5B31B

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31B00
2RVQD 4KGCB 3AZED 5B1MB 5B40A 3B0BA 5DNNC 1S32A 1HQ3B 1P34B 4J8UB 3X1SD 2IO5C 5AV9A 5KDMA 3LZ0B 3AZJD 5B32D 4Z5TA 3MVDA 4YM6C 3W98B 3WTPE 4QLCD 5B24A 3LJAD 5B40C 1S32C 1KX3A 1P3KD 5CPIB 4H9OB 5AV9C 5F99B 3WAAB 1P3OD 1KX4A 4Z5TC 3RELB 3MVDC 3AZLD 1P3AB 5B24C 5CPJC 5DNMA 3WTPA 5B1LA 3VH5T 5AY8B 1KX4C 3W99B 5BT1C 4J8VC 3R45A 5DNMC 1TZYA 3TU4B 5B0ZA 3VH6A 1F66D 4XZQB 3WTPC 1N1JA 5B1LC 1U35A 3AZMB 5B31A 3AZIB 3REJA 4WNNA 1ZLAA 3KXBD 1P3GB 3AV1D 5C3IC 5B0ZC 2AROD 1P3ID 3KUYB 2YFWA 5BS7A 3KWQA 3REHC 1U35C 5B33B 3B0DC 3LELB 5B31C 2HIOB 2HUEB 3AYWA 1EQZD 5B0YB 4XUJA 3REJC 5B2JD 2F8NG 2CWEA 3UTAB 4KUDD 3A6NA 4J8XA 2F8NH 5BS7C 3KWQC 3AZFB 3AFAA 1P3PA 5GSUB 3MGQA 1ID3B 3W96D 4NE5A 2PYOB 3MGSB 3AYWC 4ZUXB 3AZGB 4XUJC 3C1CA 3UTBA 3A6NC 4J8XC 1M19A 3REIB 3X1VB 3W97D 4DRAA 3AFAC 3AV2A 3AN2A 3MGQC 5GT3D 4WZSB 1P3PC 3UT9D 3V9RA 3C1CC 2CV5A 3AZND 1JFIA 1F66B 1M19C 3B6GD 5B2IA 4R8PC 3AN2C 3AV2C 3MGRD 2IO5B 1KX5D 4X23D 3VH6T 5CP6D 1P3LA 5AV6D 5CPKA 4E45A 2NZDC 2CV5C 3REKD 5B40B 5B2IC 1S32B 4YS3D 5AV9B 4H9SA 4J8WA 5E5AA 5KDMB 5BNVA 5FUGA 5AVBA 4Z5TB 5CPKC 3NQJA 3MVDB 5AV8A 3O62D 5BO0A 5B24B 4ZBJC 1KX3B 4KGCD 4AWLB 5B1MD 3MGPA 1P34D 4J8WC 1HQ3D 4H9SC 5E5AC 4M6BA 1M18B 4J8UD 5AVBC 1KX4B 4NFTA 3LZ0D 3LZ1A 3W98D 3MGPC 3WTPB 5B1LB 1BH8A 4UUZA 5CPID 5F99D 3WAAD 4H9NA 3R45B 3LZ1C 3RELD 5B31G 2BYMA 1TZYB 5C3IB 3X1SA 1N1JB 1U35B 3B0DB 5B31B 1M1AA 3REJB 4WNNB 5AY8D 4H9QA 1ZLAB 3W99D 4LD9D 3X1SC 2YFWB 3KWQB 3TU4D 1F1EA 1P3OA 3AZJC 4XZQD 3AYWB 1M1AC 4EO5C 4XUJB 4YM6A 4G91C 3AZHA 3AZMD 3AZID 3A6NB 4J8XB 5BNXA 1P3GD 3AFAB 1P3PB 4JJNA 1P3OC 3MGQB 3KUYD 2FJ7A 5JRGB 4Z66A 3AZLC 5B33D 4Z2MH 3AZHC 3LELD 2HIOD 3B0CW 5B0YD 3UTBB 5CPJA 1M19B 3X1TA 3UTAD 3AN2B 2FJ7C 4JJNC 5GT0B 4Z66C 3AZFD 1P3BA 5GSUD 1ID3D 3V9RB 4J8VA 2PYOD 3MGSD 2CV5B 4ZUXD 3AZGD 1JFIB 3X1TC 5B2IB 1P3MA 1P3FB 3REID 3X1VD 1P3BC 1EQZA 1P3LB 4WU9A 5CPKB 4CAYA 4LD9B 3AV1C 3WKJB 1P3MC 3MNNA 3REHA 4J8WB 5BNVB 5FUGB 1EQZC 5AVBB 4WU9C 5B2JC 3NQJB 5AV8B 4KUDC 5BO0B 1H3OA 3C1BA 3MNNC 3MGPB 5B40D 1S32D 5JA4A 1BH9A 4WV4B 3B6FA 5AV9D 4Z5TD 3LZ1B 5AVCA 3MVDD 2BYKA 5AV5A 4WU8A 2JSSA 3C1BC 5B24D 4HGAC 4G92C 3MGRA 1KX3D 1BH8B 1R4VA 4UUZB 3B6FC 4NE3A 2F8NB 1M18D 4H9NB 1KX4D 5AVCC 4WU8C 5AV5C 3AZKA 4R8PA 3MGRC 4YS3A 1KX5C 4X23C 3WTPD 5B1LD 3X1UA 1M1AB 4EO5B 3WA9A 2NZDA 4G91B 4KGCA 3AZKC 5DNNB 5B1MA 4YS3C 1TZYD 1AOIA 1U35D 3X1UC 3WA9C 4YM6B 3AZHB 2LY8A 3W98A 5B31D 4KGCC 3REJD 5B1MC 1ZLAD 5BNXB 4J8UC 1AOIC 4JJNB 2FJ7B 3KWQD 2NQBA 4Z66B 3LZ0C 3W98C 3AYWD 1P3AA 5CPJB 4XUJD 5CHLB 5GXQA 4DRBA 3A6ND 4J8XD 5F99C 2NQBC 3AFAD 1P3BB 1P3PD 3MGQD 4J8VB 3W99A 5JRGD 1P3AC 5DNMB 5GXQC 1P3MB 3UTBD 1M19D 3AN2D 3AV2D 4WU9B 5GT0D 3W99C 4CAYB 3AZEA 2CV5D 4H9RA 5B0ZB 1P3GA 5B2ID 3REHB 3AZJA 5B32A 1P3FD 2RVQC 4QLCA 3AZIC 3AZEC 5B0YA 3LJAA 1P3LD 5CPKD 1H3OB 1P3KA 3UTAA 1P3GC 3C1BB 3WKJD 4HGAB 5JA4B 1BH9B 5B32C 3B6FB 1ID3A 4J8WD 3AZLA 5E5AD 4QLCC 1B6WA 2HUEC 5B0YC 5AVBD 3LJAC 3NQUA 5AVCB 2BYKB 5AV5B 4WU8B 5AV8D 1P3KC 3UTAC 4Z2MG 3MGPD 1ID3C 3C1CB 1WWIA 4CSRA 3AZKB 1F66A 3LZ1D 4R8PB 3AV2B 3X1UB 3WA9B 2NZDB 2F8ND 5G49A 3KXBA 3AV1A 1P3IA 2AROA 1F66C 3VH6W 2YFVA 1AOIB 4H9PA 5B2JA 4KHAA 1TAFA 4NE6A 3KXBC 4KUDA 1M1AD 1P3IC 2AROC 4ZBJB 1WWSA 5DNND 3W96A 5E5AB 2NQBB 1M18A 1Q9CA 2F8NK 4YM6D 3AZHD 5GXQB 3W97A 1KX3C 4AWLC 5GT3A 3W96C 3UT9A 1M18C 2FJ7D 4JJND 3AZNA 4Z66D 3B6GA 3W97C 5CPJD 5GT3C 1KX5A 3X1TD 4X23A 3UT9C 5CP6A 5AV6A 4E44A 3REKA 5B32G 3AZNC 1P3BD 3AZEB 3B6GC 5BT1D 2BYMB 4J8VD 4H9RB 1TZYC 3X1SB 5DNMD 1P3MD 5CP6C 3AZJB 5B32B 5AV6C 1KU5A 3REKC 3O62A 4QLCB 4H9QB 4WU9D 3LJAB 1ZLAC 1P3KB 1P34A 1HQ3A 4J8UA 5B0ZD 1P3OB 3MNND 3REHD 3AZLB 3O62C 3LZ0A 5JRGA 1HTAA 3NQUB 1A7WA 1P34C 1HQ3C 3B0CT 3C1BD 5CPIA 4H9OA 5F99A 3WAAA 5GT0A 2L5AA 5JRGC 3RELA 3B6FD 4CSRB 3KSYA 1ULYA 3UTBC 3X1TB 5AVCD 4WU8D 5AV5D 5CPIC 1P3FA 3WAAC 5GT0C 5AY8A 3RELC 5G49B 3KXBB 4LD9A 3AV1B 1P3IB 3C1CD 2AROB 3WKJA 3VH5W 3TU4A 3AZKD 2YFVB 4XZQA 4R8PD 1P3FC 4H9PB 1EQZB 5AY8C 5B2JB 4KHAB 1TAFB 3AZMA 1P3LC 3AZIA 3X1UD 4KUDB 4LD9C 3WA9D 3WKJC 2NZDD 3TU4C 3MNNB 3KUYA 4XZQC 3W96B 5B33A 1AOID 3LELA 3AZMC 2HIOA 5AV8C 3W97B 4G92B 3KUYC 5GT3B 1BFMA 3UT9B 3AZFA 5B33C 5GSUA 3LELC 2PYOA 3MGSA 2HIOC 2F8NA 4ZUXA 3AZGA 3AZNB 2NQBD 1B67A 3B6GB 1P3AD 3MGRB 3VH5A 1KX5B 3REIA 5GXQD 4X23B 3X1VA 3AZFC 5CP6B 5GSUC 5AV6B 2PYOC 3MGSC 3REKB 4ZUXC 3AZGC 4YS3B 5DNNA 3REIC 3X1VC 3O62B
