4JJND

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KVRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4jjnD00
2NZDC 3AZHB 4Z5TA 2AROA 5AV9B 5CPJB 5GT3A 5B1LB 4E44A 4R8PB 5B2ID 5B32A 5AV8C 5B33C 3RELC 3B0DC 5B2JB 3AZED 2YFWA 5GXQC 5B24D 5AVBA 2LY8A 3AV1D 3AV2D 4X23A 3WAAA 1P34D 3UTAB 2PYOD 3NQUA 5B31B 5GT0D 3AZIA 3W98B 5CPKC 3MGQD 3W96A 3MGPA 2CV5D 3AZLD 4YS3A 4KHAB 3AZFC 1KX4C 1ZLAD 1P3OD 1A7WA 3UTBD 5GSUB 3MGRC 3AZMC 3MNNC 3AFAC 4ZUXC 2FJ7B 3X1TC 4EO5B 1M19B 3A6NB 1P3KA 5JRGC 3LJAD 3AZJC 5DNNB 4QLCB 3O62D 1TZYC 1F66D 4KUDC 4KGCA 4H9NA 5B0ZD 2NZDA 2BYKA 5AV6C 5AY8D 1P3PB 3TU4B 3VH5W 1H3OB 4WV4B 4DRBA 3AZND 4H9PA 3AZEB 3AZKC 5AV8A 5B24B 5B33A 4JJND 3RELA 3X1VC 5GXQA 1S32D 3UT9D 3AV2B 3AN2C 4XUJD 2PYOB 1BH8A 4J8VC 4J8UD 4Z5TB 1WWIA 5E5AD 5CPKA 3AZLB 3WTPC 4LD9D 3LZ0C 5DNMC 5F99D 5GT3B 3VH6W 4G92B 1HQ3D 4YM6C 1M18C 3AZFA 1P3OB 1KX4A 3REIC 3UTBB 5G49B 2NQBD 3B6FD 3MGRA 3AZMA 3MNNA 3AFAA 4Z2MG 4ZUXA 3X1TA 3MGSD 4J8WB 1EQZC 5JRGA 3O62B 4XZQB 2IO5C 3C1CC 3AZJA 1F66B 2HIOC 5JA4A 1TZYA 3KUYC 3NQJB 5B2IC 4KUDA 5B40C 5AV9D 5AY8B 5B1LD 5AV6A 4UUZB 1U35D 3AZNB 4J8XD 3AV1C 1P3MC 4ZBJB 1P34C 4WNNB 4JJNB 1ULYA 3AZKA 5GT0C 3X1VA 3REJC 2CV5C 3LZ1D 1P3GD 4AWLC 5B31D 3AN2A 4H9QB 4J8UB 2F8NG 3W98D 5KDMA 1M1AD 4J8VA 1ID3D 1P3AC 2YFVA 2BYKB 3X1UB 5F99B 1N1JA 1KX3C 3WTPA 3LZ0A 1HQ3B 5DNMA 4Z66D 3LJAC 5GSUD 3B6FB 5CPID 2NQBB 4H9SC 4YM6A 1M18A 2FJ7D 3LELD 3REIA 1M19D 3A6ND 3AYWD 1KX5C 1JFIA 5B0ZC 3MGSB 4CSRA 3V9RB 4QLCD 3AZGC 1P3ID 3REHC 1B67A 1EQZA 3C1CA 3C1BD 2HIOA 3KXBD 3KUYA 1P3PD 5B2IA 5B40A 3TU4D 1P3FD 1U35B 5CPKB 4WU9B 1P3BC 4J8XB 3W99C 4WU8D 3UT9C 4XUJC 3W97B 2L5AA 3AV1A 1P3MA 3MVDC 2RVQD 1KU5A 1P34A 3X1SC 5B1MC 5GT0A 1BFMA 3X1TB 5E5AC 3LZ1B 3VH5A 1P3GB 3REJA 2CWEA 5JRGB 2CV5A 3WAAD 1M1AB 5CP6C 1AOIC 3B6GC 4Z5TD 2AROD 2HUEC 