5B31B

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31B00
4WU8C 3AZFD 5AV5B 4J8VC 2NZDA 3WKJB 4J8UD 2HUEC 3MVDB 5GT3C 3MGQC 1P3KA 3LELD 2PYOA 5GT0A 3X1SD 3AZHD 2F8ND 4X23A 5B24D 2YFWB 4KUDA 3UTAC 1P3GD 1P3AD 5C3IB 5CP6C 3AZFA 5CPKB 5B2IB 5CPID 3A6NA 3AZNC 1U35B 4YM6B 3X1SA 3AZHA 3WA9D 2F8NA 3AZID 2NQBD 1P3IB 5CPJD 1P3GA 5KDMB 1P3AA 1KX5B 1ID3D 5CPIA 5BS7A 3MGPD 3REID 5E5AB 2CWEA 3KUYA 3WTPC 3UTBA 3WA9A 1P3FC 5DNMC 5AV9B 3AZIA 2NQBA 5B0YD 4H9SA 3AV1B 1KX3C 3MGSB 3TU4C 4UUZA 1ID3A 4QLCD 5JA4B 5B1LC 4ZBJB 3MGPA 3X1TB 3REIA 4XZQD 3C1CB 5AV8A 1P3PD 3W98B 4KGCA 5B2JD 1HQ3A 5AV5D 5B31B 3X1UA 5B0YA 2F8NG 4H9NA 5AY8D 4M6BA 2LY8A 3AFAB 3UT9C 4QLCA 5JRGB 3RELA 1KX4A 1P3KC 5B2JA 2FJ7A 2PYOC 5GT0C 5B2ID 4X23C 3REJA 5AY8A 4KUDC 4YM6D 3MNNB 3AZFC 3W97A 3A6NC 3AZEB 2YFWA 3KSYA 4J8UC 4JJND 4G92C 3AZLD 4KUDD 1KX5D 3LELC 3KWQB 5B32G 3X1SC 3AZHC 3AN2D 5B1MD 3C1BB 3B6GB 5E5AD 5B24C 4H9OA 1P3GC 5B33B 1P3AC 4NE6A 3WTPE 5CPIC 5BS7C 3AV1D 5AV6D 4J8VA 3B0CT 4XUJB 4JJNA 4WNNB 5AVCD 3MGRA 3AZLA 4CAYB 5GSUB 3WA9C 3X1TD 3W98D 3AN2A 5B1MA 3AZIC 3C1CD 3B0CW 3W99A 4H9SC 2NQBC 3B6FB 5G49A 5CPJC 4G91C 1M1AD 1ID3C 5B31D 3NQJB 4H9QB 5B40B 5AV6A 3MGPC 3REIC 5AV8C 3R45A 5AVCA 2YFVA 3AFAD 3KXBD 4KGCC 1ZLAB 5JRGD 3B0DB 5BNXB 4DRAA 5B0YC 4WU9B 4H9RA 3REKB 5DNNB 1M1AA 4QLCC 4LD9B 1P3PC 5F99B 1P3BB 1BH8B 1KX4C 3KXBA 3MNND 3AZJB 1N1JB 5B2JC 3WTPA 3X1VB 3AZED 3AYWD 1EQZC 5AY8C 3TU4A 3LZ1B 3KWQD 1AOIA 3VH5A 2AROD 5B33D 1AOIC 3AZGB 5B2IC 5B0ZB 3AZEA 4J8XB 3AYWA 1P3LB 3V9RB 4XUJD 1M18D 5GSUD 4YM6C 4CSRB 1A7WA 1M19B 4Z66B 3B6FD 2IO5C 2AROA 3NQUB 4JJNC 3MGRC 5B33A 3AZLC 1P34B 4H9PA 1S32D 5B40D 3AN2C 5B1MC 3W99C 5E5AC 2CV5B 1M18A 1P3OB 1TAFA 1ZLAD 5AV6C 3B6FA 5GXQB 4J8UA 5AVCC 1F66B 4HGAB 3VH5T 1BFMA 5DNND 4R8PB 3LELA 1S32A 3X1TC 4ZBJC 3C1CC 4WV4B 5F99D 5B24A 5BO0A 3VH5W 2BYKB 3AZJD 5BNVB 4Z5TD 1M1AC 4EO5B 5B31C 1B6WA 3AZMD 3AFAC 3LZ1D 3KXBC 5JRGC 2JSSA 3LJAB 4YS3D 1BH9B 5CPJA 4Z5TA 3AZGD 5AVBB 5B0ZD 3REHD 1P3LD 1EQZB 4WU8B 3AZMA 3WAAD 3LZ1A 3LZ0B 1M19D 2HUEB 3AZEC 3AYWC 3MGQB 3WKJD 2HIOB 3AZKB 4YS3A 1B67A 4J8WB 3MVDD 1P34D 2BYMB 5B0ZA 3REHA 1JFIB 3UTAB 4XZQA 1P3PA 2CV5D 5CP6B 4KHAA 2AROC 3WAAA 1WWIA 5B33C 1P3OD 3AZNB 5CPKD 5AV5A 5GXQD 3WKJA 4XUJC 1M18C 3MVDA 5GSUC 1U35D 2CV5A 3B6FC 1P3ID 1P3OA 3AV2B 5CPKA 1S32C 5B2IA 5B40C 1KU5A 1H3OB 5DNMB 1P3FB 1U35A 4NFTA 4YM6A 5AV9D 3MGSD 1P3IA 5B1LB 5KDMA 5DNNC 1KX5A 5AVBD 5F99C 1EQZD 5E5AA 3LZ0D 1P3MB 4Z5TC 5AV9A 3AV1A 2HIOD 3AZKD 3UT9B 3MGSA 4J8WD 3AZMC 3LZ1C 2NZDB 5JA4A 3X1TA 3UTAD 3W98A 3C1CA 1P3KB 4YS3C 2PYOB 3LZ0A 3AZND 5B0ZC 3REHC 5B31A 3AZKA 4XZQC 4AWLB 3AZFB 3WAAC 3AFAA 3A6NB 5JRGA 4G92B 5AV5C 3WKJC 1P34C 3X1SB 3MVDC 2F8NB 5CHLB 3AV2D 3VH6T 1R4VA 5FUGB 1WWSA 3B6GD 3C1BD 2CV5C 3O62B 1P3FD 1P3OC 4Z2MH 1ULYA 3MNNA 5C3IC 5CPKC 3KUYB 3UTBB 3AZIB 1U35C 3AV2A 3KWQA 4UUZB 5B31G 3C1BA 3B6GA 1ID3B 1P3IC 3MGPB 1P3MD 3REIB 2F8NK 5AV8B 1KX5C 4DRBA 4EO5C 4KGCB 5B32B 4XUJA 1HQ3B 4WNNA 5BT1D 4CAYA 5GSUA 3X1UB 2NZDD 4H9NB 5AV9C 3AV1C 4WU9D 1P3KD 2PYOD 3REKD 3MGSC 4QLCB 3B0BA 3RELB 1KX4B 3NQJA 4H9QA 1TZYB 5B40A 3W98C 4LD9D 2FJ7B 5B2JB 1P3BD 3LZ0C 3A6ND 3REJB 1ZLAA 5BNXA 5AY8B 3X1VD 4WU9A 2HIOC 3AZKC 3REKA 4J8WC 3W97B 5DNNA 4LD9A 5F99A 1P3BA 3O62D 1BH8A 3AZJA 1N1JA 3W96B 4WZSB 3X1VA 4H9OB 4ZUXB 3KUYD 4J8XD 3UTBD 4J8VB 3MNNC 5FUGA 2IO5B 4JJNB 3AZLB 3MGRB 4Z66D 5GT3B 3O62A 3AN2B 5B1MB 4Z2MG 3W99B 5AV8D 3AV2C 3KWQC 3AZGA 5G49B 4J8XA 1P3LA 3C1BC 3V9RA 3B6GC 5B32D 4KGCD 1HQ3D 2L5AA 3X1UD 5AV6B 4CSRA 3R45B 5AVCB 2YFVB 1M19A 4Z66A 3NQUA 1P34A 1F66D 2RVQD 4R8PD 3RELD 1KX4D 1HTAA 4H9RB 1TZYD 5B32A 2FJ7D 1F1EA 1M1AB 1P3MC 3REJD 4E45A 3KXBB 5GXQA 4NE5A 3WTPB 1F66A 5BT1C 3W97D 2NZDC 4R8PA 1ZLAC 1KX3B 3B0DC 1TZYA 3LJAD 3TU4B 4WU9C 3REKC 1AOIB 2BYKA 5BNVA 3W96D 4E44A 4ZUXD 4LD9C 1P3BC 4AWLC 4WU8D 3VH6A 3AYWB 4J8VD 3AZJC 3X1VC 3LJAA 3MGRD 5GT3D 3MGQD 1BH9A 3W99D 3W96A 5AVBA 4ZUXA 2AROB 1EQZA 3O62C 5CP6D 4H9PB 4WU8A 5GT0B 4X23B 3AZGC 1M18B 3KUYC 5GT3A 4J8XC 3MGQA 1P3LC 2HIOA 1TAFB 3UTBC 4KUDB 4J8WA 2BYMA 1JFIA 4J8UB 3UTAA 1M19C 4Z66C 5CP6A 3LELB 1S32B 3AZHB 5B24B 5BO0B 3AZNA 1P3GB 5B32C 1P3AB 1HQ3C 3WTPD 5DNMD 3X1UC 5CPIB 1KX3D 3VH6W 3TU4D 5GXQC 1AOID 1F66C 4HGAC 4NE3A 5B1LD 3WA9B 2NQBB 2RVQC 4R8PC 3RELC 1TZYC 5CPJB 4G91B 2FJ7C 1Q9CA 4Z5TB 1H3OA 5DNMA 1P3FA 3REJC 1KX3A 3AZMB 3UT9D 5B1LA 3W97C 5B0YB 2F8NH 4YS3B 3LJAC 3REHB 5GT0D 1P3MA 4X23D 3W96C 4XZQB 1P3PB 5AVBC 4KHAB 4ZUXC 3WAAB 3UT9A
