1P3ID 1ID3B 2PYOA 1EQZB 3AZJB 5C3IC 1ID3A 3REHD 4KGCB 4X23C 1M1AC 1M18C 5GXQA 3O62D 3AZMD 1BH8B 1P3KD 4NE5A 5B1LD 4Z66B 4ZBJB 4CSRB 4JJND 5B2IB 5B33C 2HUEC 1KX5C 2FJ7D 3W99B 1BH8A 5B32C 2ZY3A 3REKA 1KX3C 5KDMB 3REIB 4Z66A 4CSRA 5B2IA 1M19A 1Q9CA 4H9SA 1ID3C 5KDMA 1EQZC 3AZJC 1P3LB 1HQ3D 3MNND 3MVDB 5DNMB 5AVCD 4KGCC 5CP6D 5CPID 3MVDA 4LD9D 3AV1D 5DNMA 2AROB 1ZLAD 5B0ZD 1P34A 5B0YD 4WNNA 4ZBJC 2AROA 4Z66C 5B2IC 3W99C 2RVQD 5GSUD 3RELB 5B2JB 3REIC 5B24D 5GT3A 4J8UD 3W98B 5B2JA 5JRGD 3W97B 3W98A 1P3LC 4WU9B 3MVDC 2NZDD 5BT1C 3WTPE 3W97A 3AZGD 1Z2CB 4WU9A 3X1SB 1PZRA 2F8NG 2AROC 4H9NA 2UWXA 4J8WB 3X1SA 3V9RA 2F8NB 3EPKA 3MGPB 3WAAA 3EPJA 1P3IB 4J8WA 3RELC 2F8NA 5B2JC 2Y2MA 1P3IA 3REHB 3MGQD 3W97C 4WV4B 4WU8A 4YS3D 3O62B 3AZMB 1BH9B 1P3KB 5B1LB 2DQNC 3O62A 4JJNB 3AZMA 3X1SC 2FJ7B 1BH9A 5B1LA 4J8WC 4JJNA 2Y2QA 3UTAA 3MGPC 1P3IC 4DRBA 5F99C 3C1BD 1HQ3B 3MNNB 3X1VD 3REHC 5AV5D 3B6GD 4NE6A 5AVCB 1HQ3A 5CP6B 5CPIB 3MNNA 2CV5A 4LD9B 3AV1B 3O62C 3AZMC 1ZLAB 5AVCA 3AZKD 5CP6A 5B0ZB 5CPIA 1P3MD 1HTAA 1P3KC 4LD9A 5B1LC 5B0YB 4JJNC 2FJ7C 5GSUB 3KUYD 5BO0B 5AV8D 5B0YA 5B24B 5CHLB 4J8UB 2JCHA 5JRGB 1KX4D 5B24A 1HQ3C 3MNNC 2NZDB 3AZGB 5AV9D 2F8NH 4Z5TD 5AVCC 5CPIC 5CP6C 4LD9C 2NZDA 3AV1C 3AZGA 4E45A 3VH6T 1ZLAC 5B0ZC 4R8PD 5B0YC 2ZY4A 1S32D 5GSUC 3F6TA 3NQJB 5B24C 4J8UC 3MGQB 3NQJA 4XUJD 4QLCD 5JRGC 2CWEA 3MGQA 3KFUG 4YS3B 2NZDC 3AZGC 3VH5W 4X23A 5G49A 5FUGB 1M18A 2HUEB 4YS3A 5FUGA 2BYMB 2ZM5A 1KX5A 5B32A 3B6FC 5F99D 2BYMA 1JFIB 3C1BB 3X1VB 3AV2C 1EQZA 5AV5B 3MGQC 2JSSA 3AZJA 1JFIA 3B6GB 3C1BA 1WWSA 1P3OD 4J8XD 5AV5A 2YFWB 3X1UD 5AY8D 4YS3C 4KGCA 3EG5B 3AZID 3AZKB 2Y2LA 1P3MB 3WA9D 2Y2NA 3LZ1D 2YFWA 3AZKA 3KUYB 5AV8B 3W99A 3KUYA 3REIA 4G92B 1KX4B 3C1BC 3AFAD 3AL0C 3X1VC 5AV5C 5AV9B 1KX4A 1P3LA 3B6GC 4Z5TB 4UPKA 1B67A 5AV9A 1TZYD 3X1TD 3KSYA 3AZKC 1P3MC 4R8PB 1S32B 5CPJD 3KUYC 2LY8A 5AV8C 4R8PA 4DQYB 3RELA 4UUZB 1F1EA 1H3OB 4QLCB 4G92C 1KX4C 3UTBD 4HGAB 4UUZA 5AV9C 4Z5TC 4DRAA 1B6WA 1F66D 3B6FD 4R8PC 3REJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 C;  5F99 B;  3MGR D;  3MGP A;  3AV2 D;  1U35 D;  5F99 A;  4XUJ C;  4QLC C;  1P3O B;  3REH A;  4HGA C;  4J8X B;  3MGS D;  3X1U B;  5AY8 B;  3WA9 B;  3AZI B;  1P3O A;  3LZ1 B;  3X1U A;  5AY8 A;  3B0C W;  3WA9 A;  1P3K A;  3LZ1 A;  2FJ7 A;  1TAF B;  4XZQ D;  3AFA B;  3C1C D;  2IO5 C;  2NQB D;  1P3O C;  5DNN D;  4J8X C;  1TZY B;  3X1U C;  3X1T B;  1P3G D;  5AY8 C;  1P3F D;  3WA9 C;  3AZI C;  3AV1 A;  3AZF D;  3LZ1 C;  1ZLA A;  2BYK B;  5B1M D;  3X1T A;  5B0Z A;  5CPJ B;  3LEL D;  1BFM A;  3KWQ C;  2BYK A;  5GSU A;  5BO0 A;  5CPJ A;  4M6B A;  4J8U A;  3AYW C;  3UTB B;  5CPK D;  3AFA C;  5JRG A;  5GXQ D;  3UTB A;  1TZY C;  3X1T C;  3REK D;  1F66 B;  3B6F B;  1M19 D;  3AN2 D;  3MGR B;  5CPJ C;  1P3B D;  1F66 A;  3B6F A;  3AV2 B;  1U35 B;  3MGR A;  3A6N D;  3AV2 