chains in the Genus database with same CATH superfamily
2RVQD 4KGCB 3AZED 5B1MB 5B40A 3B0BA 5DNNC 3EG5B 1HQ3B 1S32A 1P34B 4J8UB 3X1SD 2IO5C 5AV9A 5KDMA 3LZ0B 3AZJD 5B32D 4Z5TA 3MVDA 4YM6C 3W98B 3WTPE 4QLCD 5B24A 3LJAD 5B40C 1S32C 1KX3A 1P3KD 5CPIB 4H9OB 5AV9C 5F99B 3WAAB 1P3OD 1KX4A 4Z5TC 3RELB 3MVDC 3AZLD 1P3AB 5B24C 5CPJC 5DNMA 3WTPA 5B1LA 3VH5T 5AY8B 1KX4C 3W99B 5BT1C 4J8VC 3R45A 5DNMC 1TZYA 3TU4B 5B0ZA 3VH6A 1F66D 4XZQB 3WTPC 1N1JA 5B1LC 1U35A 3AZMB 5B31A 3AZIB 3H0RC 3REJA 4WNNA 1ZLAA 3KXBD 1P3GB 3AV1D 5C3IC 5B0ZC 2AROD 1P3ID 3KUYB 2YFWA 5BS7A 3KWQA 3REHC 1U35C 5B33B 3A1IA 3B0DC 3LELB 5B31C 2HIOB 2HUEB 3AYWA 1EQZD 5B0YB 4XUJA 3REJC 5B2JD 2F8NG 2CWEA 3UTAB 4KUDD 3A6NA 4J8XA 1W2EA 2F8NH 5BS7C 3KWQC 3AZFB 3AFAA 1P3PA 5GSUB 3MGQA 1ID3B 3W96D 2W8SA 4NE5A 2PYOB 3MGSB 3AYWC 4ZUXB 3AZGB 4XUJC 3EPKA 3C1CA 3UTBA 2Y2OA 3A6NC 4J8XC 1M19A 3REIB 3X1VB 3W97D 4DRAA 3AFAC 3AV2A 3AN2A 3MGQC 5GT3D 4WZSB 1P3PC 3UT9D 2UWXA 2Y2JA 3V9RA 3C1CC 2CV5A 3AZND 1JFIA 1F66B 1M19C 3B6GD 5B2IA 4R8PC 3AN2C 3AV2C 3MGRD 2IO5B 1KX5D 4X23D 3VH6T 5CP6D 1P3LA 5AV6D 5CPKA 4E45A 2NZDC 2CV5C 3REKD 5B40B 5B2IC 1S32B 4YS3D 5AV9B 1PZRA 2DQNC 4H9SA 5E5AA 5KDMB 4J8WA 5BNVA 5FUGA 5AVBA 4Z5TB 5CPKC 3NQJA 3MVDB 3A1KA 5AV8A 2J8PA 3O62D 5BO0A 5B24B 4ZBJC 1KX3B 4KGCD 4AWLB 5B1MD 3MGPA 1P34D 4J8WC 1HQ3D 4H9SC 5E5AC 4M6BA 1M18B 4J8UD 5AVBC 1KX4B 4NFTA 3LZ0D 3LZ1A 2Y2LA 3W98D 3MGPC 3WTPB 5B1LB 1BH8A 4UUZA 5CPID 5F99D 3WAAD 4H9NA 3R45B 3LZ1C 3RELD 5B31G 2BYMA 1TZYB 5C3IB 3X1SA 1N1JB 1U35B 1Z2CB 2JE5A 3B0DB 5B31B 1M1AA 3REJB 4WNNB 5AY8D 4H9QA 1ZLAB 3W99D 4LD9D 3X1SC 2YFWB 3KWQB 3TU4D 1F1EA 1P3OA 3AZJC 3KFUG 2Y2PA 4XZQD 3AYWB 1M1AC 4EO5C 4XUJB 4YM6A 4G91C 3AZHA 3AZMD 3AZID 3A6NB 4J8XB 5BNXA 2FFFB 1P3GD 3AFAB 1P3PB 4JJNA 1P3OC 3MGQB 3KUYD 2FJ7A 5JRGB 4Z66A 3AZLC 5B33D 4Z2MH 3AZHC 3LELD 2HIOD 3B0CW 5B0YD 3UTBB 5CPJA 1M19B 2Y2NA 3X1TA 3UTAD 1T3UA 3AN2B 2FJ7C 4JJNC 5GT0B 4Z66C 3AZFD 1P3BA 5GSUD 1ID3D 3V9RB 4J8VA 2PYOD 3MGSD 2CV5B 4ZUXD 3AZGD 1JFIB 3X1TC 5B2IB 1P3MA 2RIQA 1P3FB 3REID 3X1VD 1P3BC 1EQZA 1P3LB 4WU9A 5CPKB 4CAYA 4LD9B 4UPKA 3AV1C 3WKJB 1P3MC 3MNNA 3REHA 4J8WB 5BNVB 5FUGB 1EQZC 5AVBB 4WU9C 5B2JC 3NQJB 5AV8B 4KUDC 5BO0B 1H3OA 3C1BA 3MNNC 3MGPB 5B40D 2JCHA 1S32D 2G5IC 5JA4A 1BH9A 4WV4B 3B6FA 5AV9D 4Z5TD 3LZ1B 5AVCA 3MVDD 2BYKA 5AV5A 4WU8A 2JSSA 3C1BC 5B24D 4HGAC 4G92C 3MGRA 1KX3D 1BH8B 1R4VA 4UUZB 3B6FC 4NE3A 2F8NB 1M18D 4H9NB 1KX4D 5AVCC 4WU8C 5AV5C 3AZKA 4R8PA 3MGRC 4YS3A 1KX5C 4X23C 3WTPD 5B1LD 2Y2GA 3X1UA 2Y2HA 1M1AB 4EO5B 3WA9A 2NZDA 4G91B 4KGCA 2G5HC 3AZKC 5DNNB 5B1MA 4YS3C 1TZYD 1AOIA 1U35D 3X1UC 3WA9C 4YM6B 3AZHB 2LY8A 3W98A 5B31D 4KGCC 3REJD 5B1MC 1ZLAD 5BNXB 4J8UC 1AOIC 4JJNB 2FJ7B 3KWQD 2NQBA 4Z66B 3LZ0C 2Y2MA 3W98C 3AYWD 1P3AA 5CPJB 4XUJD 5CHLB 5GXQA 2Y2KA 4DRBA 3A6ND 4J8XD 5F99C 2NQBC 3AFAD 1P3BB 1P3PD 3MGQD 2XD1A 4J8VB 3W99A 5JRGD 1P3AC 5DNMB 5GXQC 1P3MB 3UTBD 1M19D 3AL0C 3EPHA 3AN2D 3AV2D 4WU9B 5GT0D 3W99C 4CAYB 3AZEA 2CV5D 4H9RA 5B0ZB 1P3GA 4WJ3C 2VQRA 5B2ID 3REHB 3AZJA 5B32A 1P3FD 2RVQC 4QLCA 3AZIC 3AZEC 3IP4C 5B0YA 3LJAA 5CPKD 1H3OB 1P3LD 1P3KA 3UTAA 1P3GC 3C1BB 3WKJD 4HGAB 5JA4B 1BH9B 5B32C 2ZM5A 3B6FB 1ID3A 4J8WD 3AZLA 5E5AD 4QLCC 1B6WA 2HUEC 5B0YC 5AVBD 3LJAC 3NQUA 5AVCB 2BYKB 5AV5B 4WU8B 5AV8D 1P3KC 3UTAC 4Z2MG 3MGPD 1ID3C 3C1CB 1WWIA 3P5JB 4CSRA 3AZKB 1F66A 3LZ1D 4R8PB 3AV2B 3X1UB 3WA9B 2NZDB 2F8ND 5G49A 3KXBA 3AV1A 1P3IA 2AROA 1F66C 3H0LC 3VH6W 2YFVA 1AOIB 4H9PA 5B2JA 4KHAA 1TAFA 4NE6A 3KXBC 4KUDA 1M1AD 1P3IC 2AROC 4ZBJB 1WWSA 5DNND 3W96A 5E5AB 2NQBB 1M18A 1Q9CA 2F8NK 4YM6D 3AZHD 5GXQB 3W97A 1KX3C 4AWLC 5GT3A 3W96C 3UT9A 1M18C 2FJ7D 4JJND 3AZNA 4Z66D 3B6GA 3W97C 2XD5A 5CPJD 5GT3C 3EPJA 3X1TD 1KX5A 4X23A 3UT9C 5CP6A 5AV6A 4E44A 3REKA 5B32G 3AZNC 1P3BD 3AZEB 3B6GC 5BT1D 2BYMB 4J8VD 4H9RB 1TZYC 3X1SB 5DNMD 1P3MD 5CP6C 3AZJB 5B32B 5AV6C 1KU5A 3REKC 3O62A 4QLCB 4H9QB 4WU9D 3LJAB 1ZLAC 1P3KB 1P34A 1HQ3A 4J8UA 5B0ZD 1P3OB 2BG1A 3MNND 3REHD 3AZLB 3O62C 3LZ0A 5JRGA 1HTAA 3NQUB 1A7WA 1P34C 1HQ3C 3B0CT 3C1BD 5CPIA 4H9OA 5F99A 3WAAA 5GT0A 2L5AA 5JRGC 3RELA 3B6FD 4CSRB 3KSYA 1ULYA 3UTBC 3X1TB 5AVCD 3F6TA 5AV5D 4WU8D 5CPIC 1P3FA 3WAAC 5GT0C 5AY8A 3RELC 5G49B 3KXBB 4LD9A 3AV1B 1P3IB 3C1CD 2AROB 3WKJA 3VH5W 3TU4A 3AZKD 2YFVB 4XZQA 4R8PD 1P3FC 4H9PB 1EQZB 5AY8C 5B2JB 4KHAB 1TAFB 3AZMA 1P3LC 3AZIA 3X1UD 2F2AC 4KUDB 4LD9C 2ZY3A 3WA9D 3WKJC 2NZDD 3TU4C 3MNNB 4DQYB 3KUYA 4XZQC 3W96B 3H0MC 5B33A 1AOID 3LELA 3AZMC 2HIOA 5AV8C 3FDDA 3EPLA 2Y2IA 3W97B 4G92B 3KUYC 5GT3B 2ZY2A 1BFMA 3UT9B 3AZFA 5B33C 5GSUA 3LELC 2PYOA 3MGSA 2HIOC 2F8NA 2ZY4A 4ZUXA 3AZGA 3AZNB 2NQBD 1B67A 3B6GB 2Y2QA 1P3AD 2ZY5A 3MGRB 3VH5A 1KX5B 3REIA 5GXQD 4X23B 3X1VA 3AZFC 5CP6B 5GSUC 5AV6B 2PYOC 3MGSC 3REKB 4ZUXC 3AZGC 2DF4C 4YS3B 5DNNA 3REIC 3X1VC 3O62B