chains in the Genus database with same CATH superfamily
4WU8C 3AZFD 5AV5B 4J8VC 2NZDA 3WKJB 4J8UD 2HUEC 3MVDB 5GT3C 3MGQC 1P3KA 3LELD 2PYOA 5GT0A 2ZY2A 3X1SD 3AZHD 2F8ND 4X23A 5B24D 2YFWB 4KUDA 3UTAC 1P3GD 1P3AD 5C3IB 5CP6C 3AZFA 5CPKB 5B2IB 5CPID 3A6NA 3AZNC 1U35B 4YM6B 3X1SA 3AZHA 3WA9D 2F8NA 3AZID 2NQBD 1P3IB 5CPJD 1P3GA 5KDMB 1P3AA 1KX5B 1ID3D 5CPIA 5BS7A 3MGPD 3REID 5E5AB 2CWEA 3KUYA 3WTPC 3UTBA 3WA9A 1P3FC 5DNMC 5AV9B 3AZIA 2NQBA 5B0YD 4H9SA 3AV1B 1KX3C 3MGSB 3TU4C 2Y2QA 4UUZA 1ID3A 4QLCD 5JA4B 5B1LC 4ZBJB 3MGPA 3X1TB 3REIA 4XZQD 3C1CB 5AV8A 1P3PD 3W98B 4KGCA 5B2JD 1HQ3A 5AV5D 5B31B 5B0YA 3X1UA 2F8NG 4H9NA 5AY8D 4M6BA 2LY8A 3AFAB 3UT9C 4QLCA 5JRGB 3RELA 2ZY3A 1KX4A 3A1KA 1P3KC 5B2JA 2FJ7A 2PYOC 5GT0C 5B2ID 4X23C 3REJA 5AY8A 4KUDC 4YM6D 3MNNB 3AZFC 3W97A 3A6NC 3AZEB 2YFWA 3KSYA 4J8UC 4JJND 4G92C 3AZLD 4KUDD 1KX5D 3LELC 3KWQB 5B32G 3X1SC 3AZHC 3AN2D 5B1MD 3C1BB 3B6GB 5E5AD 3H0LC 5B24C 4H9OA 1P3GC 5B33B 1P3AC 4NE6A 3WTPE 5CPIC 5BS7C 3AV1D 5AV6D 4J8VA 3B0CT 4XUJB 4JJNA 4WNNB 5AVCD 3MGRA 3AZLA 4CAYB 5GSUB 3WA9C 3X1TD 3W98D 3AN2A 5B1MA 3AZIC 3C1CD 3B0CW 3W99A 4H9SC 2NQBC 3B6FB 5G49A 5CPJC 4G91C 1M1AD 1ID3C 5B31D 3NQJB 4H9QB 5B40B 5AV6A 2G5HC 3MGPC 3REIC 5AV8C 3R45A 5AVCA 2YFVA 3AFAD 3KXBD 4KGCC 1ZLAB 5JRGD 3B0DB 5BNXB 4DRAA 5B0YC 4WU9B 4H9RA 3REKB 5DNNB 1M1AA 4QLCC 4LD9B 1P3PC 5F99B 1P3BB 1BH8B 1KX4C 3KXBA 2VQRA 3MNND 1N1JB 5B2JC 3WTPA 3AZJB 2Y2LA 3X1VB 3H0RC 3AZED 3AYWD 1EQZC 5AY8C 3TU4A 3LZ1B 3KWQD 1AOIA 3VH5A 2AROD 5B33D 1AOIC 3AZGB 5B2IC 5B0ZB 3AZEA 2RIQA 4J8XB 3AYWA 1P3LB 3V9RB 4XUJD 1M18D 5GSUD 4YM6C 4CSRB 1A7WA 1M19B 4Z66B 3B6FD 2IO5C 2AROA 3NQUB 4JJNC 3MGRC 5B33A 3AZLC 1P34B 4H9PA 1S32D 5B40D 3AN2C 5B1MC 3W99C 5E5AC 2CV5B 1M18A 1P3OB 1TAFA 1ZLAD 2Y2HA 5AV6C 3B6FA 5GXQB 4J8UA 5AVCC 1F66B 4HGAB 3VH5T 1BFMA 5DNND 4R8PB 3LELA 1Z2CB 1S32A 3X1TC 4ZBJC 3C1CC 4WV4B 5F99D 2BG1A 5B24A 5BO0A 3VH5W 2BYKB 3AZJD 5BNVB 4Z5TD 1M1AC 2Y2IA 4EO5B 5B31C 1B6WA 3AZMD 3AFAC 3LZ1D 3KXBC 5JRGC 2JSSA 3LJAB 4YS3D 1BH9B 3EPKA 5CPJA 4Z5TA 3AZGD 5AVBB 5B0ZD 3REHD 1P3LD 1EQZB 4WU8B 3AZMA 3EPJA 3LZ1A 3LZ0B 3WAAD 1M19D 2HUEB 3AZEC 3AYWC 3MGQB 3WKJD 2HIOB 3AZKB 4YS3A 1B67A 4J8WB 3MVDD 1P34D 2BYMB 5B0ZA 3REHA 1JFIB 3UTAB 4XZQA 1P3PA 2CV5D 5CP6B 4KHAA 2AROC 3WAAA 1WWIA 5B33C 1P3OD 3AZNB 5CPKD 5AV5A 5GXQD 3WKJA 4XUJC 1M18C 3MVDA 5GSUC 1U35D 2W8SA 2CV5A 3B6FC 1P3ID 1P3OA 3AV2B 3P5JB 5CPKA 5B2IA 5B40C 1S32C 2DF4C 1KU5A 1H3OB 5DNMB 1P3FB 2Y2PA 1U35A 4NFTA 4YM6A 3A1IA 5AV9D 3MGSD 1P3IA 5B1LB 5KDMA 5DNNC 1KX5A 5AVBD 5F99C 1EQZD 5E5AA 3LZ0D 1P3MB 4Z5TC 5AV9A 3AV1A 2HIOD 3AZKD 3UT9B 3MGSA 4J8WD 3AZMC 3LZ1C 2NZDB 2ZM5A 5JA4A 3X1TA 3UTAD 3W98A 3C1CA 1P3KB 4YS3C 2PYOB 3LZ0A 3AZND 5B0ZC 3REHC 5B31A 3AZKA 4XZQC 3FDDA 4AWLB 3AZFB 3WAAC 3AFAA 3A6NB 5JRGA 4G92B 5AV5C 3WKJC 1P34C 3X1SB 3MVDC 2F8NB 3KFUG 5CHLB 3AV2D 3VH6T 1R4VA 5FUGB 1WWSA 3B6GD 3C1BD 3F6TA 2CV5C 3O62B 1P3FD 1P3OC 4Z2MH 1ULYA 3MNNA 2ZY4A 5C3IC 5CPKC 3KUYB 3UTBB 2JE5A 3AZIB 1U35C 3AV2A 3KWQA 4UUZB 5B31G 3C1BA 3B6GA 1ID3B 1P3IC 3MGPB 1P3MD 3H0MC 3REIB 2F8NK 5AV8B 1KX5C 4DRBA 4EO5C 2Y2JA 3EG5B 4KGCB 5B32B 4XUJA 1HQ3B 4WNNA 5BT1D 4CAYA 5GSUA 3X1UB 2NZDD 4H9NB 5AV9C 3AV1C 4WU9D 1P3KD 2PYOD 3REKD 3MGSC 4QLCB 3B0BA 2FFFB 3RELB 1KX4B 3NQJA 4H9QA 1TZYB 4UPKA 5B40A 3W98C 4LD9D 2G5IC 2FJ7B 5B2JB 1P3BD 3LZ0C 3A6ND 3REJB 1ZLAA 5BNXA 2J8PA 5AY8B 3X1VD 4WU9A 2HIOC 3AZKC 2UWXA 3REKA 4J8WC 3W97B 5DNNA 4LD9A 5F99A 1P3BA 3O62D 1BH8A 3AZJA 1N1JA 3W96B 4WZSB 3X1VA 2XD5A 2F2AC 4H9OB 4ZUXB 3KUYD 4J8XD 3UTBD 4J8VB 3MNNC 5FUGA 2IO5B 1W2EA 4JJNB 2Y2KA 3MGRB 3AZLB 4Z66D 5GT3B 2Y2NA 3O62A 3AN2B 5B1MB 4Z2MG 3W99B 5AV8D 2JCHA 3KWQC 3AV2C 3AZGA 5G49B 4J8XA 1P3LA 3C1BC 3V9RA 3B6GC 5B32D 4KGCD 1HQ3D 2L5AA 3X1UD 5AV6B 4CSRA 3R45B 5AVCB 2YFVB 1M19A 4Z66A 3NQUA 1P34A 1F66D 2RVQD 4R8PD 3RELD 2DQNC 1HTAA 4H9RB 1KX4D 1TZYD 5B32A 2FJ7D 1F1EA 2ZY5A 1M1AB 1P3MC 3REJD 4E45A 3KXBB 5GXQA 4NE5A 3WTPB 1F66A 5BT1C 3W97D 2NZDC 4R8PA 1ZLAC 1KX3B 3B0DC 1TZYA 3LJAD 3TU4B 4WU9C 3REKC 1AOIB 2BYKA 5BNVA 3W96D 4E44A 4ZUXD 4LD9C 3EPHA 1P3BC 4AWLC 4WU8D 3VH6A 3AYWB 4J8VD 3AZJC 3X1VC 3LJAA 3MGRD 5GT3D 3MGQD 1BH9A 3W99D 3W96A 5AVBA 4ZUXA 2AROB 1EQZA 3O62C 5CP6D 4H9PB 4WU8A 5GT0B 4X23B 4DQYB 3AZGC 1M18B 3KUYC 5GT3A 4J8XC 3MGQA 1P3LC 2HIOA 1TAFB 3UTBC 4KUDB 4J8WA 2BYMA 1JFIA 4J8UB 3UTAA 1M19C 4Z66C 3IP4C 5CP6A 3LELB 1S32B 3AZHB 5B24B 5BO0B 3AZNA 1T3UA 1P3GB 5B32C 1P3AB 1HQ3C 3WTPD 2XD1A 5DNMD 3X1UC 5CPIB 1KX3D 3VH6W 3TU4D 5GXQC 2Y2OA 1AOID 1F66C 4HGAC 4NE3A 5B1LD 3WA9B 2NQBB 2RVQC 4R8PC 3RELC 1TZYC 5CPJB 4G91B 2FJ7C 1Q9CA 2Y2MA 4Z5TB 1H3OA 5DNMA 1P3FA 3REJC 1KX3A 4WJ3C 3AZMB 1PZRA 3UT9D 2Y2GA 5B1LA 3W97C 5B0YB 3EPLA 2F8NH 4YS3B 3LJAC 3REHB 5GT0D 1P3MA 4X23D 3AL0C 3W96C 4XZQB 1P3PB 5AVBC 4KHAB 4ZUXC 3WAAB 3UT9A