A;  3UTB C;  1U35 A;  3MGS B;  3B0D B;  5DNM D;  3MGS A;  1P34 D;  1P3A D;  1P3P D;  1F66 C;  3TU4 D;  4CAY B;  5GT3 D;  3REJ C;  3AZL D;  3MGR C;  5BNV B;  4CAY A;  4XZQ B;  1WWI A;  1U35 C;  5GT0 D;  4XZQ A;  5AVB D;  3UT9 D;  3X1V A;  2NQB B;  4YM6 D;  5DNN B;  3B6G A;  3MGS C;  3B0D C;  1P3G B;  1P3F B;  3VH5 A;  3AZF B;  5DNN A;  3R45 B;  5B1M B;  1P3M A;  2L5A A;  5B40 C;  3WAA D;  3KWQ D;  3LEL B;  3AZF A;  3R45 A;  5AV6 D;  4NFT A;  5AV8 A;  3AZN D;  3AYW D;  5CPK B;  4XZQ C;  3VH5 T;  4NE3 A;  3C1C C;  4WU8 D;  5GXQ B;  5CPK A;  5B31 D;  5E5A D;  2NQB C;  5DNN C;  1R4V A;  4Z5T A;  1P3F C;  1P3G C;  3REK B;  3AZF C;  5B1M C;  4H9O B;  1M19 B;  3AN2 B;  3UTA D;  1KU5 A;  3LEL C;  1P3B B;  2PYO C;  2HIO D;  3W96 D;  4H9O A;  1S32 A;  3AN2 A;  1ULY A;  4XUJ B;  1P3B A;  3A6N B;  3AZH D;  5CPK C;  1N1J B;  1H3O A;  4XUJ A;  2CV5 D;  4QLC A;  3A6N A;  4J8V D;  5GXQ C;  1N1J A;  5BS7 A;  1P34 B;  1P3A B;  4WNN B;  4KUD D;  3AZE D;  3WKJ D;  1P3P B;  3LJA D;  3REK C;  3TU4 B;  1P3A A;  5GT3 B;  1M19 C;  1P3P A;  3AZL B;  3AN2 C;  4H9S C;  1P3B C;  3TU4 A;  1AOI D;  3WTP D;  2IO5 B;  3AZL A;  5GT0 B;  4H9P B;  3KXB D;  3A6N C;  5AVB B;  3UT9 B;  4YM6 B;  5GT0 A;  4H9P A;  5BS7 C;  3LZ0 D;  5DNM C;  5AVB A;  3UT9 A;  4H9N B;  4YM6 A;  4J8X A;  4ZUX D;  3V9R B;  5B40 D;  4WZS B;  3AZI A;  1P34 C;  1P3A C;  3WAA B;  3KWQ B;  1P3P C;  2YFV B;  3TU4 C;  5AV6 B;  5GT3 C;  3KWQ A;  3AZN B;  3AZL C;  3AYW B;  2YFV A;  1TAF A;  5AV6 A;  3W98 C;  3AZN A;  5B31 G;  4WU8 B;  3AYW A;  5GT0 C;  4X23 D;  3AFA A;  4AWL B;  5AVB C;  5E5A B;  5B31 B;  3UT9 C;  4YM6 C;  1M1A D;  1M18 D;  4WU9 C;  2F8N K;  5B31 A;  5E5A A;  1TZY A;  5B33 D;  4EO5 B;  1KX5 D;  1KX3 D;  5B32 D;  3UTA B;  3WAA C;  2PYO D;  3VH6 W;  3NQU B;  2HIO B;  3W96 B;  4Z2M G;  5AV6 C;  1ID3 D;  3NQU A;  3AZN C;  1EQZ D;  3AZJ D;  1A7W A;  2HIO A;  3W96 A;  3AZH B;  2CV5 B;  4J8V B;  4WU8 C;  3AZH A;  4KGC D;  3B0C T;  4AWL C;  5B31 C;  5E5A C;  4J8V A;  5BNX B;  4KUD B;  3AZE B;  3WKJ B;  3LJA B;  4Z66 D;  5BNX A;  5B2I D;  3W99 D;  4EO5 C;  3REJ B;  3AZE A;  4KUD A;  4H9R B;  3WKJ A;  3LJA A;  3UTA C;  3REI D;  3VH6 A;  1AOI B;  3WTP B;  2HIO C;  3B0B A;  3W96 C;  4H9R A;  3REJ A;  3KXB B;  1AOI A;  3WTP A;  3AZH C;  1P3L D;  3MVD D;  5BT1 D;  3KXB A;  2CV5 C;  4J8V C;  3LZ0 B;  4ZUX B;  4E44 A;  2ARO D;  5B40 B;  3LZ0 A;  4KUD C;  3AZE C;  3WKJ C;  3LJA C;  4G91 B;  4ZUX A;  5B40 A;  3REL D;  2RVQ C;  5B2J D;  5C3I B;  1AOI C;  3W98 D;  3WTP C;  3C1C B;  4KHA B;  5BNV A;  4H9Q B;  3KXB C;  3W97 D;  4X23 B;  5G49 B;  3C1C A;  1M1A B;  1M18 B;  4WU9 D;  4KHA A;  4H9Q A;  2NQB A;  3LZ0 C;  5B32 G;  1M1A A;  5B33 B;  3X1S D;  1P3F A;  1P3G A;  1KX5 B;  4ZUX C;  1KX3 B;  5JA4 B;  4Z2M H;  5B32 B;  4J8W D;  2PYO B;  5B33 A;  5B1M A;  2F8N