chains in the Genus database with same CATH topology
2RVQD 4KGCB 3AZED 5B1MB 5B40A 3B0BA 5DNNC 3EG5B 1HQ3B 1S32A 1P34B 4J8UB 3X1SD 2IO5C 5AV9A 5KDMA 3LZ0B 3AZJD 5B32D 4Z5TA 3MVDA 4YM6C 3W98B 3WTPE 4QLCD 5B24A 3LJAD 5B40C 1S32C 1KX3A 1P3KD 5CPIB 4H9OB 5AV9C 5F99B 3WAAB 1P3OD 1KX4A 4Z5TC 3RELB 3MVDC 3AZLD 1P3AB 5B24C 5CPJC 5DNMA 3WTPA 5B1LA 3VH5T 5AY8B 1KX4C 3W99B 5BT1C 4J8VC 3R45A 5DNMC 1TZYA 3TU4B 5B0ZA 3VH6A 1F66D 4XZQB 3WTPC 1N1JA 5B1LC 1U35A 3AZMB 5B31A 3AZIB 3H0RC 3REJA 4WNNA 1ZLAA 3KXBD 1P3GB 3AV1D 5C3IC 5B0ZC 2AROD 1P3ID 3KUYB 2YFWA 5BS7A 3KWQA 3REHC 1U35C 5B33B 3A1IA 3B0DC 3LELB 5B31C 2HIOB 2HUEB 3AYWA 1EQZD 5B0YB 4XUJA 3REJC 5B2JD 2F8NG 2CWEA 3UTAB 4KUDD 3A6NA 4J8XA 1W2EA 2F8NH 5BS7C 3KWQC 3AZFB 3AFAA 1P3PA 5GSUB 3MGQA 1ID3B 3W96D 2W8SA 4NE5A 2PYOB 3MGSB 3AYWC 4ZUXB 3AZGB 4XUJC 3EPKA 3C1CA 3UTBA 2Y2OA 3A6NC 4J8XC 1M19A 3REIB 3X1VB 3W97D 4DRAA 3AFAC 3AV2A 3AN2A 3MGQC 5GT3D 4WZSB 1P3PC 3UT9D 2UWXA 2Y2JA 3V9RA 3C1CC 2CV5A 3AZND 1JFIA 1F66B 1M19C 3B6GD 5B2IA 4R8PC 3AN2C 3AV2C 3MGRD 2IO5B 1KX5D 4X23D 3VH6T 5CP6D 1P3LA 5AV6D 5CPKA 4E45A 2NZDC 2CV5C 3REKD 5B40B 5B2IC 1S32B 4YS3D 5AV9B 1PZRA 2DQNC 4H9SA 5E5AA 5KDMB 4J8WA 5BNVA 5FUGA 5AVBA 4Z5TB 5CPKC 3NQJA 3MVDB 3A1KA 5AV8A 2J8PA 3O62D 5BO0A 5B24B 4ZBJC 1KX3B 4KGCD 4AWLB 5B1MD 3MGPA 1P34D 4J8WC 1HQ3D 4H9SC 5E5AC 4M6BA 1M18B 4J8UD 5AVBC 1KX4B 4NFTA 3LZ0D 3LZ1A 2Y2LA 3W98D 3MGPC 3WTPB 5B1LB 1BH8A 4UUZA 5CPID 5F99D 3WAAD 4H9NA 3R45B 3LZ1C 3RELD 5B31G 2BYMA 1TZYB 5C3IB 3X1SA 1N1JB 1U35B 1Z2CB 2JE5A 3B0DB 5B31B 1M1AA 3REJB 4WNNB 5AY8D 4H9QA 1ZLAB 3W99D 4LD9D 3X1SC 2YFWB 3KWQB 3TU4D 1F1EA 1P3OA 3AZJC 3KFUG 2Y2PA 4XZQD 3AYWB 1M1AC 4EO5C 4XUJB 4YM6A 4G91C 3AZHA 3AZMD 3AZID 3A6NB 4J8XB 5BNXA 2FFFB 1P3GD 3AFAB 1P3PB 4JJNA 1P3OC 3MGQB 3KUYD 2FJ7A 5JRGB 4Z66A 3AZLC 5B33D 4Z2MH 3AZHC 3LELD 2HIOD 3B0CW 5B0YD 3UTBB 5CPJA 1M19B 2Y2NA 3X1TA 3UTAD 1T3UA 3AN2B 2FJ7C 4JJNC 5GT0B 4Z66C 3AZFD 1P3BA 5GSUD 1ID3D 3V9RB 4J8VA 2PYOD 3MGSD 2CV5B 4ZUXD 3AZGD 1JFIB 3X1TC 5B2IB 1P3MA 2RIQA 1P3FB 3REID 3X1VD 1P3BC 1EQZA 1P3LB 4WU9A 5CPKB 4CAYA 4LD9B 4UPKA 3AV1C 3WKJB 1P3MC 3MNNA 3REHA 4J8WB 5BNVB 5FUGB 1EQZC 5AVBB 4WU9C 5B2JC 3NQJB 5AV8B 4KUDC 5BO0B 1H3OA 3C1BA 3MNNC 3MGPB 5B40D 2JCHA 1S32D 2G5IC 5JA4A 1BH9A 4WV4B 3B6FA 5AV9D 4Z5TD 3LZ1B 5AVCA 3MVDD 2BYKA 5AV5A 4WU8A 2JSSA 3C1BC 5B24D 4HGAC 4G92C 3MGRA 1KX3D 1BH8B 1R4VA 4UUZB 3B6FC 4NE3A 2F8NB 1M18D 4H9NB 1KX4D 5AVCC 4WU8C 5AV5C 3AZKA 4R8PA 3MGRC 4YS3A 1KX5C 4X23C 3WTPD 5B1LD 2Y2GA 3X1UA 2Y2HA 1M1AB 4EO5B 3WA9A 2NZDA 4G91B 4KGCA 2G5HC 3AZKC 5DNNB 5B1MA 4YS3C 1TZYD 1AOIA 1U35D 3X1UC 3WA9C 4YM6B 3AZHB 2LY8A 3W98A 5B31D 4KGCC 3REJD 5B1MC 1ZLAD 5BNXB 4J8UC 1AOIC 4JJNB 2FJ7B 3KWQD 2NQBA 4Z66B 3LZ0C 2Y2MA 3W98C 3AYWD 1P3AA 5CPJB 4XUJD 5CHLB 5GXQA 2Y2KA 4DRBA 3A6ND 4J8XD 5F99C 2NQBC 3AFAD 1P3BB 1P3PD 3MGQD 2XD1A 4J8VB 3W99A 5JRGD 1P3AC 5DNMB 5GXQC 1P3MB 3UTBD 1M19D 3AL0C 3EPHA 3AN2D 3AV2D 4WU9B 5GT0D 3W99C 4CAYB 3AZEA 2CV5D 4H9RA 5B0ZB 1P3GA 4WJ3C 2VQRA 5B2ID 3REHB 3AZJA 5B32A 1P3FD 2RVQC 4QLCA 3AZIC 3AZEC 3IP4C 5B0YA 3LJAA 5CPKD 1H3OB 1P3LD 1P3KA 3UTAA 1P3GC 3C1BB 3WKJD 4HGAB 5JA4B 1BH9B 5B32C 2ZM5A 3B6FB 1ID3A 4J8WD 3AZLA 5E5AD 4QLCC 1B6WA 2HUEC 5B0YC 5AVBD 3LJAC 3NQUA 5AVCB 2BYKB 5AV5B 4WU8B 5AV8D 1P3KC 3UTAC 4Z2MG 3MGPD 1ID3C 3C1CB 1WWIA 3P5JB 4CSRA 3AZKB 1F66A 3LZ1D 4R8PB 3AV2B 3X1UB 3WA9B 2NZDB 2F8ND 5G49A 3KXBA 3AV1A 1P3IA 2AROA 1F66C 3H0LC 3VH6W 2YFVA 1AOIB 4H9PA 5B2JA 4KHAA 1TAFA 4NE6A 3KXBC 4KUDA 1M1AD 1P3IC 2AROC 4ZBJB 1WWSA 5DNND 3W96A 5E5AB 2NQBB 1M18A 1Q9CA 2F8NK 4YM6D 3AZHD 5GXQB 3W97A 1KX3C 4AWLC 5GT3A 3W96C 3UT9A 1M18C 2FJ7D 4JJND 3AZNA 4Z66D 3B6GA 3W97C 2XD5A 5CPJD 5GT3C 3EPJA 3X1TD 1KX5A 4X23A 3UT9C 5CP6A 5AV6A 4E44A 3REKA 5B32G 3AZNC 1P3BD 3AZEB 3B6GC 5BT1D 2BYMB 4J8VD 4H9RB 1TZYC 3X1SB 5DNMD 1P3MD 5CP6C 3AZJB 5B32B 5AV6C 1KU5A 3REKC 3O62A 4QLCB 4H9QB 