chains in the Genus database with same CATH topology
4WU8C 3AZFD 5AV5B 4J8VC 2NZDA 3WKJB 4J8UD 2HUEC 3MVDB 5GT3C 3MGQC 1P3KA 3LELD 2PYOA 5GT0A 2ZY2A 3X1SD 3AZHD 2F8ND 4X23A 5B24D 2YFWB 4KUDA 3UTAC 1P3GD 1P3AD 5C3IB 5CP6C 3AZFA 5CPKB 5B2IB 5CPID 3A6NA 3AZNC 1U35B 4YM6B 3X1SA 3AZHA 3WA9D 2F8NA 3AZID 2NQBD 1P3IB 5CPJD 1P3GA 5KDMB 1P3AA 1KX5B 1ID3D 5CPIA 5BS7A 3MGPD 3REID 5E5AB 2CWEA 3KUYA 3WTPC 3UTBA 3WA9A 1P3FC 5DNMC 5AV9B 3AZIA 2NQBA 5B0YD 4H9SA 3AV1B 1KX3C 3MGSB 3TU4C 2Y2QA 4UUZA 1ID3A 4QLCD 5JA4B 5B1LC 4ZBJB 3MGPA 3X1TB 3REIA 4XZQD 3C1CB 5AV8A 1P3PD 3W98B 4KGCA 5B2JD 1HQ3A 5AV5D 5B31B 5B0YA 3X1UA 2F8NG 4H9NA 5AY8D 4M6BA 2LY8A 3AFAB 3UT9C 4QLCA 5JRGB 3RELA 2ZY3A 1KX4A 3A1KA 1P3KC 5B2JA 2FJ7A 2PYOC 5GT0C 5B2ID 4X23C 3REJA 5AY8A 4KUDC 4YM6D 3MNNB 3AZFC 3W97A 3A6NC 3AZEB 2YFWA 3KSYA 4J8UC 4JJND 4G92C 3AZLD 4KUDD 1KX5D 3LELC 3KWQB 5B32G 3X1SC 3AZHC 3AN2D 5B1MD 3C1BB 3B6GB 5E5AD 3H0LC 5B24C 4H9OA 1P3GC 5B33B 1P3AC 4NE6A 3WTPE 5CPIC 5BS7C 3AV1D 5AV6D 4J8VA 3B0CT 4XUJB 4JJNA 4WNNB 5AVCD 3MGRA 3AZLA 4CAYB 5GSUB 3WA9C 3X1TD 3W98D 3AN2A 5B1MA 3AZIC 3C1CD 3B0CW 3W99A 4H9SC 2NQBC 3B6FB 5G49A 5CPJC 4G91C 1M1AD 1ID3C 5B31D 3NQJB 4H9QB 5B40B 5AV6A 2G5HC 3MGPC 3REIC 5AV8C 3R45A 5AVCA 2YFVA 3AFAD 3KXBD 4KGCC 1ZLAB 5JRGD 3B0DB 5BNXB 4DRAA 5B0YC 4WU9B 4H9RA 3REKB 5DNNB 1M1AA 4QLCC 4LD9B 1P3PC 5F99B 1P3BB 1BH8B 1KX4C 3KXBA 2VQRA 3MNND 1N1JB 5B2JC 3WTPA 3AZJB 2Y2LA 3X1VB 3H0RC 3AZED 3AYWD 1EQZC 5AY8C 3TU4A 3LZ1B 3KWQD 1AOIA 3VH5A 2AROD 5B33D 1AOIC 3AZGB 5B2IC 5B0ZB 3AZEA 2RIQA 4J8XB 3AYWA 1P3LB 3V9RB 4XUJD 1M18D 5GSUD 4YM6C 4CSRB 1A7WA 1M19B 4Z66B 3B6FD 2IO5C 2AROA 3NQUB 4JJNC 3MGRC 5B33A 3AZLC 1P34B 4H9PA 1S32D 5B40D 3AN2C 5B1MC 3W99C 5E5AC 2CV5B 1M18A 1P3OB 1TAFA 1ZLAD 2Y2HA 5AV6C 3B6FA 5GXQB 4J8UA 5AVCC 1F66B 4HGAB 3VH5T 1BFMA 5DNND 4R8PB 3LELA 1Z2CB 1S32A 3X1TC 4ZBJC 3C1CC 4WV4B 5F99D 2BG1A 5B24A 5BO0A 3VH5W 2BYKB 3AZJD 5BNVB 4Z5TD 1M1AC 2Y2IA 4EO5B 5B31C 1B6WA 3AZMD 3AFAC 3LZ1D 3KXBC 5JRGC 2JSSA 3LJAB 4YS3D 1BH9B 3EPKA 5CPJA 4Z5TA 3AZGD 5AVBB 5B0ZD 3REHD 1P3LD 1EQZB 4WU8B 3AZMA 3EPJA 3LZ1A 3LZ0B 3WAAD 1M19D 2HUEB 3AZEC 3AYWC 3MGQB 3WKJD 2HIOB 3AZKB 4YS3A 1B67A 4J8WB 3MVDD 1P34D 2BYMB 5B0ZA 3REHA 1JFIB 3UTAB 4XZQA 1P3PA 2CV5D 5CP6B 4KHAA 2AROC 3WAAA 1WWIA 5B33C 1P3OD 3AZNB 5CPKD 5AV5A 5GXQD 3WKJA 4XUJC 1M18C 3MVDA 5GSUC 1U35D 2W8SA 2CV5A 3B6FC 1P3ID 1P3OA 3AV2B 3P5JB 5CPKA 5B2IA 5B40C 1S32C 2DF4C 1KU5A 1H3OB 5DNMB 1P3FB 2Y2PA 1U35A 4NFTA 4YM6A 3A1IA 5AV9D 3MGSD 1P3IA 5B1LB 5KDMA 5DNNC 1KX5A 5AVBD 5F99C 1EQZD 5E5AA 3LZ0D 1P3MB 4Z5TC 5AV9A 3AV1A 2HIOD 3AZKD 3UT9B 3MGSA 4J8WD 3AZMC 3LZ1C 2NZDB 2ZM5A 5JA4A 3X1TA 3UTAD 3W98A 3C1CA 1P3KB 4YS3C 2PYOB 3LZ0A 3AZND 5B0ZC 3REHC 5B31A 3AZKA 4XZQC 3FDDA 4AWLB 3AZFB 3WAAC 3AFAA 3A6NB 5JRGA 4G92B 5AV5C 3WKJC 1P34C 3X1SB 3MVDC 2F8NB 3KFUG 5CHLB 3AV2D 3VH6T 1R4VA 5FUGB 1WWSA 3B6GD 3C1BD 3F6TA 2CV5C 3O62B 1P3FD 1P3OC 4Z2MH 1ULYA 3MNNA 2ZY4A 5C3IC 5CPKC 3KUYB 3UTBB 2JE5A 3AZIB 1U35C 3AV2A 3KWQA 4UUZB 5B31G 3C1BA 3B6GA 1ID3B 1P3IC 3MGPB 1P3MD 3H0MC 3REIB 2F8NK 5AV8B 1KX5C 4DRBA 4EO5C 2Y2JA 3EG5B 4KGCB 5B32B 4XUJA 1HQ3B 4WNNA 5BT1D 4CAYA 5GSUA 3X1UB 2NZDD 4H9NB 5AV9C 3AV1C 4WU9D 1P3KD 2PYOD 3REKD 3MGSC 4QLCB 3B0BA 2FFFB 3RELB 1KX4B 3NQJA 4H9QA 1TZYB 4UPKA 5B40A 3W98C 4LD9D 2G5IC 2FJ7B 5B2JB 1P3BD 3LZ0C 3A6ND 3REJB 1ZLAA 5BNXA 2J8PA 5AY8B 3X1VD 4WU9A 2HIOC 3AZKC 2UWXA 3REKA 4J8WC 3W97B 5DNNA 4LD9A 5F99A 1P3BA 3O62D 1BH8A 3AZJA 1N1JA 3W96B 4WZSB 3X1VA 2XD5A 2F2AC 4H9OB 4ZUXB 3KUYD 4J8XD 3UTBD 4J8VB 3MNNC 5FUGA 2IO5B 1W2EA 4JJNB 2Y2KA 3MGRB 3AZLB 4Z66D 5GT3B 2Y2NA 3O62A 3AN2B 5B1MB 4Z2MG 3W99B 5AV8D 2JCHA 3KWQC 3AV2C 3AZGA 5G49B 4J8XA 1P3LA 3C1BC 3V9RA 3B6GC 5B32D 4KGCD 1HQ3D 2L5AA 3X1UD 5AV6B 4CSRA 3R45B 5AVCB 2YFVB 1M19A 4Z66A 3NQUA 1P34A 1F66D 2RVQD 4R8PD 3RELD 2DQNC 1HTAA 4H9RB 1KX4D 1TZYD 5B32A 2FJ7D 1F1EA 2ZY5A 