D;  4G91 C;  1KX3 A;  5JA4 A;  3MGP D;  3LEL A;  1P3I D;  1ID3 B;  2PYO A;  1EQZ B;  3AZJ B;  5C3I C;  1ID3 A;  3REH D;  4KGC B;  4X23 C;  1M1A C;  1M18 C;  5GXQ A;  3O62 D;  3AZM D;  1BH8 B;  1P3K D;  4NE5 A;  5B1L D;  4Z66 B;  4ZBJ B;  4CSR B;  4JJN D;  5B2I B;  5B33 C;  2HUE C;  1KX5 C;  2FJ7 D;  3W99 B;  1BH8 A;  5B32 C;  3REK A;  1KX3 C;  5KDM B;  3REI B;  4Z66 A;  4CSR A;  5B2I A;  1M19 A;  1Q9C A;  4H9S A;  1ID3 C;  5KDM A;  1EQZ C;  3AZJ C;  1P3L B;  1HQ3 D;  3MNN D;  3MVD B;  5DNM B;  5AVC D;  4KGC C;  5CP6 D;  5CPI D;  3MVD A;  4LD9 D;  3AV1 D;  5DNM A;  2ARO B;  1ZLA D;  5B0Z D;  1P34 A;  5B0Y D;  4WNN A;  4ZBJ C;  2ARO A;  4Z66 C;  5B2I C;  3W99 C;  2RVQ D;  5GSU D;  3REL B;  5B2J B;  3REI C;  5B24 D;  5GT3 A;  4J8U D;  3W98 B;  5B2J A;  5JRG D;  3W97 B;  3W98 A;  1P3L C;  4WU9 B;  3MVD C;  2NZD D;  5BT1 C;  3WTP E;  3W97 A;  3AZG D;  4WU9 A;  3X1S B;  2F8N G;  2ARO C;  4H9N A;  4J8W B;  3X1S A;  3V9R A;  2F8N B;  3MGP B;  3WAA A;  1P3I B;  4J8W A;  3REL C;  2F8N A;  5B2J C;  1P3I A;  3REH B;  3MGQ D;  3W97 C;  4WV4 B;  4WU8 A;  4YS3 D;  3O62 B;  3AZM B;  1BH9 B;  1P3K B;  5B1L B;  3O62 A;  4JJN B;  3AZM A;  3X1S C;  2FJ7 B;  1BH9 A;  5B1L A;  4J8W C;  4JJN A;  3UTA A;  3MGP C;  1P3I C;  4DRB A;  5F99 C;  3C1B D;  1HQ3 B;  3MNN B;  3X1V D;  3REH C;  5AV5 D;  3B6G D;  4NE6 A;  5AVC B;  1HQ3 A;  5CP6 B;  5CPI B;  3MNN A;  2CV5 A;  4LD9 B;  3AV1 B;  3O62 C;  3AZM C;  1ZLA B;  5AVC A;  3AZK D;  5CP6 A;  5B0Z B;  5CPI A;  1P3M D;  1HTA A;  1P3K C;  4LD9 A;  5B1L C;  5B0Y B;  4JJN C;  2FJ7 C;  5GSU B;  3KUY D;  5BO0 B;  5AV8 D;  5B0Y A;  5B24 B;  5CHL B;  4J8U B;  5JRG B;  1KX4 D;  5B24 A;  1HQ3 C;  3MNN C;  2NZD B;  3AZG B;  5AV9 D;  2F8N H;  4Z5T D;  5AVC C;  5CPI C;  5CP6 C;  4LD9 C;  2NZD A;  3AV1 C;  3AZG A;  4E45 A;  3VH6 T;  1ZLA C;  5B0Z C;  4R8P D;  5B0Y C;  1S32 D;  5GSU C;  3NQJ B;  5B24 C;  4J8U C;  3MGQ B;  3NQJ A;  4XUJ D;  4QLC D;  5JRG C;  2CWE A;  3MGQ A;  4YS3 B;  2NZD C;  3AZG C;  3VH5 W;  4X23 A;  5G49 A;  5FUG B;  1M18 A;  2HUE B;  4YS3 A;  5FUG A;  2BYM B;  1KX5 A;  5B32 A;  3B6F C;  5F99 D;  2BYM A;  1JFI B;  3C1B B;  3X1V B;  3AV2 C;  1EQZ A;  5AV5 B;  3MGQ C;  2JSS A;  3AZJ A;  1JFI A;  3B6G B;  3C1B A;  1WWS A;  1P3O D;  4J8X D;  5AV5 A;  2YFW B;  3X1U D;  5AY8 D;  4YS3 C;  4KGC A;  3WA9 D;  3AZI D;  3AZK B;  1P3M B;  3LZ1 D;  2YFW A;  3AZK A;  3KUY B;  5AV8 B;  3W99 A;  3KUY A;  3REI A;  4G92 B;  1KX4 B;  3C1B C;  3AFA D;  3X1V C;  5AV5 C;  5AV9 B;  1KX4 A;  1P3L A;  3B6G C;  4Z5T B;  1B67 A;  5AV9 A;  1TZY D;  3X1T D;  3KSY A;  3AZK C;  1P3M C;  4R8P B;  1S32 B;  5CPJ D;  3KUY C;  2LY8 A;  5AV8 C;  4R8P A;  3REL A;  4UUZ B;  1F1E A;  1H3O B;  4QLC B;  4G92 C;  1KX4 C;  3UTB D;  4HGA B;  4UUZ A;  5AV9 C;  4Z5T C;  4DRA A;  1B6W A;  1F66 D;  3B6F D;  4R8P C;  3REJ D; 