4WU9D 3LJAB 1ZLAC 1P3KB 1P34A 1HQ3A 4J8UA 5B0ZD 1P3OB 2BG1A 3MNND 3REHD 3AZLB 3O62C 3LZ0A 5JRGA 1HTAA 3NQUB 1A7WA 1P34C 1HQ3C 3B0CT 3C1BD 5CPIA 4H9OA 5F99A 3WAAA 5GT0A 2L5AA 5JRGC 3RELA 3B6FD 4CSRB 3KSYA 1ULYA 3UTBC 3X1TB 5AVCD 3F6TA 5AV5D 4WU8D 5CPIC 1P3FA 3WAAC 5GT0C 5AY8A 3RELC 5G49B 3KXBB 4LD9A 3AV1B 1P3IB 3C1CD 2AROB 3WKJA 3VH5W 3TU4A 3AZKD 2YFVB 4XZQA 4R8PD 1P3FC 4H9PB 1EQZB 5AY8C 5B2JB 4KHAB 1TAFB 3AZMA 1P3LC 3AZIA 3X1UD 2F2AC 4KUDB 4LD9C 2ZY3A 3WA9D 3WKJC 2NZDD 3TU4C 3MNNB 4DQYB 3KUYA 4XZQC 3W96B 3H0MC 5B33A 1AOID 3LELA 3AZMC 2HIOA 5AV8C 3FDDA 3EPLA 2Y2IA 3W97B 4G92B 3KUYC 5GT3B 2ZY2A 1BFMA 3UT9B 3AZFA 5B33C 5GSUA 3LELC 2PYOA 3MGSA 2HIOC 2F8NA 2ZY4A 4ZUXA 3AZGA 3AZNB 2NQBD 1B67A 3B6GB 2Y2QA 1P3AD 2ZY5A 3MGRB 3VH5A 1KX5B 3REIA 5GXQD 4X23B 3X1VA 3AZFC 5CP6B 5GSUC 5AV6B 2PYOC 3MGSC 3REKB 4ZUXC 3AZGC 2DF4C 4YS3B 5DNNA 3REIC 3X1VC 3O62B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ D;  4KGC B;  3AZE D;  5B1M B;  5B40 A;  3B0B A;  5DNN C;  1S32 A;  1HQ3 B;  1P34 B;  4J8U B;  3X1S D;  2IO5 C;  5AV9 A;  5KDM A;  3LZ0 B;  3AZJ D;  5B32 D;  4Z5T A;  3MVD A;  4YM6 C;  3W98 B;  3WTP E;  4QLC D;  5B24 A;  3LJA D;  5B40 C;  1S32 C;  1KX3 A;  1P3K D;  5CPI B;  4H9O B;  5AV9 C;  5F99 B;  3WAA B;  1P3O D;  1KX4 A;  4Z5T C;  3REL B;  3MVD C;  3AZL D;  1P3A B;  5B24 C;  5CPJ C;  5DNM A;  3WTP A;  5B1L A;  3VH5 T;  5AY8 B;  1KX4 C;  3W99 B;  5BT1 C;  4J8V C;  3R45 A;  5DNM C;  1TZY A;  3TU4 B;  5B0Z A;  3VH6 A;  1F66 D;  4XZQ B;  3WTP C;  1N1J A;  5B1L C;  1U35 A;  3AZM B;  5B31 A;  3AZI B;  3REJ A;  4WNN A;  1ZLA A;  3KXB D;  1P3G B;  3AV1 D;  5C3I C;  5B0Z C;  2ARO D;  1P3I D;  3KUY B;  2YFW A;  5BS7 A;  3KWQ A;  3REH C;  1U35 C;  5B33 B;  3B0D C;  3LEL B;  5B31 C;  2HIO B;  2HUE B;  3AYW A;  1EQZ D;  5B0Y B;  4XUJ A;  3REJ C;  5B2J D;  2F8N G;  2CWE A;  3UTA B;  4KUD D;  3A6N A;  4J8X A;  2F8N H;  5BS7 C;  3KWQ C;  3AZF B;  3AFA A;  1P3P A;  5GSU B;  3MGQ A;  1ID3 B;  3W96 D;  4NE5 A;  2PYO B;  3MGS B;  3AYW C;  4ZUX B;  3AZG B;  4XUJ C;  3C1C A;  3UTB A;  3A6N C;  4J8X C;  1M19 A;  3REI B;  3X1V B;  3W97 D;  4DRA A;  3AFA C;  3AV2 A;  3AN2 A;  3MGQ C;  5GT3 D;  4WZS B;  1P3P C;  3UT9 D;  3V9R A;  3C1C C;  2CV5 A;  3AZN D;  1JFI A;  1F66 B;  1M19 C;  3B6G D;  5B2I A;  4R8P C;  3AN2 C;  3AV2 C;  3MGR D;  2IO5 B;  1KX5 D;  4X23 D;  3VH6 T;  5CP6 D;  1P3L A;  5AV6 D;  5CPK A;  4E45 A;  2NZD C;  2CV5 C;  3REK D;  5B40 B;  5B2I C;  1S32 B;  4YS3 D;  5AV9 B;  4H9S A;  4J8W A;  5E5A A;  5KDM B;  5BNV A;  5FUG A;  5AVB A;  4Z5T B;  5CPK C;  3NQJ A;  3MVD B;  5AV8 A;  3O62 D;  5BO0 A;  5B24 B;  4ZBJ C;  1KX3 B;  4KGC D;  4AWL B;  5B1M D;  3MGP A;  1P34 D;  4J8W C;  1HQ3 D;  4H9S C;  5E5A C;  4M6B A;  1M18 B;  4J8U D;  5AVB C;  1KX4 B;  4NFT A;  3LZ0 D;  3LZ1 A;  3W98 D;  3MGP C;  3WTP B;  5B1L B;  1BH8 A;  4UUZ A;  5CPI D;  5F99 D;  3WAA D;  4H9N A;  3R45 B;  3LZ1 C;  3REL D;  5B31 G;  2BYM A;  1TZY B;  5C3I B;  3X1S A;  1N1J B;  1U35 B;  3B0D B;  5B31 B;  1M1A A;  3REJ B;  4WNN B;  5AY8 D;  4H9Q A;  1ZLA B;  3W99 D;  4LD9 D;  3X1S C;  2YFW B;  3KWQ B;  3TU4 D;  1F1E A;  1P3O A;  3AZJ C;  4XZQ D;  3AYW B;  1M1A C;  4EO5 C;  4XUJ B;  4YM6 A;  4G91 C;  3AZH A;  3AZM D;  3AZI D;  3A6N B;  4J8X B;  5BNX A;  1P3G D;  3AFA B;  1P3P B;  4JJN A;  1P3O C;  3MGQ B;  3KUY D;  2FJ7 A;  5JRG B;  4Z66 A;  3AZL C;  5B33 D;  4Z2M H;  3AZH C;  3LEL D;  2HIO D;  3B0C W;  5B0Y D;  3UTB B;  5CPJ A;  1M19 B;  3X1T A;  3UTA D;  3AN2 B;  2FJ7 C;  4JJN C;  5GT0 B;  4Z66 C;  3AZF D;  1P3B A;  5GSU D;  1ID3 D;  3V9R B;  4J8V A;  2PYO D;  3MGS D;  2CV5 B;  4ZUX D;  3AZG D;  1JFI B;  3X1T C;  5B2I B;  1P3M A;  1P3F B;  3REI D;  3X1V D;  1P3B C;  1EQZ A;  1P3L B;  4WU9 A;  5CPK B;  4CAY A;  4LD9 B;  3AV1 C;  3WKJ B;  1P3M C;  3MNN A;  3REH A;  4J8W B;  5BNV B;  5FUG B;  1EQZ C;  5AVB B;  4WU9 C;  5B2J C;  3NQJ B;  5AV8 B;  4KUD C;  5BO0 B;  1H3O A;  3C1B A;  3MNN C;  3MGP B;  5B40 D;  1S32 D;  5JA4 A;  1BH9 A;  4WV4 B;  3B6F A;  5AV9 D;  4Z5T D;  3LZ1 B;  5AVC A;  3MVD D;  2BYK A;  5AV5 A;  4WU8 A;  2JSS A;  3C1B C;  5B24 D;  4HGA C;  4G92 C;  3MGR A;  1KX3 D;  1BH8 B;  1R4V A;  4UUZ B;  3B6F C;  4NE3 A;  2F8N B;  1M18 D;  4H9N B;  1KX4 D;  5AVC C;  4WU8 C;  5AV5 C;  3AZK A;  4R8P A;  3MGR C;  4YS3 A;  1KX5 C;  4X23 C;  3WTP