1M1AB 1P3MC 3REJD 4E45A 3KXBB 5GXQA 4NE5A 3WTPB 1F66A 5BT1C 3W97D 2NZDC 4R8PA 1ZLAC 1KX3B 3B0DC 1TZYA 3LJAD 3TU4B 4WU9C 3REKC 1AOIB 2BYKA 5BNVA 3W96D 4E44A 4ZUXD 4LD9C 3EPHA 1P3BC 4AWLC 4WU8D 3VH6A 3AYWB 4J8VD 3AZJC 3X1VC 3LJAA 3MGRD 5GT3D 3MGQD 1BH9A 3W99D 3W96A 5AVBA 4ZUXA 2AROB 1EQZA 3O62C 5CP6D 4H9PB 4WU8A 5GT0B 4X23B 4DQYB 3AZGC 1M18B 3KUYC 5GT3A 4J8XC 3MGQA 1P3LC 2HIOA 1TAFB 3UTBC 4KUDB 4J8WA 2BYMA 1JFIA 4J8UB 3UTAA 1M19C 4Z66C 3IP4C 5CP6A 3LELB 1S32B 3AZHB 5B24B 5BO0B 3AZNA 1T3UA 1P3GB 5B32C 1P3AB 1HQ3C 3WTPD 2XD1A 5DNMD 3X1UC 5CPIB 1KX3D 3VH6W 3TU4D 5GXQC 2Y2OA 1AOID 1F66C 4HGAC 4NE3A 5B1LD 3WA9B 2NQBB 2RVQC 4R8PC 3RELC 1TZYC 5CPJB 4G91B 2FJ7C 1Q9CA 2Y2MA 4Z5TB 1H3OA 5DNMA 1P3FA 3REJC 1KX3A 4WJ3C 3AZMB 1PZRA 3UT9D 2Y2GA 5B1LA 3W97C 5B0YB 3EPLA 2F8NH 4YS3B 3LJAC 3REHB 5GT0D 1P3MA 4X23D 3AL0C 3W96C 4XZQB 1P3PB 5AVBC 4KHAB 4ZUXC 3WAAB 3UT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 C;  3AZF D;  5AV5 B;  4J8V C;  2NZD A;  3WKJ B;  4J8U D;  2HUE C;  3MVD B;  5GT3 C;  3MGQ C;  1P3K A;  3LEL D;  2PYO A;  5GT0 A;  3X1S D;  3AZH D;  2F8N D;  4X23 A;  5B24 D;  2YFW B;  4KUD A;  3UTA C;  1P3G D;  1P3A D;  5C3I B;  5CP6 C;  3AZF A;  5CPK B;  5B2I B;  5CPI D;  3A6N A;  3AZN C;  1U35 B;  4YM6 B;  3X1S A;  3AZH A;  3WA9 D;  2F8N A;  3AZI D;  2NQB D;  1P3I B;  5CPJ D;  1P3G A;  5KDM B;  1P3A A;  1KX5 B;  1ID3 D;  5CPI A;  5BS7 A;  3MGP D;  3REI D;  5E5A B;  2CWE A;  3KUY A;  3WTP C;  3UTB A;  3WA9 A;  1P3F C;  5DNM C;  5AV9 B;  3AZI A;  2NQB A;  5B0Y D;  4H9S A;  3AV1 B;  1KX3 C;  3MGS B;  3TU4 C;  4UUZ A;  1ID3 A;  4QLC D;  5JA4 B;  5B1L C;  4ZBJ B;  3MGP A;  3X1T B;  3REI A;  4XZQ D;  3C1C B;  5AV8 A;  1P3P D;  3W98 B;  4KGC A;  5B2J D;  1HQ3 A;  5AV5 D;  5B31 B;  3X1U A;  5B0Y A;  2F8N G;  4H9N A;  5AY8 D;  4M6B A;  2LY8 A;  3AFA B;  3UT9 C;  4QLC A;  5JRG B;  3REL A;  1KX4 A;  1P3K C;  5B2J A;  2FJ7 A;  2PYO C;  5GT0 C;  5B2I D;  4X23 C;  3REJ A;  5AY8 A;  4KUD C;  4YM6 D;  3MNN B;  3AZF C;  3W97 A;  3A6N C;  3AZE B;  2YFW A;  3KSY A;  4J8U C;  4JJN D;  4G92 C;  3AZL D;  4KUD D;  1KX5 D;  3LEL C;  3KWQ B;  5B32 G;  3X1S C;  3AZH C;  3AN2 D;  5B1M D;  3C1B B;  3B6G B;  5E5A D;  5B24 C;  4H9O A;  1P3G C;  5B33 B;  1P3A C;  4NE6 A;  3WTP E;  5CPI C;  5BS7 C;  3AV1 D;  5AV6 D;  4J8V A;  3B0C T;  4XUJ B;  4JJN A;  4WNN B;  5AVC D;  3MGR A;  3AZL A;  4CAY B;  5GSU B;  3WA9 C;  3X1T D;  3W98 D;  3AN2 A;  5B1M A;  3AZI C;  3C1C D;  3B0C W;  3W99 A;  4H9S C;  2NQB C;  3B6F B;  5G49 A;  5CPJ C;  4G91 C;  1M1A D;  1ID3 C;  5B31 D;  3NQJ B;  4H9Q B;  5B40 B;  5AV6 A;  3MGP C;  3REI C;  5AV8 C;  3R45 A;  5AVC A;  2YFV A;  3AFA D;  3KXB D;  4KGC C;  1ZLA B;  5JRG D;  3B0D B;  5BNX B;  4DRA A;  5B0Y C;  4WU9 B;  4H9R A;  3REK B;  5DNN B;  1M1A A;  4QLC C;  4LD9 B;  1P3P C;  5F99 B;  1P3B B;  1BH8 B;  1KX4 C;  3KXB A;  3MNN D;  3AZJ B;  1N1J B;  5B2J C;  3WTP A;  3X1V B;  3AZE D;  3AYW D;  1EQZ C;  5AY8 C;  3TU4 A;  3LZ1 B;  3KWQ D;  1AOI A;  3VH5 A;  2ARO D;  5B33 D;  1AOI C;  3AZG B;  5B2I C;  5B0Z B;  3AZE A;  4J8X B;  3AYW A;  1P3L B;  3V9R B;  4XUJ D;  1M18 D;  5GSU D;  4YM6 C;  4CSR B;  1A7W A;  1M19 B;  4Z66 B;  3B6F D;  2IO5 C;  2ARO A;  3NQU B;  4JJN C;  3MGR C;  5B33 A;  3AZL C;  1P34 B;  4H9P A;  1S32 D;  5B40 D;  3AN2 C;  5B1M C;  3W99 C;  5E5A C;  2CV5 B;  1M18 A;  1P3O B;  1TAF A;  1ZLA D;  5AV6 C;  3B6F A;  5GXQ B;  4J8U A;  5AVC C;  1F66 B;  4HGA B;  3VH5 T;  1BFM A;  5DNN D;  4R8P B;  3LEL A;  1S32 A;  3X1T C;  4ZBJ C;  3C1C C;  4WV4 B;  5F99 D;  5B24 A;  5BO0 A;  3VH5 W;  2BYK B;  3AZJ D;  5BNV B;  4Z5T D;  1M1A C;  4EO5 B;  5B31 C;  1B6W A;  3AZM D;  3AFA C;  3LZ1 D;  3KXB C;  5JRG C;  2JSS A;  3LJA B;  4YS3 D;  1BH9 B;  5CPJ A;  4Z5T A;  3AZG D;  5AVB B;  5B0Z D;  3REH D;  1P3L D;  1EQZ B;  4WU8 B;  3AZM A;  3WAA D;  3LZ1 A;  3LZ0 B;  1M19 D;  2HUE B;  3AZE C;  3AYW C;  3MGQ B;  3WKJ D;  2HIO B;  3AZK B;  4YS3 A;  1B67 A;  4J8W B;  3MVD D;  1P34 D;  2BYM B;  5B0Z A;  3REH A;  1JFI B;  3UTA B;  4XZQ A;  1P3P A;  2CV5 D;  5CP6 B;  4KHA A;  2ARO C;  3WAA A;  1WWI A;  5B33 C;  1P3O D;  3AZN B;  5CPK D;  5AV5 A;  5GXQ D;  3WKJ A;  4XUJ C;  1M18 C;  3MVD A;  5GSU C;  1U35 D;  2CV5 A;  3B6F C;  1P3I D;  1P3O A;  3AV2 B;  5CPK A;  1S32 C;  5B2I A;  5B40 C;  1KU5 A;  1H3O B;  5DNM B;  1P3F