#chains in the Genus database with same CATH topology
 1S32 C;  5F99 B;  3MGR D;  3MGP A;  3AV2 D;  1U35 D;  5F99 A;  4XUJ C;  4QLC C;  1P3O B;  3REH A;  4HGA C;  4J8X B;  3MGS D;  3X1U B;  5AY8 B;  3WA9 B;  3AZI B;  1P3O A;  3LZ1 B;  3X1U A;  5AY8 A;  3B0C W;  3WA9 A;  1P3K A;  3LZ1 A;  2FJ7 A;  1TAF B;  2ZY5 A;  4XZQ D;  3AFA B;  3C1C D;  2IO5 C;  3H0L C;  2NQB D;  1P3O C;  5DNN D;  4J8X C;  2F2A C;  1TZY B;  2G5I C;  3X1U C;  3X1T B;  5AY8 C;  1P3G D;  1P3F D;  3WA9 C;  3AZI C;  3AV1 A;  3AZF D;  2Y2H A;  3LZ1 C;  1ZLA A;  2BYK B;  5B1M D;  3X1T A;  4WJ3 C;  5B0Z A;  5CPJ B;  3LEL D;  1BFM A;  2FFF B;  3KWQ C;  2J8P A;  2BYK A;  5GSU A;  5BO0 A;  5CPJ A;  4M6B A;  4J8U A;  3AYW C;  3UTB B;  5CPK D;  2Y2I A;  3AFA C;  5JRG A;  5GXQ D;  3UTB A;  3EPH A;  1TZY C;  3X1T C;  3REK D;  1F66 B;  3B6F B;  1M19 D;  3AN2 D;  3MGR B;  5CPJ C;  1P3B D;  1F66 A;  3B6F A;  3AV2 B;  1U35 B;  3MGR A;  3A6N D;  3AV2 A;  3UTB C;  1U35 A;  3FDD A;  3MGS B;  3B0D B;  3H0M C;  5DNM D;  3MGS A;  1P34 D;  1P3A D;  1P3P D;  1F66 C;  3TU4 D;  4CAY B;  5GT3 D;  3REJ C;  3AZL D;  3MGR C;  2BG1 A;  5BNV B;  4CAY A;  4XZQ B;  1WWI A;  1U35 C;  5GT0 D;  2DF4 C;  4XZQ A;  5AVB D;  3UT9 D;  3X1V A;  2NQB B;  4YM6 D;  3A1K A;  5DNN B;  3B6G A;  3MGS C;  3B0D C;  1P3G B;  1P3F B;  2W8S A;  3VH5 A;  3AZF B;  5DNN A;  3R45 B;  5B1M B;  1P3M A;  2L5A A;  5B40 C;  3WAA D;  3KWQ D;  3LEL B;  3AZF A;  3R45 A;  5AV6 D;  4NFT A;  5AV8 A;  3AZN D;  3AYW D;  5CPK B;  2XD1 A;  4XZQ C;  3VH5 T;  2Y2J A;  4NE3 A;  3C1C C;  4WU8 D;  5GXQ B;  5CPK A;  5B31 D;  5E5A D;  2NQB C;  5DNN C;  1R4V A;  4Z5T A;  2Y2K A;  1P3G C;  1P3F C;  3REK B;  3AZF C;  5B1M C;  2JE5 A;  4H9O B;  1M19 B;  3AN2 B;  3UTA D;  1KU5 A;  3LEL C;  1P3B B;  2PYO C;  2HIO D;  3W96 D;  4H9O A;  1S32 A;  3AN2 A;  1ULY A;  4XUJ B;  1P3B A;  3A6N B;  3AZH D;  5CPK C;  3P5J B;  1N1J B;  1H3O A;  4XUJ A;  2CV5 D;  4QLC A;  3A6N A;  4J8V D;  5GXQ C;  1N1J A;  5BS7 A;  1P34 B;  1P3A B;  4WNN B;  4KUD D;  3AZE D;  3WKJ D;  1P3P B;  3LJA D;  3REK C;  3TU4 B;  1P3A A;  5GT3 B;  1M19 C;  1P3P A;  3AZL B;  3AN2 C;  4H9S C;  1P3B C;  3TU4 A;  1AOI D;  3WTP D;  2IO5 B;  3AZL A;  5GT0 B;  4H9P B;  3KXB D;  3A6N C;  2G5H C;  5AVB B;  3UT9 B;  4YM6 B;  5GT0 A;  4H9P A;  5BS7 C;  3LZ0 D;  2RIQ A;  5DNM C;  5AVB A;  3UT9 A;  4H9N B;  4YM6 A;  4J8X A;  4ZUX D;  3V9R B;  5B40 D;  4WZS B;  3AZI A;  1P34 C;  1P3A C;  3WAA B;  3KWQ B;  1P3P C;  2VQR A;  2YFV B;  3TU4 C;  5AV6 B;  5GT3 C;  3KWQ A;  3AZN B;  3AZL C;  3AYW B;  2YFV A;  1TAF A;  5AV6 A;  3W98 C;  3AZN A;  5B31 G;  4WU8 B;  3AYW A;  5GT0 C;  4X23 D;  3AFA A;  4AWL B;  5AVB C;  5E5A B;  5B31 B;  3UT9 C;  4YM6 C;  1M1A D;  3EPL A;  1M18 D;  4WU9 C;  2F8N K;  5B31 A;  2Y2P A;  5E5A A;  1TZY A;  5B33 D;  3A1I A;  