1ID3B 4G91B 5BNXA 5C3IC 5GT3D 4NE6A 1P3AA 5AV6B 4Z66B 1KX3A 5CPIB 5B32D 3REKC 3LJAA 3LELB 4H9SA 3B0CW 5FUGB 3AZHC 3AYWB 4J8WD 3WKJB 5AVBD 1KX5A 3KSYA 4H9OB 5AV9C 5CPJC 5B0ZA 4XZQD 3KWQB 1P3IB 3VH6A 4X23D 4R8PC 2BYMA 3AZGA 3C1BB 3REHA 3KXBB 1TAFB 4H9RB 5B2JC 5BO0B 1P3FB 5B0YC 3W96D 3MGPD 4J8VB 5BT1C 4YS3D 5AV5B 4WU8B 3WTPB 2F8NA 3UTAC 1P3BA 3W99A 3WA9C 3UT9A 4XUJA 5BS7C 3MVDA 1P3LC 1F1EA 1P3KD 4CAYA 3X1SA 5B1MA 3WAAB 5E5AA 1WWSA 4KGCD 3B0CT 5GSUC 2AROB 2NZDD 5CP6A 2FJ7C 1AOIA 3X1UD 1HTAA 3B6GA 5AVCC 4EO5C 3R45A 5B32B 5DNNC 3REKA 3VH5T 5AV8D 2YFWB 5B33D 5AVBB 3AZHA 3TU4C 5AV9A 5CPJA 4X23B 3NQUB 3WTPE 4R8PA 3AZIB 3AZEC 3W96B 5B24C 3MGPB 5B2JA 4YS3B 5CPKD 4WU9D 5B0YA 5BNXB 2JSSA 3AV2C 3W97D 2PYOC 1KX4D 3UTAA 3WA9A 3MGRD 3VH6T 3MNND 3AFAD 4Z2MH 5BS7A 3MGQC 1P3KB 4ZUXD 3X1TD 1P3LA 3AZLC 5JRGD 4G92C 1ZLAC 1BH9A 3AZJD 4HGAB 4KGCB 4KHAA 1P3OC 3UTBC 1TZYD 4H9NB 4KUDD 2NZDB 5GSUA 5AV6D 2FJ7A 5AVCA 4J8WC 3O62C 4XZQC 1F66C 5DNNA 4H9PB 5AV8B 4DRAA 3WKJD 5B33B 4NE3A 3RELB 3B0DB 5AY8C 3AZKD 3KWQD 5GXQB 3MVDB 4NFTA 3X1VD 3TU4A 3AN2D 3AZNC 1BH8B 1H3OA 2F8NH 4ZBJC 4J8VD 4JJNC 5AV5D 3AZEA 5B24A 1S32C 3WTPD 3LZ0D 3AZFB 1KX4B 3AV2A 3R45B 4YM6D 1M18D 4J8UC 2PYOA 3REID 3MGRB 3AZMB 3MNNB 3AFAB 5BNVA 4ZUXB 3REKB 4LD9C 3MGQA 3X1UC 5F99C 3AZLA 3AZJB 1HQ3C 1EQZD 5JA4B 3B6FC 2NQBC 1TZYB 3C1CD 1ZLAA 2HIOD 4KUDB 1P3OA 3UTBA 5G49A 5B31G 3KUYD 5B40D 3MGSC 5B0YB 4J8WA 3O62A 4XZQA 1F66A 1P3MD 5B1LC 3NQJA 3AZKB 3WA9B 5AY8A 3X1VB 1U35C 1P3LB 4UUZA 4WU9C 3AN2B 4J8XC 3REJD 3AZID 3W97C 1BH9B 5KDMB 3AZNA 2YFVB 4WNNA 1N1JB 4JJNA 1P3AD 4WZSB 3LZ0B 5DNMB 3LZ1C 5AVCB 1S32A 1KX3D 1P3GC 5B31C 4YM6B 1M18B 3REIB 3W98C 1M1AC 4H9QA 4J8UA 1JFIB 1ID3C 4G91C 4CSRB 1KX5D 4NE5A 4LD9A 4Z66C 3X1UA 5F99A 1EQZB 5CPIC 2IO5B 4E45A 3C1CB 3REHD 2HIOB 1HQ3A 3AZGD 3LELC 3B6FA 1M19C 3KUYB 