D;  5B1L D;  3X1U A;  1M1A B;  4EO5 B;  3WA9 A;  2NZD A;  4G91 B;  4KGC A;  3AZK C;  5DNN B;  5B1M A;  4YS3 C;  1TZY D;  1AOI A;  1U35 D;  3X1U C;  3WA9 C;  4YM6 B;  3AZH B;  2LY8 A;  3W98 A;  5B31 D;  4KGC C;  3REJ D;  5B1M C;  1ZLA D;  5BNX B;  4J8U C;  1AOI C;  4JJN B;  2FJ7 B;  3KWQ D;  2NQB A;  4Z66 B;  3LZ0 C;  3W98 C;  3AYW D;  1P3A A;  5CPJ B;  4XUJ D;  5CHL B;  5GXQ A;  4DRB A;  3A6N D;  4J8X D;  5F99 C;  2NQB C;  3AFA D;  1P3B B;  1P3P D;  3MGQ D;  4J8V B;  3W99 A;  5JRG D;  1P3A C;  5DNM B;  5GXQ C;  1P3M B;  3UTB D;  1M19 D;  3AN2 D;  3AV2 D;  4WU9 B;  5GT0 D;  3W99 C;  4CAY B;  3AZE A;  2CV5 D;  4H9R A;  5B0Z B;  1P3G A;  5B2I D;  3REH B;  3AZJ A;  5B32 A;  1P3F D;  2RVQ C;  4QLC A;  3AZI C;  3AZE C;  5B0Y A;  3LJA A;  1P3L D;  5CPK D;  1H3O B;  1P3K A;  3UTA A;  1P3G C;  3C1B B;  3WKJ D;  4HGA B;  5JA4 B;  1BH9 B;  5B32 C;  3B6F B;  1ID3 A;  4J8W D;  3AZL A;  5E5A D;  4QLC C;  1B6W A;  2HUE C;  5B0Y C;  5AVB D;  3LJA C;  3NQU A;  5AVC B;  2BYK B;  5AV5 B;  4WU8 B;  5AV8 D;  1P3K C;  3UTA C;  4Z2M G;  3MGP D;  1ID3 C;  3C1C B;  1WWI A;  4CSR A;  3AZK B;  1F66 A;  3LZ1 D;  4R8P B;  3AV2 B;  3X1U B;  3WA9 B;  2NZD B;  2F8N D;  5G49 A;  3KXB A;  3AV1 A;  1P3I A;  2ARO A;  1F66 C;  3VH6 W;  2YFV A;  1AOI B;  4H9P A;  5B2J A;  4KHA A;  1TAF A;  4NE6 A;  3KXB C;  4KUD A;  1M1A D;  1P3I C;  2ARO C;  4ZBJ B;  1WWS A;  5DNN D;  3W96 A;  5E5A B;  2NQB B;  1M18 A;  1Q9C A;  2F8N K;  4YM6 D;  3AZH D;  5GXQ B;  3W97 A;  1KX3 C;  4AWL C;  5GT3 A;  3W96 C;  3UT9 A;  1M18 C;  2FJ7 D;  4JJN D;  3AZN A;  4Z66 D;  3B6G A;  3W97 C;  5CPJ D;  5GT3 C;  1KX5 A;  3X1T D;  4X23 A;  3UT9 C;  5CP6 A;  5AV6 A;  4E44 A;  3REK A;  5B32 G;  3AZN C;  1P3B D;  3AZE B;  3B6G C;  5BT1 D;  2BYM B;  4J8V D;  4H9R B;  1TZY C;  3X1S B;  5DNM D;  1P3M D;  5CP6 C;  3AZJ B;  5B32 B;  5AV6 C;  1KU5 A;  3REK C;  3O62 A;  4QLC B;  4H9Q B;  4WU9 D;  3LJA B;  1ZLA C;  1P3K B;  1P34 A;  1HQ3 A;  4J8U A;  5B0Z D;  1P3O B;  3MNN D;  3REH D;  3AZL B;  3O62 C;  3LZ0 A;  5JRG A;  1HTA A;  3NQU B;  1A7W A;  1P34 C;  1HQ3 C;  3B0C T;  3C1B D;  5CPI A;  4H9O A;  5F99 A;  3WAA A;  5GT0 A;  2L5A A;  5JRG C;  3REL A;  3B6F D;  4CSR B;  3KSY A;  1ULY A;  3UTB C;  3X1T B;  5AVC D;  4WU8 D;  5AV5 D;  5CPI C;  1P3F A;  3WAA C;  5GT0 C;  5AY8 A;  3REL C;  5G49 B;  3KXB B;  4LD9 A;  3AV1 B;  1P3I B;  3C1C D;  2ARO B;  3WKJ A;  3VH5 W;  3TU4 A;  3AZK D;  2YFV B;  4XZQ A;  4R8P D;  1P3F C;  4H9P B;  1EQZ B;  5AY8 C;  5B2J B;  4KHA B;  1TAF B;  3AZM A;  1P3L C;  3AZI A;  3X1U D;  4KUD B;  4LD9 C;  3WA9 D;  3WKJ C;  2NZD D;  3TU4 C;  3MNN B;  3KUY A;  4XZQ C;  3W96 B;  5B33 A;  1AOI D;  3LEL A;  3AZM C;  2HIO A;  5AV8 C;  3W97 B;  4G92 B;  3KUY C;  5GT3 B;  1BFM A;  3UT9 B;  3AZF A;  5B33 C;  5GSU A;  3LEL C;  2PYO A;  3MGS A;  2HIO C;  2F8N A;  4ZUX A;  3AZG A;  3AZN B;  2NQB D;  1B67 A;  3B6G B;  1P3A D;  3MGR B;  3VH5 A;  1KX5 B;  3REI A;  5GXQ D;  4X23 B;  3X1V A;  3AZF C;  5CP6 B;  5GSU C;  5AV6 B;  2PYO C;  3MGS C;  3REK B;  4ZUX C;  3AZG C;  4YS3 B;  5DNN A;  3REI C;  3X1V C;  3O62 B; 
#chains in the Genus database with same CATH topology
 2RVQ D;  4KGC B;  3AZE D;  5B1M B;  5B40 A;  3B0B A;  5DNN C;  3EG5 B;  1HQ3 B;  1S32 A;  1P34 B;  4J8U B;  3X1S D;  2IO5 C;  5AV9 A;  5KDM A;  3LZ0 B;  3AZJ D;  5B32 D;  4Z5T A;  3MVD A;  4YM6 C;  3W98 B;  3WTP E;  4QLC D;  5B24 A;  3LJA D;  5B40 C;  1S32 C;  1KX3 A;  1P3K D;  5CPI B;  4H9O B;  5AV9 C;  5F99 B;  3WAA B;  1P3O D;  1KX4 A;  4Z5T C;  3REL B;  3MVD C;  3AZL D;  1P3A B;  5B24 C;  5CPJ C;  5DNM A;  3WTP A;  5B1L A;  3VH5 T;  5AY8 B;  1KX4 C;  3W99 B;  5BT1 C;  4J8V C;  3R45 A;  5DNM C;  1TZY A;  3TU4 B;  5B0Z A;  3VH6 A;  1F66 D;  4XZQ B;  3WTP C;  1N1J A;  5B1L C;  1U35 A;  3AZM B;  5B31 A;  3AZI B;  3H0R C;  3REJ A;  4WNN A;  1ZLA A;  3KXB D;  1P3G B;  3AV1 D;  5C3I C;  5B0Z C;  2ARO D;  1P3I D;  3KUY B;  2YFW A;  5BS7 A;  3KWQ A;  3REH C;  1U35 C;  5B33 B;  3A1I A;  3B0D C;  3LEL B;  5B31 C;  2HIO B;  2HUE B;  3AYW A;  1EQZ D;  5B0Y B;  4XUJ A;  3REJ C;  5B2J D;  2F8N G;  2CWE A;  3UTA B;  4KUD D;  3A6N A;  4J8X A;  1W2E A;  2F8N H;  5BS7 C;  3KWQ C;  3AZF B;  3AFA A;  1P3P A;  5GSU B;  3MGQ A;  1ID3 B;  3W96 D;  2W8S A;  4NE5 A;  2PYO B;  3MGS B;  3AYW C;  4ZUX B;  3AZG B;  4XUJ C;  