4EO5 B;  1KX5 D;  1KX3 D;  5B32 D;  3UTA B;  3WAA C;  2PYO D;  3VH6 W;  3NQU B;  2HIO B;  3W96 B;  4Z2M G;  5AV6 C;  1ID3 D;  3NQU A;  3AZN C;  1EQZ D;  3AZJ D;  3IP4 C;  1A7W A;  2HIO A;  3W96 A;  3AZH B;  2XD5 A;  2CV5 B;  4J8V B;  4WU8 C;  3AZH A;  4KGC D;  1T3U A;  3B0C T;  4AWL C;  5B31 C;  5E5A C;  4J8V A;  5BNX B;  4KUD B;  3AZE B;  3WKJ B;  3LJA B;  4Z66 D;  5BNX A;  2Y2G A;  5B2I D;  2ZY2 A;  3W99 D;  4EO5 C;  3REJ B;  3AZE A;  4H9R B;  3WKJ A;  4KUD A;  3LJA A;  3UTA C;  3REI D;  3VH6 A;  1AOI B;  3WTP B;  2HIO C;  3B0B A;  3W96 C;  4H9R A;  3REJ A;  3KXB B;  1AOI A;  3WTP A;  3AZH C;  1P3L D;  3MVD D;  5BT1 D;  3KXB A;  2CV5 C;  4J8V C;  3LZ0 B;  4ZUX B;  4E44 A;  2ARO D;  5B40 B;  3LZ0 A;  4KUD C;  3AZE C;  2Y2O A;  3WKJ C;  3LJA C;  1W2E A;  4G91 B;  4ZUX A;  5B40 A;  3REL D;  2RVQ C;  5B2J D;  5C3I B;  1AOI C;  3W98 D;  3WTP C;  3C1C B;  3H0R C;  4KHA B;  5BNV A;  4H9Q B;  3KXB C;  3W97 D;  4X23 B;  5G49 B;  3C1C A;  1M1A B;  1M18 B;  4WU9 D;  4KHA A;  4H9Q A;  2NQB A;  3LZ0 C;  5B32 G;  1M1A A;  5B33 B;  3X1S D;  1P3F A;  1P3G A;  1KX5 B;  4ZUX C;  1KX3 B;  5JA4 B;  4Z2M H;  5B32 B;  4J8W D;  2PYO B;  5B33 A;  5B1M A;  2F8N D;  4G91 C;  1KX3 A;  5JA4 A;  3MGP D;  3LEL A;  1P3I D;  1ID3 B;  2PYO A;  1EQZ B;  3AZJ B;  5C3I C;  1ID3 A;  3REH D;  4KGC B;  4X23 C;  1M1A C;  1M18 C;  5GXQ A;  3O62 D;  3AZM D;  1BH8 B;  1P3K D;  4NE5 A;  5B1L D;  4Z66 B;  4ZBJ B;  4CSR B;  4JJN D;  5B2I B;  5B33 C;  2HUE C;  1KX5 C;  2FJ7 D;  3W99 B;  1BH8 A;  5B32 C;  2ZY3 A;  3REK A;  1KX3 C;  5KDM B;  3REI B;  4Z66 A;  4CSR A;  5B2I A;  1M19 A;  1Q9C A;  4H9S A;  1ID3 C;  5KDM A;  1EQZ C;  3AZJ C;  1P3L B;  1HQ3 D;  3MNN D;  3MVD B;  5DNM B;  5AVC D;  4KGC C;  5CP6 D;  5CPI D;  3MVD A;  4LD9 D;  3AV1 D;  5DNM A;  2ARO B;  1ZLA D;  5B0Z D;  1P34 A;  5B0Y D;  4WNN A;  4ZBJ C;  2ARO A;  4Z66 C;  5B2I C;  3W99 C;  2RVQ D;  5GSU D;  3REL B;  5B2J B;  3REI C;  5B24 D;  5GT3 A;  4J8U D;  3W98 B;  5B2J A;  5JRG D;  3W97 B;  3W98 A;  1P3L C;  4WU9 B;  3MVD C;  2NZD D;  5BT1 C;  3WTP E;  3W97 A;  3AZG D;  1Z2C B;  4WU9 A;  3X1S B;  1PZR A;  2F8N G;  2ARO C;  4H9N A;  2UWX A;  4J8W B;  3X1S A;  3V9R A;  2F8N B;  3EPK A;  3MGP B;  3WAA A;  3EPJ A;  1P3I B;  4J8W A;  3REL C;  2F8N A;  5B2J C;  2Y2M A;  1P3I A;  3REH B;  3MGQ D;  3W97 C;  4WV4 B;  4WU8 A;  4YS3 D;  3O62 B;  3AZM B;  1BH9 B;  1P3K B;  5B1L B;  2DQN C;  3O62 A;  4JJN B;  3AZM A;  3X1S C;  2FJ7 B;  1BH9 A;  5B1L A;  4J8W C;  4JJN A;  2Y2Q A;  3UTA A;  3MGP C;  1P3I C;  4DRB A;  5F99 C;  3C1B D;  1HQ3 B;  3MNN B;  3X1V D;  3REH C;  5AV5 D;  3B6G D;  4NE6 A;  5AVC B;  1HQ3 A;  5CP6 B;  5CPI B;  3MNN A;  2CV5 A;  4LD9 B;  3AV1 B;  3O62 C;  3AZM C;  1ZLA B;  5AVC A;  3AZK D;  5CP6 A;  5B0Z B;  5CPI A;  1P3M D;  1HTA A;  1P3K C;  4LD9 A;  5B1L C;  