2NQBA 5B2IB 1Q9CA 3A6NC 3AYWC 5B40B 3WKJC 4QLCC 3KWQC 3MGSA 1P3IC 3V9RA 1R4VA 5CHLB 2F8ND 1P3BD 3C1BC 3W99D 3AV1B 1P3MB 3RELD 3KXBC 1P34B 1P3PC 5GXQD 5B32G 3MVDD 5BNVB 1P3FC 5B1LA 5GT0B 3X1SD 5AV5C 5B1MD 1B6WA 3MGQB 3REJB 1U35A 4WU8C 2CV5B 4WU9A 4AWLB 4J8XA 2RVQC 3W97A 1ZLAB 5CP6D 1AOID 3B6GD 2F8NK 1P3AB 3AZFD 1KX3B 3WAAC 3LZ1A 3LJAB 1P3GA 5B31A 3AZMD 3REKD 4Z5TC 2AROC 3W98A 1M1AA 1KX5B 3AZHD 5GT3C 1ID3A 5B0ZB 5CPJD 3B0BA 3AZGB 2BYMB 3REHB 5B32C 4Z66A 4R8PD 5CPIA 3LELA 1M19A 5FUGA 5AVBC 3A6NA 5B2JD 3AYWA 5B0YD 3WKJA 4H9OA 5BT1D 2F8NB 4QLCA 4X23C 3KWQA 1P3BB 1P3IA 1S32B 3W99B 3UT9B 4XUJB 3UTAD 3C1BA 3WA9D 3AZIC 3KXBA 3W96C 4CAYB 3MGPC 1P3PA 1TAFA 4H9RA 1P3LD 3X1SB 4YS3C 5B1MB 5BO0A 1P3FA 5E5AB 5AV5A 4LD9B 4WU8A 5CP6B 1AOIB 3B6GB 2HUEB 4M6BA 1P3KC 5DNMD 5C3IB 5AVCD 4HGAC 4KGCC 5DNND
chains in the Genus database with same CATH superfamily
2VQRA 2NZDC 2JE5A 3AZHB 4Z5TA 2AROA 5AV9B 5CPJB 5GT3A 5B1LB 4E44A 4R8PB 5B2ID 5B32A 5AV8C 5B33C 4WJ3C 3RELC 3B0DC 5B2JB 3AZED 2YFWA 5GXQC 5B24D 5AVBA 2LY8A 3AV1D 3AV2D 4X23A 3WAAA 1P34D 3UTAB 2PYOD 3NQUA 5B31B 5GT0D 3AZIA 3W98B 5CPKC 3MGQD 3W96A 3MGPA 2CV5D 3AZLD 4YS3A 2Y2LA 4KHAB 3AZFC 1KX4C 1ZLAD 1P3OD 1A7WA 3UTBD 5GSUB 3MGRC 3EPJA 3MNNC 3AFAC 3AZMC 4ZUXC 2FJ7B 3X1TC 4EO5B 1M19B 3A6NB 1P3KA 5JRGC 3EPHA 3LJAD 3AZJC 5DNNB 4QLCB 3O62D 1TZYC 1F66D 4KUDC 4KGCA 4H9NA 5B0ZD 2NZDA 2BYKA 5AV6C 5AY8D 1P3PB 3TU4B 3VH5W 2W8SA 1H3OB 4WV4B 4DRBA 3AZND 4H9PA 3AZEB 3AZKC 5AV8A 5B24B 5B33A 4JJND 3RELA 3X1VC 2Y2PA 5GXQA 1S32D 3UT9D 3AV2B 3AN2C 4XUJD 2PYOB 1BH8A 4J8VC 4J8UD 2G5HC 4Z5TB 1WWIA 5E5AD 5CPKA 3AZLB 3WTPC 4LD9D 3LZ0C 5DNMC 5F99D 5GT3B 3VH6W 4G92B 1HQ3D 4YM6C 1M18C 3EPLA 3AZFA 1P3OB 3REIC 3UTBB 5G49B 1KX4A 2NQBD 3B6FD 2ZY4A 3MGRA 3AZMA 3MNNA 3AFAA 4Z2MG 4ZUXA 3X1TA 3MGSD 4J8WB 1EQZC 5JRGA 3O62B 