3EPK A;  3C1C A;  3UTB A;  2Y2O A;  3A6N C;  4J8X C;  1M19 A;  3REI B;  3X1V B;  3W97 D;  4DRA A;  3AFA C;  3AV2 A;  3AN2 A;  3MGQ C;  5GT3 D;  4WZS B;  1P3P C;  3UT9 D;  2UWX A;  2Y2J A;  3V9R A;  3C1C C;  2CV5 A;  3AZN D;  1JFI A;  1F66 B;  1M19 C;  3B6G D;  5B2I A;  4R8P C;  3AN2 C;  3AV2 C;  3MGR D;  2IO5 B;  1KX5 D;  4X23 D;  3VH6 T;  5CP6 D;  1P3L A;  5AV6 D;  5CPK A;  4E45 A;  2NZD C;  2CV5 C;  3REK D;  5B40 B;  5B2I C;  1S32 B;  4YS3 D;  5AV9 B;  1PZR A;  2DQN C;  4H9S A;  5E5A A;  5KDM B;  4J8W A;  5BNV A;  5FUG A;  5AVB A;  4Z5T B;  5CPK C;  3NQJ A;  3MVD B;  3A1K A;  5AV8 A;  2J8P A;  3O62 D;  5BO0 A;  5B24 B;  4ZBJ C;  1KX3 B;  4KGC D;  4AWL B;  5B1M D;  3MGP A;  1P34 D;  4J8W C;  1HQ3 D;  4H9S C;  5E5A C;  4M6B A;  1M18 B;  4J8U D;  5AVB C;  1KX4 B;  4NFT A;  3LZ0 D;  3LZ1 A;  2Y2L A;  3W98 D;  3MGP C;  3WTP B;  5B1L B;  1BH8 A;  4UUZ A;  5CPI D;  5F99 D;  3WAA D;  4H9N A;  3R45 B;  3LZ1 C;  3REL D;  5B31 G;  2BYM A;  1TZY B;  5C3I B;  3X1S A;  1N1J B;  1U35 B;  1Z2C B;  2JE5 A;  3B0D B;  5B31 B;  1M1A A;  3REJ B;  4WNN B;  5AY8 D;  4H9Q A;  1ZLA B;  3W99 D;  4LD9 D;  3X1S C;  2YFW B;  3KWQ B;  3TU4 D;  1F1E A;  1P3O A;  3AZJ C;  3KFU G;  2Y2P A;  4XZQ D;  3AYW B;  1M1A C;  4EO5 C;  4XUJ B;  4YM6 A;  4G91 C;  3AZH A;  3AZM D;  3AZI D;  3A6N B;  4J8X B;  5BNX A;  2FFF B;  1P3G D;  3AFA B;  1P3P B;  4JJN A;  1P3O C;  3MGQ B;  3KUY D;  2FJ7 A;  5JRG B;  4Z66 A;  3AZL C;  5B33 D;  4Z2M H;  3AZH C;  3LEL D;  2HIO D;  3B0C W;  5B0Y D;  3UTB B;  5CPJ A;  1M19 B;  2Y2N A;  3X1T A;  3UTA D;  1T3U A;  3AN2 B;  2FJ7 C;  4JJN C;  5GT0 B;  4Z66 C;  3AZF D;  1P3B A;  5GSU D;  1ID3 D;  3V9R B;  4J8V A;  2PYO D;  3MGS D;  2CV5 B;  4ZUX D;  3AZG D;  1JFI B;  3X1T C;  5B2I B;  1P3M A;  2RIQ A;  1P3F B;  3REI D;  3X1V D;  1P3B C;  1EQZ A;  1P3L B;  4WU9 A;  5CPK B;  4CAY A;  4LD9 B;  4UPK A;  3AV1 C;  3WKJ B;  1P3M C;  3MNN A;  3REH A;  4J8W B;  5BNV B;  5FUG B;  1EQZ C;  5AVB B;  4WU9 C;  5B2J C;  3NQJ B;  5AV8 B;  4KUD C;  5BO0 B;  1H3O A;  3C1B A;  3MNN C;  3MGP B;  5B40 D;  2JCH A;  1S32 D;  2G5I C;  5JA4 A;  1BH9 A;  4WV4 B;  3B6F A;  5AV9 D;  4Z5T D;  3LZ1 B;  5AVC A;  3MVD D;  2BYK A;  5AV5 A;  4WU8 A;  2JSS A;  3C1B C;  5B24 D;  4HGA C;  4G92 C;  3MGR A;  1KX3 D;  1BH8 B;  1R4V A;  4UUZ B;  3B6F C;  4NE3 A;  2F8N B;  1M18 D;  4H9N B;  1KX4 D;  5AVC C;  4WU8 C;  5AV5 C;  3AZK A;  4R8P A;  3MGR C;  4YS3 A;  1KX5 C;  4X23 C;  3WTP D;  5B1L D;  2Y2G A;  3X1U A;  2Y2H A;  1M1A B;  4EO5 B;  3WA9 A;  2NZD A;  4G91 B;  4KGC A;  2G5H C;  3AZK C;  5DNN B;  5B1M A;  4YS3 C;  1TZY D;  1AOI A;  1U35 D;  3X1U C;  3WA9 C;  4YM6 B;  3AZH B;  2LY8 A;  3W98 A;  5B31 D;  4KGC C;  3REJ D;  5B1M C;  1ZLA D;  5BNX B;  4J8U C;  1AOI C;  4JJN B;  2FJ7 B;  3KWQ D;  2NQB A;  4Z66 B;  3LZ0 C;  2Y2M A;  3W98 C;  3AYW D;  1P3A A;  5CPJ B;  4XUJ D;  5CHL B;  5GXQ A;  2Y2K A;  4DRB A;  3A6N D;  4J8X D;  5F99 C;  2NQB C;  3AFA D;  1P3B B;  1P3P D;  3MGQ D;  2XD1 A;  4J8V B;  3W99 A;  5JRG D;  1P3A C;  5DNM B;  5GXQ C;  1P3M B;  3UTB D;  1M19 D;  3AL0 C;  3EPH A;  3AN2 D;  3AV2 D;  4WU9 B;  5GT0 D;  3W99 C;  4CAY B;  3AZE A;  2CV5 D;  4H9R A;  5B0Z B;  1P3G A;  4WJ3 C;  2VQR A;  5B2I D;  3REH B;  3AZJ A;  5B32 A;  1P3F D;  2RVQ C;  4QLC A;  3AZI C;  3AZE C;  3IP4 C;  5B0Y A;  3LJA A;  5CPK D;  1H3O B;  1P3L D;  1P3K A;  3UTA A;  1P3G C;  3C1B B;  3WKJ D;  4HGA B;  5JA4 B;  1BH9 B;  5B32 C;  2ZM5 A;  3B6F B;  1ID3 A;  4J8W D;  3AZL A;  5E5A D;  4QLC C;  1B6W A;  2HUE C;  5B0Y C;  5AVB D;  3LJA C;  3NQU A;  5AVC B;  2BYK B;  5AV5 B;  4WU8 B;  5AV8 D;  1P3K C;  3UTA C;  4Z2M G;  3MGP D;  1ID3 C;  3C1C B;  1WWI A;  3P5J B;  4CSR A;  3AZK B;  1F66 A;  3LZ1 D;  4R8P B;  3AV2 B;  3X1U B;  3WA9 B;  2NZD B;  2F8N D;  5G49 A;  3KXB A;  3AV1 A;  1P3I A;  2ARO A;  1F66 C;  3H0L C;  3VH6 W;  2YFV A;  1AOI B;  4H9P A;  5B2J A;  4KHA A;  1TAF A;  4NE6 A;  3KXB C;  4KUD A;  1M1A D;  1P3I C;  2ARO C;  4ZBJ B;  1WWS A;  5DNN D;  3W96 A;  5E5A B;  2NQB B;  1M18 A;  1Q9C A;  2F8N K;  4YM6 D;  3AZH D;  5GXQ B;  3W97 A;  1KX3 C;  4AWL C;  5GT3 A;  3W96 C;  3UT9 A;  1M18 C;  2FJ7 D;  4JJN D;  3AZN A;  4Z66 D;  3B6G A;  3W97 C;  2XD5 A;  5CPJ D;  5GT3 C;  3EPJ A;  3X1T D;  1KX5 A;  4X23 A;  3UT9 C;  5CP6 A;  5AV6 A;  4E44 A;  3REK A;  5B32 