5B0Y B;  4JJN C;  2FJ7 C;  5GSU B;  3KUY D;  5BO0 B;  5AV8 D;  5B0Y A;  5B24 B;  5CHL B;  4J8U B;  2JCH A;  5JRG B;  1KX4 D;  5B24 A;  1HQ3 C;  3MNN C;  2NZD B;  3AZG B;  5AV9 D;  2F8N H;  4Z5T D;  5AVC C;  5CPI C;  5CP6 C;  4LD9 C;  2NZD A;  3AV1 C;  3AZG A;  4E45 A;  3VH6 T;  1ZLA C;  5B0Z C;  4R8P D;  5B0Y C;  2ZY4 A;  1S32 D;  5GSU C;  3F6T A;  3NQJ B;  5B24 C;  4J8U C;  3MGQ B;  3NQJ A;  4XUJ D;  4QLC D;  5JRG C;  2CWE A;  3MGQ A;  3KFU G;  4YS3 B;  2NZD C;  3AZG C;  3VH5 W;  4X23 A;  5G49 A;  5FUG B;  1M18 A;  2HUE B;  4YS3 A;  5FUG A;  2BYM B;  2ZM5 A;  1KX5 A;  5B32 A;  3B6F C;  5F99 D;  2BYM A;  1JFI B;  3C1B B;  3X1V B;  3AV2 C;  1EQZ A;  5AV5 B;  3MGQ C;  2JSS A;  3AZJ A;  1JFI A;  3B6G B;  3C1B A;  1WWS A;  1P3O D;  4J8X D;  5AV5 A;  2YFW B;  3X1U D;  5AY8 D;  4YS3 C;  4KGC A;  3EG5 B;  3AZI D;  3AZK B;  2Y2L A;  1P3M B;  3WA9 D;  2Y2N A;  3LZ1 D;  2YFW A;  3AZK A;  3KUY B;  5AV8 B;  3W99 A;  3KUY A;  3REI A;  4G92 B;  1KX4 B;  3C1B C;  3AFA D;  3AL0 C;  3X1V C;  5AV5 C;  5AV9 B;  1KX4 A;  1P3L A;  3B6G C;  4Z5T B;  4UPK A;  1B67 A;  5AV9 A;  1TZY D;  3X1T D;  3KSY A;  3AZK C;  1P3M C;  4R8P B;  1S32 B;  5CPJ D;  3KUY C;  2LY8 A;  5AV8 C;  4R8P A;  4DQY B;  3REL A;  4UUZ B;  1F1E A;  1H3O B;  4QLC B;  4G92 C;  1KX4 C;  3UTB D;  4HGA B;  4UUZ A;  5AV9 C;  4Z5T C;  4DRA A;  1B6W A;  1F66 D;  3B6F D;  4R8P C;  3REJ D; 
#chains in the Genus database with same CATH homology
 1S32 C;  5F99 B;  3MGR D;  3MGP A;  3AV2 D;  1U35 D;  5F99 A;  4XUJ C;  4QLC C;  1P3O B;  3REH A;  4HGA C;  4J8X B;  3MGS D;  3X1U B;  5AY8 B;  3WA9 B;  3AZI B;  1P3O A;  3LZ1 B;  3X1U A;  5AY8 A;  3B0C W;  3WA9 A;  1P3K A;  3LZ1 A;  2FJ7 A;  1TAF B;  2ZY5 A;  4XZQ D;  3AFA B;  3C1C D;  2IO5 C;  3H0L C;  2NQB D;  1P3O C;  5DNN D;  4J8X C;  2F2A C;  1TZY B;  2G5I C;  3X1U C;  3X1T B;  5AY8 C;  1P3G D;  1P3F D;  3WA9 C;  3AZI C;  3AV1 A;  3AZF D;  2Y2H A;  3LZ1 C;  1ZLA A;  2BYK B;  5B1M D;  3X1T A;  4WJ3 C;  5B0Z A;  5CPJ B;  3LEL D;  1BFM A;  2FFF B;  3KWQ C;  2J8P A;  2BYK A;  5GSU A;  5BO0 A;  5CPJ A;  4M6B A;  4J8U A;  3AYW C;  3UTB B;  5CPK D;  2Y2I A;  3AFA C;  5JRG A;  5GXQ D;  3UTB A;  3EPH A;  1TZY C;  3X1T C;  3REK D;  1F66 B;  3B6F B;  1M19 D;  3AN2 D;  3MGR B;  5CPJ C;  1P3B D;  1F66 A;  3B6F A;  3AV2 B;  1U35 B;  3MGR A;  3A6N D;  3AV2 A;  3UTB C;  1U35 A;  3FDD A;  3MGS B;  3B0D B;  3H0M C;  5DNM D;  3MGS A;  1P34 D;  1P3A D;  1P3P D;  1F66 C;  3TU4 D;  4CAY B;  5GT3 D;  3REJ C;  3AZL D;  3MGR C;  2BG1 A;  5BNV B;  4CAY A;  4XZQ B;  1WWI A;  1U35 C;  5GT0 D;  2DF4 C;  4XZQ A;  5AVB D;  3UT9 D;  3X1V A;  2NQB B;  4YM6 D;  3A1K A;  5DNN B;  3B6G A;  3MGS C;  3B0D C;  1P3G B;  1P3F B;  2W8S A;  3VH5 A;  3AZF B;  5DNN A;  3R45 B;  5B1M B;  1P3M A;  2L5A A;  5B40 C;  3WAA D;  3KWQ D;  3LEL B;  3AZF A;  