4XZQB 2IO5C 3C1CC 3AZJA 1F66B 2HIOC 5JA4A 1TZYA 3KUYC 3NQJB 5B2IC 4KUDA 5B40C 5AV9D 5AY8B 5B1LD 5AV6A 4UUZB 1U35D 3AZNB 4J8XD 3AV1C 1P3MC 4ZBJB 1P34C 4WNNB 4JJNB 1ULYA 3AZKA 5GT0C 3X1VA 3REJC 2CV5C 3LZ1D 1P3GD 4AWLC 5B31D 3AN2A 4H9QB 4J8UB 2F8NG 3W98D 5KDMA 3A1IA 1M1AD 4J8VA 1ID3D 1P3AC 2YFVA 1PZRA 2BYKB 3X1UB 5F99B 1N1JA 1KX3C 2XD5A 3WTPA 3LZ0A 1HQ3B 5DNMA 4Z66D 3LJAC 5GSUD 3B6FB 5CPID 2NQBB 4H9SC 4YM6A 1M18A 2FJ7D 3LELD 3REIA 1M19D 3A6ND 3AYWD 1KX5C 1JFIA 5B0ZC 3MGSB 4CSRA 3V9RB 4QLCD 3AZGC 1P3ID 3REHC 1B67A 3AL0C 1EQZA 2Y2KA 3C1BD 3C1CA 2HIOA 3KXBD 3KUYA 1P3PD 2DQNC 5B2IA 5B40A 3TU4D 1P3FD 1U35B 5CPKB 4WU9B 1P3BC 4J8XB 3W99C 4WU8D 3UT9C 4XUJC 3W97B 2L5AA 3A1KA 3AV1A 1P3MA 3MVDC 2RVQD 1KU5A 1P34A 3X1SC 3H0MC 5B1MC 5GT0A 1BFMA 3X1TB 5E5AC 3LZ1B 3VH5A 1P3GB 3REJA 2CWEA 5JRGB 2CV5A 3WAAD 1M1AB 5CP6C 1AOIC 3B6GC 4Z5TD 2AROD 2HUEC 4UPKA 1ID3B 4G91B 5BNXA 5C3IC 5GT3D 4NE6A 3EG5B 1P3AA 5AV6B 4Z66B 1KX3A 5CPIB 5B32D 3REKC 3LJAA 3LELB 4H9SA 3B0CW 5FUGB 3AZHC 3AYWB 4J8WD 3WKJB 5AVBD 1KX5A 3KSYA 4H9OB 5AV9C 5CPJC 5B0ZA 4XZQD 3KWQB 1P3IB 3VH6A 4X23D 4R8PC 2BYMA 3AZGA 3C1BB 3REHA 3KXBB 2Y2NA 2FFFB 1TAFB 4H9RB 5B2JC 5BO0B 1P3FB 5B0YC 3W96D 3MGPD 4J8VB 5BT1C 4YS3D 5AV5B 4WU8B 3WTPB 2F8NA 3UTAC 1P3BA 3W99A 3WA9C 3UT9A 3IP4C 4XUJA 5BS7C 3MVDA 1P3LC 1F1EA 1P3KD 4CAYA 3X1SA 5B1MA 3WAAB 2Y2QA 5E5AA 4DQYB 1WWSA 4KGCD 3B0CT 2DF4C 2AROB 2ZY5A 5GSUC 2NZDD 5CP6A 2FJ7C 1AOIA 3X1UD 1HTAA 3B6GA 4EO5C 5AVCC 3R45A 5B32B 5DNNC 3REKA 3VH5T 5AV8D 2YFWB 5B33D 5AVBB 3AZHA 3TU4C 5AV9A 5CPJA 4X23B 3NQUB 3WTPE 4R8PA 3AZIB 3AZEC 3W96B 5B24C 3MGPB 5B2JA 4YS3B 5CPKD 4WU9D 5B0YA 5BNXB 2JSSA 3AV2C 3W97D 2PYOC 1KX4D 3UTAA 3WA9A 3MGRD 3VH6T 3MNND 3AFAD 4Z2MH 5BS7A 3MGQC 1P3KB 4ZUXD 2ZY3A 3X1TD 1P3LA 3AZLC 5JRGD 4G92C 1ZLAC 1BH9A 3AZJD 4HGAB 4KGCB 4KHAA 1P3OC 3UTBC 