B;  1U35 A;  4NFT A;  4YM6 A;  5AV9 D;  3MGS D;  1P3I A;  5B1L B;  5KDM A;  5DNN C;  1KX5 A;  5AVB D;  5F99 C;  1EQZ D;  5E5A A;  3LZ0 D;  1P3M B;  4Z5T C;  5AV9 A;  3AV1 A;  2HIO D;  3AZK D;  3UT9 B;  3MGS A;  4J8W D;  3AZM C;  3LZ1 C;  2NZD B;  5JA4 A;  3X1T A;  3UTA D;  3W98 A;  3C1C A;  1P3K B;  4YS3 C;  2PYO B;  3LZ0 A;  3AZN D;  5B0Z C;  3REH C;  5B31 A;  3AZK A;  4XZQ C;  4AWL B;  3AZF B;  3WAA C;  3AFA A;  3A6N B;  5JRG A;  4G92 B;  5AV5 C;  3WKJ C;  1P34 C;  3X1S B;  3MVD C;  2F8N B;  5CHL B;  3AV2 D;  3VH6 T;  1R4V A;  5FUG B;  1WWS A;  3B6G D;  3C1B D;  2CV5 C;  3O62 B;  1P3F D;  1P3O C;  4Z2M H;  1ULY A;  3MNN A;  5C3I C;  5CPK C;  3KUY B;  3UTB B;  3AZI B;  1U35 C;  3AV2 A;  3KWQ A;  4UUZ B;  5B31 G;  3C1B A;  3B6G A;  1ID3 B;  1P3I C;  3MGP B;  1P3M D;  3REI B;  2F8N K;  5AV8 B;  1KX5 C;  4DRB A;  4EO5 C;  4KGC B;  5B32 B;  4XUJ A;  1HQ3 B;  4WNN A;  5BT1 D;  4CAY A;  5GSU A;  3X1U B;  2NZD D;  4H9N B;  5AV9 C;  3AV1 C;  4WU9 D;  1P3K D;  2PYO D;  3REK D;  3MGS C;  4QLC B;  3B0B A;  3REL B;  1KX4 B;  3NQJ A;  4H9Q A;  1TZY B;  5B40 A;  3W98 C;  4LD9 D;  2FJ7 B;  5B2J B;  1P3B D;  3LZ0 C;  3A6N D;  3REJ B;  1ZLA A;  5BNX A;  5AY8 B;  3X1V D;  4WU9 A;  2HIO C;  3AZK C;  3REK A;  4J8W C;  3W97 B;  5DNN A;  4LD9 A;  5F99 A;  1P3B A;  3O62 D;  1BH8 A;  3AZJ A;  1N1J A;  3W96 B;  4WZS B;  3X1V A;  4H9O B;  4ZUX B;  3KUY D;  4J8X D;  3UTB D;  4J8V B;  3MNN C;  5FUG A;  2IO5 B;  4JJN B;  3AZL B;  3MGR B;  4Z66 D;  5GT3 B;  3O62 A;  3AN2 B;  5B1M B;  4Z2M G;  3W99 B;  5AV8 D;  3AV2 C;  3KWQ C;  3AZG A;  5G49 B;  4J8X A;  1P3L A;  3C1B C;  3V9R A;  3B6G C;  5B32 D;  4KGC D;  1HQ3 D;  2L5A A;  3X1U D;  5AV6 B;  4CSR A;  3R45 B;  5AVC B;  2YFV B;  1M19 A;  4Z66 A;  3NQU A;  1P34 A;  1F66 D;  2RVQ D;  4R8P D;  3REL D;  1KX4 D;  1HTA A;  4H9R B;  1TZY D;  5B32 A;  2FJ7 D;  1F1E A;  1M1A B;  1P3M C;  3REJ D;  4E45 A;  3KXB B;  5GXQ A;  4NE5 A;  3WTP B;  1F66 A;  5BT1 C;  3W97 D;  2NZD C;  4R8P A;  1ZLA C;  1KX3 B;  3B0D C;  1TZY A;  3LJA D;  3TU4 B;  4WU9 C;  3REK C;  1AOI B;  2BYK A;  5BNV A;  3W96 D;  4E44 A;  4ZUX D;  4LD9 C;  1P3B C;  4AWL C;  4WU8 D;  3VH6 A;  3AYW B;  4J8V D;  3AZJ C;  3X1V C;  3LJA A;  3MGR D;  5GT3 D;  3MGQ D;  1BH9 A;  3W99 D;  3W96 A;  5AVB A;  4ZUX A;  2ARO B;  1EQZ A;  3O62 C;  5CP6 D;  4H9P B;  4WU8 A;  5GT0 B;  4X23 B;  3AZG C;  1M18 B;  3KUY C;  5GT3 A;  4J8X C;  3MGQ A;  1P3L C;  2HIO A;  1TAF B;  3UTB C;  4KUD B;  4J8W A;  2BYM A;  1JFI A;  4J8U B;  3UTA A;  1M19 C;  4Z66 C;  5CP6 A;  3LEL B;  1S32 B;  3AZH B;  5B24 B;  5BO0 B;  3AZN A;  1P3G B;  5B32 C;  1P3A B;  1HQ3 C;  3WTP D;  5DNM D;  3X1U C;  5CPI B;  1KX3 D;  3VH6 W;  3TU4 D;  5GXQ C;  1AOI D;  1F66 C;  4HGA C;  4NE3 A;  5B1L D;  3WA9 B;  2NQB B;  2RVQ C;  4R8P C;  3REL C;  1TZY C;  5CPJ B;  4G91 B;  2FJ7 C;  1Q9C A;  4Z5T B;  1H3O A;  5DNM A;  1P3F A;  3REJ C;  1KX3 A;  3AZM B;  3UT9 D;  5B1L A;  3W97 C;  5B0Y B;  2F8N H;  4YS3 B;  3LJA C;  3REH B;  5GT0 D;  1P3M A;  4X23 D;  3W96 C;  4XZQ B;  1P3P B;  5AVB C;  4KHA B;  4ZUX C;  3WAA B;  3UT9 A; 
#chains in the Genus database with same CATH topology
 4WU8 C;  3AZF D;  5AV5 B;  4J8V C;  2NZD A;  3WKJ B;  4J8U D;  2HUE C;  3MVD B;  5GT3 C;  3MGQ C;  1P3K A;  3LEL D;  2PYO A;  5GT0 A;  2ZY2 A;  3X1S D;  3AZH D;  2F8N D;  4X23 A;  5B24 D;  2YFW B;  4KUD A;  3UTA C;  1P3G D;  1P3A D;  5C3I B;  5CP6 C;  3AZF A;  5CPK B;  5B2I B;  5CPI D;  3A6N A;  3AZN C;  1U35 B;  4YM6 B;  3X1S A;  3AZH A;  3WA9 D;  2F8N A;  3AZI D;  2NQB D;  1P3I B;  5CPJ D;  1P3G A;  5KDM B;  1P3A A;  1KX5 B;  1ID3 D;  5CPI A;  5BS7 A;  3MGP D;  3REI D;  5E5A B;  2CWE A;  3KUY A;  3WTP C;  3UTB A;  3WA9 A;  1P3F C;  5DNM C;  5AV9 B;  3AZI A;  2NQB A;  5B0Y D;  4H9S A;  3AV1 B;  1KX3 C;  3MGS B;  3TU4 C;  2Y2Q A;  4UUZ A;  1ID3 A;  4QLC D;  5JA4 B;  5B1L C;  4ZBJ B;  3MGP A;  3X1T B;  3REI A;  4XZQ D;  3C1C B;  5AV8 A;  1P3P D;  3W98 B;  4KGC A;  5B2J D;  1HQ3 A;  5AV5 D;  5B31 B;  5B0Y A;  3X1U A;  2F8N G;  4H9N A;  5AY8 D;  4M6B A;  2LY8 A;  3AFA B;  3UT9 C;  4QLC A;  5JRG B;  3REL A;  2ZY3 A;  1KX4 A;  3A1K A;  1P3K C;  5B2J A;  2FJ7 A;  2PYO C;  5GT0 C;  5B2I D;  4X23 C;  3REJ A;  5AY8 A;  4KUD C;  4YM6 D;  3MNN B;  3AZF C;  3W97 A;  3A6N C;  3AZE B;  2YFW A;  3KSY A;  4J8U C;  