3R45 A;  5AV6 D;  4NFT A;  5AV8 A;  3AZN D;  3AYW D;  5CPK B;  2XD1 A;  4XZQ C;  3VH5 T;  2Y2J A;  4NE3 A;  3C1C C;  4WU8 D;  5GXQ B;  5CPK A;  5B31 D;  5E5A D;  2NQB C;  5DNN C;  1R4V A;  4Z5T A;  2Y2K A;  1P3G C;  1P3F C;  3REK B;  3AZF C;  5B1M C;  2JE5 A;  4H9O B;  1M19 B;  3AN2 B;  3UTA D;  1KU5 A;  3LEL C;  1P3B B;  2PYO C;  2HIO D;  3W96 D;  4H9O A;  1S32 A;  3AN2 A;  1ULY A;  4XUJ B;  1P3B A;  3A6N B;  3AZH D;  5CPK C;  3P5J B;  1N1J B;  1H3O A;  4XUJ A;  2CV5 D;  4QLC A;  3A6N A;  4J8V D;  5GXQ C;  1N1J A;  5BS7 A;  1P34 B;  1P3A B;  4WNN B;  4KUD D;  3AZE D;  3WKJ D;  1P3P B;  3LJA D;  3REK C;  3TU4 B;  1P3A A;  5GT3 B;  1M19 C;  1P3P A;  3AZL B;  3AN2 C;  4H9S C;  1P3B C;  3TU4 A;  1AOI D;  3WTP D;  2IO5 B;  3AZL A;  5GT0 B;  4H9P B;  3KXB D;  3A6N C;  2G5H C;  5AVB B;  3UT9 B;  4YM6 B;  5GT0 A;  4H9P A;  5BS7 C;  3LZ0 D;  2RIQ A;  5DNM C;  5AVB A;  3UT9 A;  4H9N B;  4YM6 A;  4J8X A;  4ZUX D;  3V9R B;  5B40 D;  4WZS B;  3AZI A;  1P34 C;  1P3A C;  3WAA B;  3KWQ B;  1P3P C;  2VQR A;  2YFV B;  3TU4 C;  5AV6 B;  5GT3 C;  3KWQ A;  3AZN B;  3AZL C;  3AYW B;  2YFV A;  1TAF A;  5AV6 A;  3W98 C;  3AZN A;  5B31 G;  4WU8 B;  3AYW A;  5GT0 C;  4X23 D;  3AFA A;  4AWL B;  5AVB C;  5E5A B;  5B31 B;  3UT9 C;  4YM6 C;  1M1A D;  3EPL A;  1M18 D;  4WU9 C;  2F8N K;  5B31 A;  2Y2P A;  5E5A A;  1TZY A;  5B33 D;  3A1I A;  4EO5 B;  1KX5 D;  1KX3 D;  5B32 D;  3UTA B;  3WAA C;  2PYO D;  3VH6 W;  3NQU B;  2HIO B;  3W96 B;  4Z2M G;  5AV6 C;  1ID3 D;  3NQU A;  3AZN C;  1EQZ D;  3AZJ D;  3IP4 C;  1A7W A;  2HIO A;  3W96 A;  3AZH B;  2XD5 A;  2CV5 B;  4J8V B;  4WU8 C;  3AZH A;  4KGC D;  1T3U A;  3B0C T;  4AWL C;  5B31 C;  5E5A C;  4J8V A;  5BNX B;  4KUD B;  3AZE B;  3WKJ B;  3LJA B;  4Z66 D;  5BNX A;  2Y2G A;  5B2I D;  2ZY2 A;  3W99 D;  4EO5 C;  3REJ B;  3AZE A;  4H9R B;  3WKJ A;  4KUD A;  3LJA A;  3UTA C;  3REI D;  3VH6 A;  1AOI B;  3WTP B;  2HIO C;  3B0B A;  3W96 C;  4H9R A;  3REJ A;  3KXB B;  1AOI A;  3WTP A;  3AZH C;  1P3L D;  3MVD D;  5BT1 D;  3KXB A;  2CV5 C;  4J8V C;  3LZ0 B;  4ZUX B;  4E44 A;  2ARO D;  5B40 B;  3LZ0 A;  4KUD C;  3AZE C;  2Y2O A;  3WKJ C;  3LJA C;  1W2E A;  4G91 B;  4ZUX A;  5B40 A;  3REL D;  2RVQ C;  5B2J D;  5C3I B;  1AOI C;  3W98 D;  3WTP C;  3C1C B;  3H0R C;  4KHA B;  5BNV A;  4H9Q B;  3KXB C;  3W97 D;  4X23 B;  5G49 B;  3C1C A;  1M1A B;  1M18 B;  4WU9 D;  4KHA A;  4H9Q A;  2NQB A;  3LZ0 C;  5B32 G;  1M1A A;  5B33 B;  3X1S D;  1P3F A;  1P3G A;  1KX5 B;  4ZUX C;  1KX3 B;  5JA4 B;  4Z2M H;  5B32 B;  4J8W D;  2PYO B;  5B33 A;  5B1M A;  2F8N D;  4G91 C;  1KX3 A;  5JA4 A;  3MGP D;  3LEL A;  1P3I D;  1ID3 B;  2PYO A;  1EQZ B;  3AZJ B;  5C3I C;  1ID3 A;  3REH D;  4KGC B;  4X23 C;  1M1A C;  1M18 C;  5GXQ A;  3O62 D;  3AZM D;  1BH8 B;  1P3K D;  4NE5 A;  5B1L D;  4Z66 B;  4ZBJ B;  4CSR