1TZYD 4H9NB 4KUDD 2NZDB 5GSUA 5AV6D 2FJ7A 5AVCA 4J8WC 2Y2GA 3O62C 4XZQC 1F66C 5DNNA 4H9PB 5AV8B 4DRAA 3WKJD 5B33B 4NE3A 3RELB 1T3UA 3B0DB 5AY8C 3AZKD 3KWQD 5GXQB 3MVDB 4NFTA 3P5JB 3X1VD 3TU4A 3AN2D 3AZNC 1BH8B 1H3OA 2F8NH 4ZBJC 4J8VD 4JJNC 5AV5D 3AZEA 5B24A 1S32C 2Y2IA 3WTPD 3LZ0D 3AZFB 1KX4B 3AV2A 3R45B 4YM6D 1M18D 4J8UC 2PYOA 3REID 3MGRB 3AZMB 3MNNB 3AFAB 5BNVA 4ZUXB 3REKB 4LD9C 3MGQA 3X1UC 5F99C 3AZLA 3AZJB 1HQ3C 1EQZD 5JA4B 3B6FC 2NQBC 1TZYB 3C1CD 1ZLAA 2HIOD 4KUDB 1P3OA 2J8PA 3UTBA 5G49A 5B31G 3KUYD 5B40D 3MGSC 5B0YB 2XD1A 4J8WA 3O62A 4XZQA 1F66A 1P3MD 5B1LC 3NQJA 2BG1A 3AZKB 3WA9B 2Y2OA 5AY8A 3X1VB 1U35C 1P3LB 4UUZA 4WU9C 3AN2B 4J8XC 3REJD 3AZID 3W97C 1BH9B 5KDMB 3AZNA 3H0RC 2YFVB 4WNNA 2ZY2A 1Z2CB 1N1JB 4JJNA 1P3AD 4WZSB 3LZ0B 5DNMB 3LZ1C 5AVCB 1S32A 1KX3D 1P3GC 5B31C 4YM6B 1M18B 3REIB 3W98C 1M1AC 4H9QA 4J8UA 1JFIB 1ID3C 4G91C 4CSRB 1KX5D 4NE5A 4LD9A 4Z66C 3X1UA 5F99A 1EQZB 2JCHA 2IO5B 4E45A 5CPIC 3C1CB 2HIOB 1HQ3A 3REHD 3AZGD 3LELC 3B6FA 1M19C 3KUYB 2NQBA 5B2IB 1Q9CA 2UWXA 3A6NC 5B40B 3AYWC 3WKJC 2Y2HA 4QLCC 3KWQC 3MGSA 1P3IC 2RIQA 3V9RA 1R4VA 5CHLB 2F8ND 1P3BD 3C1BC 3W99D 3AV1B 1P3MB 3RELD 3KXBC 3H0LC 1P34B 1P3PC 5GXQD 5B32G 3MVDD 5BNVB 1P3FC 5B1LA 5GT0B 3X1SD 5AV5C 5B1MD 2ZM5A 1B6WA 3MGQB 3REJB 1U35A 4WU8C 2CV5B 4WU9A 4AWLB 4J8XA 2RVQC 3W97A 1ZLAB 3F6TA 5CP6D 1AOID 3B6GD 2F8NK 1P3AB 3AZFD 1KX3B 3WAAC 3LZ1A 3LJAB 1P3GA 5B31A 3AZMD 2Y2MA 3REKD 4Z5TC 2AROC 3W98A 1M1AA 1KX5B 3AZHD 5GT3C 1ID3A 5B0ZB 5CPJD 3B0BA 3AZGB 2BYMB 3REHB 5B32C 4Z66A 3FDDA 4R8PD 5CPIA 3LELA 1M19A 5FUGA 5AVBC 1W2EA 5B2JD 3A6NA 3AYWA 5B0YD 3WKJA 4H9OA 5BT1D 2F8NB 4QLCA 4X23C 3KWQA 1P3BB 1P3IA 1S32B 3W99B 3UT9B 4XUJB 3UTAD 3C1BA 3WA9D 3AZIC 3KXBA 3W96C 4CAYB 3MGPC 1P3PA 1TAFA 4H9RA 1P3LD 2F2AC 3X1SB 4YS3C 5B1MB 5BO0A 1P3FA 2G5IC 5E5AB 5AV5A 4LD9B 4WU8A 3KFUG 3EPKA 5CP6B 1AOIB 3B6GB 2HUEB 4M6BA 1P3KC 2Y2JA 5C3IB 5DNMD 5AVCD 4HGAC 4KGCC 5DNND