G;  3AZN C;  1P3B D;  3AZE B;  3B6G C;  5BT1 D;  2BYM B;  4J8V D;  4H9R B;  1TZY C;  3X1S B;  5DNM D;  1P3M D;  5CP6 C;  3AZJ B;  5B32 B;  5AV6 C;  1KU5 A;  3REK C;  3O62 A;  4QLC B;  4H9Q B;  4WU9 D;  3LJA B;  1ZLA C;  1P3K B;  1P34 A;  1HQ3 A;  4J8U A;  5B0Z D;  1P3O B;  2BG1 A;  3MNN D;  3REH D;  3AZL B;  3O62 C;  3LZ0 A;  5JRG A;  1HTA A;  3NQU B;  1A7W A;  1P34 C;  1HQ3 C;  3B0C T;  3C1B D;  5CPI A;  4H9O A;  5F99 A;  3WAA A;  5GT0 A;  2L5A A;  5JRG C;  3REL A;  3B6F D;  4CSR B;  3KSY A;  1ULY A;  3UTB C;  3X1T B;  5AVC D;  3F6T A;  5AV5 D;  4WU8 D;  5CPI C;  1P3F A;  3WAA C;  5GT0 C;  5AY8 A;  3REL C;  5G49 B;  3KXB B;  4LD9 A;  3AV1 B;  1P3I B;  3C1C D;  2ARO B;  3WKJ A;  3VH5 W;  3TU4 A;  3AZK D;  2YFV B;  4XZQ A;  4R8P D;  1P3F C;  4H9P B;  1EQZ B;  5AY8 C;  5B2J B;  4KHA B;  1TAF B;  3AZM A;  1P3L C;  3AZI A;  3X1U D;  2F2A C;  4KUD B;  4LD9 C;  2ZY3 A;  3WA9 D;  3WKJ C;  2NZD D;  3TU4 C;  3MNN B;  4DQY B;  3KUY A;  4XZQ C;  3W96 B;  3H0M C;  5B33 A;  1AOI D;  3LEL A;  3AZM C;  2HIO A;  5AV8 C;  3FDD A;  3EPL A;  2Y2I A;  3W97 B;  4G92 B;  3KUY C;  5GT3 B;  2ZY2 A;  1BFM A;  3UT9 B;  3AZF A;  5B33 C;  5GSU A;  3LEL C;  2PYO A;  3MGS A;  2HIO C;  2F8N A;  2ZY4 A;  4ZUX A;  3AZG A;  3AZN B;  2NQB D;  1B67 A;  3B6G B;  2Y2Q A;  1P3A D;  2ZY5 A;  3MGR B;  3VH5 A;  1KX5 B;  3REI A;  5GXQ D;  4X23 B;  3X1V A;  3AZF C;  5CP6 B;  5GSU C;  5AV6 B;  2PYO C;  3MGS C;  3REK B;  4ZUX C;  3AZG C;  2DF4 C;  4YS3 B;  5DNN A;  3REI C;  3X1V C;  3O62 B; 
#chains in the Genus database with same CATH homology
 2RVQ D;  4KGC B;  3AZE D;  5B1M B;  5B40 A;  3B0B A;  5DNN C;  3EG5 B;  1HQ3 B;  1S32 A;  1P34 B;  4J8U B;  3X1S D;  2IO5 C;  5AV9 A;  5KDM A;  3LZ0 B;  3AZJ D;  5B32 D;  4Z5T A;  3MVD A;  4YM6 C;  3W98 B;  3WTP E;  4QLC D;  5B24 A;  3LJA D;  5B40 C;  1S32 C;  1KX3 A;  1P3K D;  5CPI B;  4H9O B;  5AV9 C;  5F99 B;  3WAA B;  1P3O D;  1KX4 A;  4Z5T C;  3REL B;  3MVD C;  3AZL D;  1P3A B;  5B24 C;  5CPJ C;  5DNM A;  3WTP A;  5B1L A;  3VH5 T;  5AY8 B;  1KX4 C;  3W99 B;  5BT1 C;  4J8V C;  3R45 A;  5DNM C;  1TZY A;  3TU4 B;  5B0Z A;  3VH6 A;  1F66 D;  4XZQ B;  3WTP C;  1N1J A;  5B1L C;  1U35 A;  3AZM B;  5B31 A;  3AZI B;  3H0R C;  3REJ A;  4WNN A;  1ZLA A;  3KXB D;  1P3G B;  3AV1 D;  5C3I C;  5B0Z C;  2ARO D;  1P3I D;  3KUY B;  2YFW A;  5BS7 A;  3KWQ A;  3REH C;  1U35 C;  5B33 B;  3A1I A;  3B0D C;  3LEL B;  5B31 C;  2HIO B;  2HUE B;  3AYW A;  1EQZ D;  5B0Y B;  4XUJ A;  3REJ C;  5B2J D;  2F8N G;  2CWE A;  3UTA B;  4KUD D;  3A6N A;  4J8X A;  1W2E A;  2F8N H;  5BS7 C;  3KWQ C;  3AZF B;  3AFA A;  1P3P A;  5GSU B;  3MGQ A;  1ID3 B;  3W96 D;  2W8S A;  4NE5 A;  2PYO B;  3MGS B;  3AYW C;  4ZUX B;  3AZG B;  4XUJ C;  3EPK A;  3C1C A;  3UTB A;  2Y2O A;  3A6N C;  4J8X C;  1M19 A;  3REI B;  3X1V B;  3W97 D;  4DRA A;  3AFA C;  3AV2 A;  3AN2 A;  3MGQ C;  5GT3 D;  4WZS B;  1P3P C;  3UT9 D;  2UWX A;  2Y2J A;  3V9R A;  3C1C C;  2CV5 A;  3AZN D;  1JFI A;  1F66 B;  1M19 C;  3B6G D;  5B2I A;  4R8P C;  3AN2 C;  3AV2 C;  3MGR D;  2IO5 B;  1KX5 D;  4X23 D;  3VH6 T;  5CP6 D;  1P3L A;  5AV6 D;  5CPK A;  4E45 A;  2NZD C;  2CV5 C;  3REK D;  5B40 B;  5B2I C;  1S32 B;  4YS3 D;  5AV9 B;  1PZR A;  2DQN C;  4H9S A;  5E5A A;  5KDM B;  4J8W A;  5BNV A;  5FUG A;  5AVB A;  4Z5T B;  5CPK C;  3NQJ A;  3MVD B;  3A1K A;  5AV8 A;  2J8P A;  3O62 D;  5BO0 A;  5B24 B;  4ZBJ C;  1KX3 B;  4KGC D;  4AWL B;  5B1M D;  3MGP A;  1P34 D;  4J8W C;  1HQ3 D;  4H9S C;  5E5A C;  4M6B A;  1M18 B;  4J8U D;  5AVB C;  1KX4 B;  4NFT A;  3LZ0 D;  3LZ1 A;  2Y2L A;  3W98 D;  3MGP C;  3WTP B;  5B1L B;  1BH8 A;  4UUZ A;  5CPI D;  5F99 D;  3WAA D;  4H9N A;  3R45 B;  3LZ1 C;  3REL D;  5B31 G;  2BYM A;  1TZY B;  5C3I B;  3X1S A;  1N1J B;  1U35 B;  1Z2C B;  2JE5 A;  3B0D B;  5B31 B;  1M1A A;  3REJ B;  4WNN B;  5AY8 D;  4H9Q A;  1ZLA B;  3W99 D;  4LD9 D;  3X1S C;  2YFW B;  3KWQ B;  3TU4 D;  1F1E A;  1P3O A;  3AZJ C;  3KFU G;  2Y2P A;  4XZQ D;  3AYW B;  1M1A C;  4EO5 C;  4XUJ B;  4YM6 A;  4G91 C;  3AZH A;  3AZM D;  3AZI D;  3A6N B;  4J8X B;  5BNX A;  2FFF B;  1P3G D;  3AFA B;  1P3P B;  4JJN A;  1P3O C;  3MGQ B;  3KUY D;  2FJ7 A;  5JRG B;  4Z66 A;  3AZL C;  5B33 D;  4Z2M H;  3AZH C;  3LEL D;  2HIO D;  3B0C W;  5B0Y D;  3UTB B;  5CPJ A;  1M19 B;  2Y2N A;  3X1T A;  3UTA D;  