B;  4JJN D;  5B2I B;  5B33 C;  2HUE C;  1KX5 C;  2FJ7 D;  3W99 B;  1BH8 A;  5B32 C;  2ZY3 A;  3REK A;  1KX3 C;  5KDM B;  3REI B;  4Z66 A;  4CSR A;  5B2I A;  1M19 A;  1Q9C A;  4H9S A;  1ID3 C;  5KDM A;  1EQZ C;  3AZJ C;  1P3L B;  1HQ3 D;  3MNN D;  3MVD B;  5DNM B;  5AVC D;  4KGC C;  5CP6 D;  5CPI D;  3MVD A;  4LD9 D;  3AV1 D;  5DNM A;  2ARO B;  1ZLA D;  5B0Z D;  1P34 A;  5B0Y D;  4WNN A;  4ZBJ C;  2ARO A;  4Z66 C;  5B2I C;  3W99 C;  2RVQ D;  5GSU D;  3REL B;  5B2J B;  3REI C;  5B24 D;  5GT3 A;  4J8U D;  3W98 B;  5B2J A;  5JRG D;  3W97 B;  3W98 A;  1P3L C;  4WU9 B;  3MVD C;  2NZD D;  5BT1 C;  3WTP E;  3W97 A;  3AZG D;  1Z2C B;  4WU9 A;  3X1S B;  1PZR A;  2F8N G;  2ARO C;  4H9N A;  2UWX A;  4J8W B;  3X1S A;  3V9R A;  2F8N B;  3EPK A;  3MGP B;  3WAA A;  3EPJ A;  1P3I B;  4J8W A;  3REL C;  2F8N A;  5B2J C;  2Y2M A;  1P3I A;  3REH B;  3MGQ D;  3W97 C;  4WV4 B;  4WU8 A;  4YS3 D;  3O62 B;  3AZM B;  1BH9 B;  1P3K B;  5B1L B;  2DQN C;  3O62 A;  4JJN B;  3AZM A;  3X1S C;  2FJ7 B;  1BH9 A;  5B1L A;  4J8W C;  4JJN A;  2Y2Q A;  3UTA A;  3MGP C;  1P3I C;  4DRB A;  5F99 C;  3C1B D;  1HQ3 B;  3MNN B;  3X1V D;  3REH C;  5AV5 D;  3B6G D;  4NE6 A;  5AVC B;  1HQ3 A;  5CP6 B;  5CPI B;  3MNN A;  2CV5 A;  4LD9 B;  3AV1 B;  3O62 C;  3AZM C;  1ZLA B;  5AVC A;  3AZK D;  5CP6 A;  5B0Z B;  5CPI A;  1P3M D;  1HTA A;  1P3K C;  4LD9 A;  5B1L C;  5B0Y B;  4JJN C;  2FJ7 C;  5GSU B;  3KUY D;  5BO0 B;  5AV8 D;  5B0Y A;  5B24 B;  5CHL B;  4J8U B;  2JCH A;  5JRG B;  1KX4 D;  5B24 A;  1HQ3 C;  3MNN C;  2NZD B;  3AZG B;  5AV9 D;  2F8N H;  4Z5T D;  5AVC C;  5CPI C;  5CP6 C;  4LD9 C;  2NZD A;  3AV1 C;  3AZG A;  4E45 A;  3VH6 T;  1ZLA C;  5B0Z C;  4R8P D;  5B0Y C;  2ZY4 A;  1S32 D;  5GSU C;  3F6T A;  3NQJ B;  5B24 C;  4J8U C;  3MGQ B;  3NQJ A;  4XUJ D;  4QLC D;  5JRG C;  2CWE A;  3MGQ A;  3KFU G;  4YS3 B;  2NZD C;  3AZG C;  3VH5 W;  4X23 A;  5G49 A;  5FUG B;  1M18 A;  2HUE B;  4YS3 A;  5FUG A;  2BYM B;  2ZM5 A;  1KX5 A;  5B32 A;  3B6F C;  5F99 D;  2BYM A;  1JFI B;  3C1B B;  3X1V B;  3AV2 C;  1EQZ A;  5AV5 B;  3MGQ C;  2JSS A;  3AZJ A;  1JFI A;  3B6G B;  3C1B A;  1WWS A;  1P3O D;  4J8X D;  5AV5 A;  2YFW B;  3X1U D;  5AY8 D;  4YS3 C;  4KGC A;  3EG5 B;  3AZI D;  3AZK B;  2Y2L A;  1P3M B;  3WA9 D;  2Y2N A;  3LZ1 D;  2YFW A;  3AZK A;  3KUY B;  5AV8 B;  3W99 A;  3KUY A;  3REI A;  4G92 B;  1KX4 B;  3C1B C;  3AFA D;  3AL0 C;  3X1V C;  5AV5 C;  5AV9 B;  1KX4 A;  1P3L A;  3B6G C;  4Z5T B;  4UPK A;  1B67 A;  5AV9 A;  1TZY D;  3X1T D;  3KSY A;  3AZK C;  1P3M C;  4R8P B;  1S32 B;  5CPJ D;  3KUY C;  2LY8 A;  5AV8 C;  4R8P A;  4DQY B;  3REL A;  4UUZ B;  1F1E A;  1H3O B;  4QLC B;  4G92 C;  1KX4 C;  3UTB D;  4HGA B;  4UUZ A;  5AV9 C;  4Z5T C;  4DRA A;  1B6W A;  1F66 D;  3B6F D;  4R8P C;  3REJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...