4JJN D;  4G92 C;  3AZL D;  4KUD D;  1KX5 D;  3LEL C;  3KWQ B;  5B32 G;  3X1S C;  3AZH C;  3AN2 D;  5B1M D;  3C1B B;  3B6G B;  5E5A D;  3H0L C;  5B24 C;  4H9O A;  1P3G C;  5B33 B;  1P3A C;  4NE6 A;  3WTP E;  5CPI C;  5BS7 C;  3AV1 D;  5AV6 D;  4J8V A;  3B0C T;  4XUJ B;  4JJN A;  4WNN B;  5AVC D;  3MGR A;  3AZL A;  4CAY B;  5GSU B;  3WA9 C;  3X1T D;  3W98 D;  3AN2 A;  5B1M A;  3AZI C;  3C1C D;  3B0C W;  3W99 A;  4H9S C;  2NQB C;  3B6F B;  5G49 A;  5CPJ C;  4G91 C;  1M1A D;  1ID3 C;  5B31 D;  3NQJ B;  4H9Q B;  5B40 B;  5AV6 A;  2G5H C;  3MGP C;  3REI C;  5AV8 C;  3R45 A;  5AVC A;  2YFV A;  3AFA D;  3KXB D;  4KGC C;  1ZLA B;  5JRG D;  3B0D B;  5BNX B;  4DRA A;  5B0Y C;  4WU9 B;  4H9R A;  3REK B;  5DNN B;  1M1A A;  4QLC C;  4LD9 B;  1P3P C;  5F99 B;  1P3B B;  1BH8 B;  1KX4 C;  3KXB A;  2VQR A;  3MNN D;  1N1J B;  5B2J C;  3WTP A;  3AZJ B;  2Y2L A;  3X1V B;  3H0R C;  3AZE D;  3AYW D;  1EQZ C;  5AY8 C;  3TU4 A;  3LZ1 B;  3KWQ D;  1AOI A;  3VH5 A;  2ARO D;  5B33 D;  1AOI C;  3AZG B;  5B2I C;  5B0Z B;  3AZE A;  2RIQ A;  4J8X B;  3AYW A;  1P3L B;  3V9R B;  4XUJ D;  1M18 D;  5GSU D;  4YM6 C;  4CSR B;  1A7W A;  1M19 B;  4Z66 B;  3B6F D;  2IO5 C;  2ARO A;  3NQU B;  4JJN C;  3MGR C;  5B33 A;  3AZL C;  1P34 B;  4H9P A;  1S32 D;  5B40 D;  3AN2 C;  5B1M C;  3W99 C;  5E5A C;  2CV5 B;  1M18 A;  1P3O B;  1TAF A;  1ZLA D;  2Y2H A;  5AV6 C;  3B6F A;  5GXQ B;  4J8U A;  5AVC C;  1F66 B;  4HGA B;  3VH5 T;  1BFM A;  5DNN D;  4R8P B;  3LEL A;  1Z2C B;  1S32 A;  3X1T C;  4ZBJ C;  3C1C C;  4WV4 B;  5F99 D;  2BG1 A;  5B24 A;  5BO0 A;  3VH5 W;  2BYK B;  3AZJ D;  5BNV B;  4Z5T D;  1M1A C;  2Y2I A;  4EO5 B;  5B31 C;  1B6W A;  3AZM D;  3AFA C;  3LZ1 D;  3KXB C;  5JRG C;  2JSS A;  3LJA B;  4YS3 D;  1BH9 B;  3EPK A;  5CPJ A;  4Z5T A;  3AZG D;  5AVB B;  5B0Z D;  3REH D;  1P3L D;  1EQZ B;  4WU8 B;  3AZM A;  3EPJ A;  3LZ1 A;  3LZ0 B;  3WAA D;  1M19 D;  2HUE B;  3AZE C;  3AYW C;  3MGQ B;  3WKJ D;  2HIO B;  3AZK B;  4YS3 A;  1B67 A;  4J8W B;  3MVD D;  1P34 D;  2BYM B;  5B0Z A;  3REH A;  1JFI B;  3UTA B;  4XZQ A;  1P3P A;  2CV5 D;  5CP6 B;  4KHA A;  2ARO C;  3WAA A;  1WWI A;  5B33 C;  1P3O D;  3AZN B;  5CPK D;  5AV5 A;  5GXQ D;  3WKJ A;  4XUJ C;  1M18 C;  3MVD A;  5GSU C;  1U35 D;  2W8S A;  2CV5 A;  3B6F C;  1P3I D;  1P3O A;  3AV2 B;  3P5J B;  5CPK A;  5B2I A;  5B40 C;  1S32 C;  2DF4 C;  1KU5 A;  1H3O B;  5DNM B;  1P3F B;  2Y2P A;  1U35 A;  4NFT A;  4YM6 A;  3A1I A;  5AV9 D;  3MGS D;  1P3I A;  5B1L B;  5KDM A;  5DNN C;  1KX5 A;  5AVB D;  5F99 C;  1EQZ D;  5E5A A;  3LZ0 D;  1P3M B;  4Z5T C;  5AV9 A;  3AV1 A;  2HIO D;  3AZK D;  3UT9 B;  3MGS A;  4J8W D;  3AZM C;  3LZ1 C;  2NZD B;  2ZM5 A;  5JA4 A;  3X1T A;  3UTA D;  3W98 A;  3C1C A;  1P3K B;  4YS3 C;  2PYO B;  3LZ0 A;  3AZN D;  5B0Z C;  3REH C;  5B31 A;  3AZK A;  4XZQ C;  3FDD A;  4AWL B;  3AZF B;  3WAA C;  3AFA A;  3A6N B;  5JRG A;  4G92 B;  5AV5 C;  3WKJ C;  1P34 C;  3X1S B;  3MVD C;  2F8N B;  3KFU G;  5CHL B;  3AV2 D;  3VH6 T;  1R4V A;  5FUG B;  1WWS A;  3B6G D;  3C1B D;  3F6T A;  2CV5 C;  3O62 B;  1P3F D;  1P3O C;  4Z2M H;  1ULY A;  3MNN A;  2ZY4 A;  5C3I C;  5CPK C;  3KUY B;  3UTB B;  2JE5 A;  3AZI B;  1U35 C;  3AV2 A;  3KWQ A;  4UUZ B;  5B31 G;  3C1B A;  3B6G A;  1ID3 B;  1P3I C;  3MGP B;  1P3M D;  3H0M C;  3REI B;  2F8N K;  5AV8 B;  1KX5 C;  4DRB A;  4EO5 C;  2Y2J A;  3EG5 B;  4KGC B;  5B32 B;  4XUJ A;  1HQ3 B;  4WNN A;  5BT1 D;  4CAY A;  5GSU A;  3X1U B;  2NZD D;  4H9N B;  5AV9 C;  3AV1 C;  4WU9 D;  1P3K D;  2PYO D;  3REK D;  3MGS C;  4QLC B;  3B0B A;  2FFF B;  3REL B;  1KX4 B;  3NQJ A;  4H9Q A;  1TZY B;  4UPK A;  5B40 A;  3W98 C;  4LD9 D;  2G5I C;  2FJ7 B;  5B2J B;  1P3B D;  3LZ0 C;  3A6N D;  3REJ B;  1ZLA A;  5BNX A;  2J8P A;  5AY8 B;  3X1V D;  4WU9 A;  2HIO C;  3AZK C;  2UWX A;  3REK A;  4J8W C;  3W97 B;  5DNN A;  4LD9 A;  5F99 A;  1P3B A;  3O62 D;  1BH8 A;  3AZJ A;  1N1J A;  3W96 B;  4WZS B;  3X1V A;  2XD5 A;  2F2A C;  4H9O B;  4ZUX B;  3KUY D;  4J8X D;  3UTB D;  4J8V B;  3MNN C;  5FUG A;  2IO5 B;  1W2E A;  4JJN B;  2Y2K A;  3MGR B;  3AZL B;  4Z66 D;  5GT3 B;  2Y2N A;  3O62 A;  3AN2 B;  5B1M B;  4Z2M G;  3W99 B;  5AV8 D;  2JCH A;  3KWQ C;  3AV2 C;  3AZG A;  5G49 B;  4J8X A;  1P3L A;  3C1B C;  3V9R A;  3B6G C;  5B32 D;  4KGC D;  1HQ3 D;  2L5A A;  3X1U D;  5AV6 B;  4CSR