1T3U A;  3AN2 B;  2FJ7 C;  4JJN C;  5GT0 B;  4Z66 C;  3AZF D;  1P3B A;  5GSU D;  1ID3 D;  3V9R B;  4J8V A;  2PYO D;  3MGS D;  2CV5 B;  4ZUX D;  3AZG D;  1JFI B;  3X1T C;  5B2I B;  1P3M A;  2RIQ A;  1P3F B;  3REI D;  3X1V D;  1P3B C;  1EQZ A;  1P3L B;  4WU9 A;  5CPK B;  4CAY A;  4LD9 B;  4UPK A;  3AV1 C;  3WKJ B;  1P3M C;  3MNN A;  3REH A;  4J8W B;  5BNV B;  5FUG B;  1EQZ C;  5AVB B;  4WU9 C;  5B2J C;  3NQJ B;  5AV8 B;  4KUD C;  5BO0 B;  1H3O A;  3C1B A;  3MNN C;  3MGP B;  5B40 D;  2JCH A;  1S32 D;  2G5I C;  5JA4 A;  1BH9 A;  4WV4 B;  3B6F A;  5AV9 D;  4Z5T D;  3LZ1 B;  5AVC A;  3MVD D;  2BYK A;  5AV5 A;  4WU8 A;  2JSS A;  3C1B C;  5B24 D;  4HGA C;  4G92 C;  3MGR A;  1KX3 D;  1BH8 B;  1R4V A;  4UUZ B;  3B6F C;  4NE3 A;  2F8N B;  1M18 D;  4H9N B;  1KX4 D;  5AVC C;  4WU8 C;  5AV5 C;  3AZK A;  4R8P A;  3MGR C;  4YS3 A;  1KX5 C;  4X23 C;  3WTP D;  5B1L D;  2Y2G A;  3X1U A;  2Y2H A;  1M1A B;  4EO5 B;  3WA9 A;  2NZD A;  4G91 B;  4KGC A;  2G5H C;  3AZK C;  5DNN B;  5B1M A;  4YS3 C;  1TZY D;  1AOI A;  1U35 D;  3X1U C;  3WA9 C;  4YM6 B;  3AZH B;  2LY8 A;  3W98 A;  5B31 D;  4KGC C;  3REJ D;  5B1M C;  1ZLA D;  5BNX B;  4J8U C;  1AOI C;  4JJN B;  2FJ7 B;  3KWQ D;  2NQB A;  4Z66 B;  3LZ0 C;  2Y2M A;  3W98 C;  3AYW D;  1P3A A;  5CPJ B;  4XUJ D;  5CHL B;  5GXQ A;  2Y2K A;  4DRB A;  3A6N D;  4J8X D;  5F99 C;  2NQB C;  3AFA D;  1P3B B;  1P3P D;  3MGQ D;  2XD1 A;  4J8V B;  3W99 A;  5JRG D;  1P3A C;  5DNM B;  5GXQ C;  1P3M B;  3UTB D;  1M19 D;  3AL0 C;  3EPH A;  3AN2 D;  3AV2 D;  4WU9 B;  5GT0 D;  3W99 C;  4CAY B;  3AZE A;  2CV5 D;  4H9R A;  5B0Z B;  1P3G A;  4WJ3 C;  2VQR A;  5B2I D;  3REH B;  3AZJ A;  5B32 A;  1P3F D;  2RVQ C;  4QLC A;  3AZI C;  3AZE C;  3IP4 C;  5B0Y A;  3LJA A;  5CPK D;  1H3O B;  1P3L D;  1P3K A;  3UTA A;  1P3G C;  3C1B B;  3WKJ D;  4HGA B;  5JA4 B;  1BH9 B;  5B32 C;  2ZM5 A;  3B6F B;  1ID3 A;  4J8W D;  3AZL A;  5E5A D;  4QLC C;  1B6W A;  2HUE C;  5B0Y C;  5AVB D;  3LJA C;  3NQU A;  5AVC B;  2BYK B;  5AV5 B;  4WU8 B;  5AV8 D;  1P3K C;  3UTA C;  4Z2M G;  3MGP D;  1ID3 C;  3C1C B;  1WWI A;  3P5J B;  4CSR A;  3AZK B;  1F66 A;  3LZ1 D;  4R8P B;  3AV2 B;  3X1U B;  3WA9 B;  2NZD B;  2F8N D;  5G49 A;  3KXB A;  3AV1 A;  1P3I A;  2ARO A;  1F66 C;  3H0L C;  3VH6 W;  2YFV A;  1AOI B;  4H9P A;  5B2J A;  4KHA A;  1TAF A;  4NE6 A;  3KXB C;  4KUD A;  1M1A D;  1P3I C;  2ARO C;  4ZBJ B;  1WWS A;  5DNN D;  3W96 A;  5E5A B;  2NQB B;  1M18 A;  1Q9C A;  2F8N K;  4YM6 D;  3AZH D;  5GXQ B;  3W97 A;  1KX3 C;  4AWL C;  5GT3 A;  3W96 C;  3UT9 A;  1M18 C;  2FJ7 D;  4JJN D;  3AZN A;  4Z66 D;  3B6G A;  3W97 C;  2XD5 A;  5CPJ D;  5GT3 C;  3EPJ A;  3X1T D;  1KX5 A;  4X23 A;  3UT9 C;  5CP6 A;  5AV6 A;  4E44 A;  3REK A;  5B32 G;  3AZN C;  1P3B D;  3AZE B;  3B6G C;  5BT1 D;  2BYM B;  4J8V D;  4H9R B;  1TZY C;  3X1S B;  5DNM D;  1P3M D;  5CP6 C;  3AZJ B;  5B32 B;  5AV6 C;  1KU5 A;  3REK C;  3O62 A;  4QLC B;  4H9Q B;  4WU9 D;  3LJA B;  1ZLA C;  1P3K B;  1P34 A;  1HQ3 A;  4J8U A;  5B0Z D;  1P3O B;  2BG1 A;  3MNN D;  3REH D;  3AZL B;  3O62 C;  3LZ0 A;  5JRG A;  1HTA A;  3NQU B;  1A7W A;  1P34 C;  1HQ3 C;  3B0C T;  3C1B D;  5CPI A;  4H9O A;  5F99 A;  3WAA A;  5GT0 A;  2L5A A;  5JRG C;  3REL A;  3B6F D;  4CSR B;  3KSY A;  1ULY A;  3UTB C;  3X1T B;  5AVC D;  3F6T A;  5AV5 D;  4WU8 D;  5CPI C;  1P3F A;  3WAA C;  5GT0 C;  5AY8 A;  3REL C;  5G49 B;  3KXB B;  4LD9 A;  3AV1 B;  1P3I B;  3C1C D;  2ARO B;  3WKJ A;  3VH5 W;  3TU4 A;  3AZK D;  2YFV B;  4XZQ A;  4R8P D;  1P3F C;  4H9P B;  1EQZ B;  5AY8 C;  5B2J B;  4KHA B;  1TAF B;  3AZM A;  1P3L C;  3AZI A;  3X1U D;  2F2A C;  4KUD B;  4LD9 C;  2ZY3 A;  3WA9 D;  3WKJ C;  2NZD D;  3TU4 C;  3MNN B;  4DQY B;  3KUY A;  4XZQ C;  3W96 B;  3H0M C;  5B33 A;  1AOI D;  3LEL A;  3AZM C;  2HIO A;  5AV8 C;  3FDD A;  3EPL A;  2Y2I A;  3W97 B;  4G92 B;  3KUY C;  5GT3 B;  2ZY2 A;  1BFM A;  3UT9 B;  3AZF A;  5B33 C;  5GSU A;  3LEL C;  2PYO A;  3MGS A;  2HIO C;  2F8N A;  2ZY4 A;  4ZUX A;  3AZG A;  3AZN B;  2NQB D;  1B67 A;  3B6G B;  2Y2Q A;  1P3A D;  2ZY5 A;  3MGR B;  3VH5 A;  1KX5 B;  3REI A;  5GXQ D;  4X23 B;  3X1V A;  3AZF C;  5CP6 B;  5GSU C;  5AV6 B;  2PYO C;  3MGS C;  3REK B;  4ZUX C;  3AZG C;  2DF4 C;  4YS3 B;  5DNN A;  3REI C;  3X1V C;  3O62 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...