A;  3R45 B;  5AVC B;  2YFV B;  1M19 A;  4Z66 A;  3NQU A;  1P34 A;  1F66 D;  2RVQ D;  4R8P D;  3REL D;  2DQN C;  1HTA A;  4H9R B;  1KX4 D;  1TZY D;  5B32 A;  2FJ7 D;  1F1E A;  2ZY5 A;  1M1A B;  1P3M C;  3REJ D;  4E45 A;  3KXB B;  5GXQ A;  4NE5 A;  3WTP B;  1F66 A;  5BT1 C;  3W97 D;  2NZD C;  4R8P A;  1ZLA C;  1KX3 B;  3B0D C;  1TZY A;  3LJA D;  3TU4 B;  4WU9 C;  3REK C;  1AOI B;  2BYK A;  5BNV A;  3W96 D;  4E44 A;  4ZUX D;  4LD9 C;  3EPH A;  1P3B C;  4AWL C;  4WU8 D;  3VH6 A;  3AYW B;  4J8V D;  3AZJ C;  3X1V C;  3LJA A;  3MGR D;  5GT3 D;  3MGQ D;  1BH9 A;  3W99 D;  3W96 A;  5AVB A;  4ZUX A;  2ARO B;  1EQZ A;  3O62 C;  5CP6 D;  4H9P B;  4WU8 A;  5GT0 B;  4X23 B;  4DQY B;  3AZG C;  1M18 B;  3KUY C;  5GT3 A;  4J8X C;  3MGQ A;  1P3L C;  2HIO A;  1TAF B;  3UTB C;  4KUD B;  4J8W A;  2BYM A;  1JFI A;  4J8U B;  3UTA A;  1M19 C;  4Z66 C;  3IP4 C;  5CP6 A;  3LEL B;  1S32 B;  3AZH B;  5B24 B;  5BO0 B;  3AZN A;  1T3U A;  1P3G B;  5B32 C;  1P3A B;  1HQ3 C;  3WTP D;  2XD1 A;  5DNM D;  3X1U C;  5CPI B;  1KX3 D;  3VH6 W;  3TU4 D;  5GXQ C;  2Y2O A;  1AOI D;  1F66 C;  4HGA C;  4NE3 A;  5B1L D;  3WA9 B;  2NQB B;  2RVQ C;  4R8P C;  3REL C;  1TZY C;  5CPJ B;  4G91 B;  2FJ7 C;  1Q9C A;  2Y2M A;  4Z5T B;  1H3O A;  5DNM A;  1P3F A;  3REJ C;  1KX3 A;  4WJ3 C;  3AZM B;  1PZR A;  3UT9 D;  2Y2G A;  5B1L A;  3W97 C;  5B0Y B;  3EPL A;  2F8N H;  4YS3 B;  3LJA C;  3REH B;  5GT0 D;  1P3M A;  4X23 D;  3AL0 C;  3W96 C;  4XZQ B;  1P3P B;  5AVB C;  4KHA B;  4ZUX C;  3WAA B;  3UT9 A; 
#chains in the Genus database with same CATH homology
 4WU8 C;  3AZF D;  5AV5 B;  4J8V C;  2NZD A;  3WKJ B;  4J8U D;  2HUE C;  3MVD B;  5GT3 C;  3MGQ C;  1P3K A;  3LEL D;  2PYO A;  5GT0 A;  2ZY2 A;  3X1S D;  3AZH D;  2F8N D;  4X23 A;  5B24 D;  2YFW B;  4KUD A;  3UTA C;  1P3G D;  1P3A D;  5C3I B;  5CP6 C;  3AZF A;  5CPK B;  5B2I B;  5CPI D;  3A6N A;  3AZN C;  1U35 B;  4YM6 B;  3X1S A;  3AZH A;  3WA9 D;  2F8N A;  3AZI D;  2NQB D;  1P3I B;  5CPJ D;  1P3G A;  5KDM B;  1P3A A;  1KX5 B;  1ID3 D;  5CPI A;  5BS7 A;  3MGP D;  3REI D;  5E5A B;  2CWE A;  3KUY A;  3WTP C;  3UTB A;  3WA9 A;  1P3F C;  5DNM C;  5AV9 B;  3AZI A;  2NQB A;  5B0Y D;  4H9S A;  3AV1 B;  1KX3 C;  3MGS B;  3TU4 C;  2Y2Q A;  4UUZ A;  1ID3 A;  4QLC D;  5JA4 B;  5B1L C;  4ZBJ B;  3MGP A;  3X1T B;  3REI A;  4XZQ D;  3C1C B;  5AV8 A;  1P3P D;  3W98 B;  4KGC A;  5B2J D;  1HQ3 A;  5AV5 D;  5B31 B;  5B0Y A;  3X1U A;  2F8N G;  4H9N A;  5AY8 D;  4M6B A;  2LY8 A;  3AFA B;  3UT9 C;  4QLC A;  5JRG B;  3REL A;  2ZY3 A;  1KX4 A;  3A1K A;  1P3K C;  5B2J A;  2FJ7 A;  2PYO C;  5GT0 C;  5B2I D;  4X23 C;  3REJ A;  5AY8 A;  4KUD C;  4YM6 D;  3MNN B;  3AZF C;  3W97 A;  3A6N C;  3AZE B;  2YFW A;  3KSY A;  4J8U C;  4JJN D;  4G92 C;  3AZL D;  4KUD D;  1KX5 D;  3LEL C;  3KWQ B;  5B32 G;  3X1S C;  3AZH C;  3AN2 D;  5B1M D;  3C1B B;  3B6G B;  5E5A D;  3H0L C;  5B24 C;  4H9O A;  1P3G C;  5B33 B;  1P3A C;  4NE6 A;  3WTP E;  5CPI C;  5BS7 C;  3AV1 D;  5AV6 D;  4J8V A;  3B0C T;  4XUJ B;  4JJN A;  4WNN B;  5AVC D;  3MGR A;  3AZL A;  4CAY B;  5GSU B;  3WA9 C;  3X1T D;  3W98 D;  3AN2 A;  5B1M A;  3AZI C;  3C1C D;  3B0C W;  3W99 A;  4H9S C;  2NQB C;  3B6F B;  5G49 A;  5CPJ C;  4G91 C;  1M1A D;  1ID3 C;  5B31 D;  3NQJ B;  4H9Q B;  5B40 B;  5AV6 A;  2G5H C;  3MGP C;  3REI C;  5AV8 C;  3R45 A;  5AVC A;  2YFV A;  3AFA D;  3KXB D;  4KGC C;  1ZLA B;  5JRG D;  3B0D B;  5BNX B;  4DRA A;  5B0Y C;  4WU9 B;  4H9R A;  3REK B;  5DNN B;  1M1A A;  4QLC C;  4LD9 B;  1P3P C;  5F99 B;  1P3B B;  1BH8 B;  1KX4 C;  3KXB A;  2VQR A;  3MNN D;  1N1J B;  5B2J C;  3WTP A;  3AZJ B;  2Y2L A;  3X1V B;  3H0R C;  3AZE D;  3AYW D;  1EQZ C;  5AY8 C;  3TU4 A;  3LZ1 B;  3KWQ D;  1AOI A;  3VH5 A;  2ARO D;  5B33 D;  1AOI C;  3AZG B;  5B2I C;  5B0Z B;  3AZE A;  2RIQ A;  4J8X B;  3AYW A;  1P3L B;  3V9R B;  4XUJ D;  1M18 D;  5GSU D;  4YM6 C;  4CSR B;  1A7W A;  1M19 B;  4Z66 B;  3B6F D;  2IO5 C;  2ARO A;  3NQU B;  4JJN C;  3MGR C;  5B33 A;  3AZL C;  1P34 B;  4H9P A;  1S32 D;  5B40 D;  3AN2 C;  5B1M C;  3W99 C;  5E5A C;  2CV5 B;  1M18 A;  1P3O B;  1TAF A;  1ZLA D;  2Y2H A;  5AV6 C;  3B6F A;  5GXQ B;  4J8U A;  5AVC C;  1F66 B;  4HGA B;  3VH5 T;  1BFM A;  5DNN D;  4R8P B;  3LEL A;  1Z2C B;  1S32 A;  3X1T C;  4ZBJ C;  3C1C C;  4WV4 B;  5F99 D;  2BG1 A;  5B24 A;  5BO0 A;  3VH5 W;  2BYK B;  3AZJ D;  5BNV B;  4Z5T D;  1M1A C;  2Y2I A;  4EO5 B;  5B31 C;  1B6W A;  3AZM D;  3AFA C;  3LZ1 D;  3KXB C;  5JRG C;  2JSS A;  3LJA B;  4YS3 D;  1BH9 B;  3EPK A;  5CPJ A;  4Z5T A;  3AZG D;  5AVB B;  5B0Z D;  3REH D;  1P3L D;  1EQZ B;  4WU8 B;  3AZM A;  3EPJ A;  3LZ1 A;  3LZ0 B;  3WAA D;  1M19 D;  2HUE B;  3AZE C;  3AYW C;  3MGQ B;  3WKJ D;  2HIO B;  3AZK B;  4YS3 A;  1B67 A;  4J8W B;  3MVD D;  1P34 D;  2BYM B;  5B0Z A;  3REH A;  1JFI B;  3UTA B;  4XZQ A;  1P3P A;  2CV5 D;  5CP6 B;  4KHA A;  2ARO C;  3WAA A;  1WWI A;  5B33 C;  1P3O D;  3AZN B;  5CPK D;  5AV5 A;  5GXQ D;  3WKJ A;  4XUJ C;  1M18 C;  3MVD A;  5GSU C;  1U35 D;  2W8S A;  2CV5 A;  3B6F C;  1P3I D;  1P3O A;  3AV2 B;  3P5J B;  5CPK A;  5B2I A;  5B40 C;  1S32 C;  2DF4 C;  1KU5 A;  1H3O B;  5DNM B;  1P3F B;  2Y2P A;  1U35 A;  4NFT A;  4YM6 A;  3A1I A;  5AV9 D;  3MGS D;  1P3I A;  5B1L B;  5KDM A;  5DNN C;  1KX5 A;  5AVB D;  5F99 C;  1EQZ D;  5E5A A;  3LZ0 D;  1P3M B;  4Z5T C;  5AV9 A;  3AV1 A;  2HIO D;  3AZK D;  3UT9 B;  3MGS A;  4J8W D;  3AZM C;  3LZ1 C;  2NZD B;  2ZM5 A;  5JA4 A;  3X1T A;  3UTA D;  3W98 A;  3C1C A;  1P3K B;  4YS3 C;  2PYO B;  3LZ0 A;  3AZN D;  5B0Z C;  3REH C;  5B31 A;  3AZK A;  4XZQ C;  3FDD A;  4AWL B;  3AZF B;  3WAA C;  3AFA A;  3A6N B;  5JRG A;  4G92 B;  5AV5 C;  3WKJ C;  1P34 C;  3X1S B;  3MVD C;  2F8N B;  3KFU G;  5CHL B;  3AV2 D;  3VH6 T;  1R4V A;  5FUG B;  1WWS A;  3B6G D;  3C1B D;  3F6T A;  2CV5 C;  3O62 B;  1P3F D;  1P3O C;  4Z2M H;  1ULY A;  3MNN A;  2ZY4 A;  5C3I C;  5CPK C;  3KUY B;  3UTB B;  2JE5 A;  3AZI B;  1U35 C;  3AV2 A;  3KWQ A;  4UUZ B;  5B31 G;  3C1B A;  3B6G A;  1ID3 B;  1P3I C;  3MGP B;  1P3M D;  3H0M C;  3REI B;  2F8N K;  5AV8 B;  1KX5 C;  4DRB A;  4EO5 C;  2Y2J A;  3EG5 B;  4KGC B;  5B32 B;  4XUJ A;  1HQ3 B;  4WNN A;  5BT1 D;  4CAY A;  5GSU A;  3X1U B;  2NZD D;  4H9N B;  5AV9 C;  3AV1 C;  4WU9 D;  1P3K D;  2PYO D;  3REK D;  3MGS C;  4QLC B;  3B0B A;  2FFF B;  3REL B;  1KX4 B;  3NQJ A;  4H9Q A;  1TZY B;  4UPK A;  5B40 A;  3W98 C;  4LD9 D;  2G5I C;  2FJ7 B;  5B2J B;  1P3B D;  3LZ0 C;  3A6N D;  3REJ B;  1ZLA A;  5BNX A;  2J8P A;  5AY8 B;  3X1V D;  4WU9 A;  2HIO C;  3AZK C;  2UWX A;  3REK A;  4J8W C;  3W97 B;  5DNN A;  4LD9 A;  5F99 A;  1P3B A;  3O62 D;  1BH8 A;  3AZJ A;  1N1J A;  3W96 B;  4WZS B;  3X1V A;  2XD5 A;  2F2A C;  4H9O B;  4ZUX B;  3KUY D;  4J8X D;  3UTB D;  4J8V B;  3MNN C;  5FUG A;  2IO5 B;  1W2E A;  4JJN B;  2Y2K A;  3MGR B;  3AZL B;  4Z66 D;  5GT3 B;  2Y2N A;  3O62 A;  3AN2 B;  5B1M B;  4Z2M G;  3W99 B;  5AV8 D;  2JCH A;  3KWQ C;  3AV2 C;  3AZG A;  5G49 B;  4J8X A;  1P3L A;  3C1B C;  3V9R A;  3B6G C;  5B32 D;  4KGC D;  1HQ3 D;  2L5A A;  3X1U D;  5AV6 B;  4CSR A;  3R45 B;  5AVC B;  2YFV B;  1M19 A;  4Z66 A;  3NQU A;  1P34 A;  1F66 D;  2RVQ D;  4R8P D;  3REL D;  2DQN C;  1HTA A;  4H9R B;  1KX4 D;  1TZY D;  5B32 A;  2FJ7 D;  1F1E A;  2ZY5 A;  1M1A B;  1P3M C;  3REJ D;  4E45 A;  3KXB B;  5GXQ A;  4NE5 A;  3WTP B;  1F66 A;  5BT1 C;  3W97 D;  2NZD C;  4R8P A;  1ZLA C;  1KX3 B;  3B0D C;  1TZY A;  3LJA D;  3TU4 B;  4WU9 C;  3REK C;  1AOI B;  2BYK A;  5BNV A;  3W96 D;  4E44 A;  4ZUX D;  4LD9 C;  3EPH A;  1P3B C;  4AWL C;  4WU8 D;  3VH6 A;  3AYW B;  4J8V D;  3AZJ C;  3X1V C;  3LJA A;  3MGR D;  5GT3 D;  3MGQ D;  1BH9 A;  3W99 D;  3W96 A;  5AVB A;  4ZUX A;  2ARO B;  1EQZ A;  3O62 C;  5CP6 D;  4H9P B;  4WU8 A;  5GT0 B;  4X23 B;  4DQY B;  3AZG C;  1M18 B;  3KUY C;  5GT3 A;  4J8X C;  3MGQ A;  1P3L C;  2HIO A;  1TAF B;  3UTB C;  4KUD B;  4J8W A;  2BYM A;  1JFI A;  4J8U B;  3UTA A;  1M19 C;  4Z66 C;  3IP4 C;  5CP6 A;  3LEL B;  1S32 B;  3AZH B;  5B24 B;  5BO0 B;  3AZN A;  1T3U A;  1P3G B;  5B32 C;  1P3A B;  1HQ3 C;  3WTP D;  2XD1 A;  5DNM D;  3X1U C;  5CPI B;  1KX3 D;  3VH6 W;  3TU4 D;  5GXQ C;  2Y2O A;  1AOI D;  1F66 C;  4HGA C;  4NE3 A;  5B1L D;  3WA9 B;  2NQB B;  2RVQ C;  4R8P C;  3REL C;  1TZY C;  5CPJ B;  4G91 B;  2FJ7 C;  1Q9C A;  2Y2M A;  4Z5T B;  1H3O A;  5DNM A;  1P3F A;  3REJ C;  1KX3 A;  4WJ3 C;  3AZM B;  1PZR A;  3UT9 D;  2Y2G A;  5B1L A;  3W97 C;  5B0Y B;  3EPL A;  2F8N H;  4YS3 B;  3LJA C;  3REH B;  5GT0 D;  1P3M A;  4X23 D;  3AL0 C;  3W96 C;  4XZQ B;  1P3P B;  5AVB C;  4KHA B;  4ZUX C;  3WAA B;  3UT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...