chains in the Genus database with same CATH topology
2VQRA 2NZDC 2JE5A 3AZHB 4Z5TA 2AROA 5AV9B 5CPJB 5GT3A 5B1LB 4E44A 4R8PB 5B2ID 5B32A 5AV8C 5B33C 4WJ3C 3RELC 3B0DC 5B2JB 3AZED 2YFWA 5GXQC 5B24D 5AVBA 2LY8A 3AV1D 3AV2D 4X23A 3WAAA 1P34D 3UTAB 2PYOD 3NQUA 5B31B 5GT0D 3AZIA 3W98B 5CPKC 3MGQD 3W96A 3MGPA 2CV5D 3AZLD 4YS3A 2Y2LA 4KHAB 3AZFC 1KX4C 1ZLAD 1P3OD 1A7WA 3UTBD 5GSUB 3MGRC 3EPJA 3MNNC 3AFAC 3AZMC 4ZUXC 2FJ7B 3X1TC 4EO5B 1M19B 3A6NB 1P3KA 5JRGC 3EPHA 3LJAD 3AZJC 5DNNB 4QLCB 3O62D 1TZYC 1F66D 4KUDC 4KGCA 4H9NA 5B0ZD 2NZDA 2BYKA 5AV6C 5AY8D 1P3PB 3TU4B 3VH5W 2W8SA 1H3OB 4WV4B 4DRBA 3AZND 4H9PA 3AZEB 3AZKC 5AV8A 5B24B 5B33A 4JJND 3RELA 3X1VC 2Y2PA 5GXQA 1S32D 3UT9D 3AV2B 3AN2C 4XUJD 2PYOB 1BH8A 4J8VC 4J8UD 2G5HC 4Z5TB 1WWIA 5E5AD 5CPKA 3AZLB 3WTPC 4LD9D 3LZ0C 5DNMC 5F99D 5GT3B 3VH6W 4G92B 1HQ3D 4YM6C 1M18C 3EPLA 3AZFA 1P3OB 3REIC 3UTBB 5G49B 1KX4A 2NQBD 3B6FD 2ZY4A 3MGRA 3AZMA 3MNNA 3AFAA 4Z2MG 4ZUXA 3X1TA 3MGSD 4J8WB 1EQZC 5JRGA 3O62B 4XZQB 2IO5C 3C1CC 3AZJA 1F66B 2HIOC 5JA4A 1TZYA 3KUYC 3NQJB 5B2IC 4KUDA 5B40C 5AV9D 5AY8B 5B1LD 5AV6A 4UUZB 1U35D 3AZNB 4J8XD 3AV1C 1P3MC 4ZBJB 1P34C 4WNNB 4JJNB 1ULYA 3AZKA 5GT0C 3X1VA 3REJC 2CV5C 3LZ1D 1P3GD 4AWLC 5B31D 3AN2A 4H9QB 4J8UB 2F8NG 3W98D 5KDMA 3A1IA 1M1AD 4J8VA 1ID3D 1P3AC 2YFVA 1PZRA 2BYKB 3X1UB 5F99B 1N1JA 1KX3C 2XD5A 3WTPA 3LZ0A 1HQ3B 5DNMA 4Z66D 3LJAC 5GSUD 3B6FB 5CPID 2NQBB 4H9SC 4YM6A 1M18A 2FJ7D 3LELD 3REIA 1M19D 3A6ND 3AYWD 1KX5C 1JFIA 5B0ZC 3MGSB 4CSRA 3V9RB 4QLCD 3AZGC 1P3ID 3REHC 1B67A 3AL0C 1EQZA 2Y2KA 3C1BD 3C1CA 2HIOA 3KXBD 3KUYA 1P3PD 2DQNC 5B2IA 5B40A 3TU4D 1P3FD 1U35B 5CPKB 4WU9B 1P3BC 4J8XB 3W99C 4WU8D 3UT9C 4XUJC 3W97B 2L5AA 3A1KA 3AV1A 1P3MA 3MVDC 2RVQD 1KU5A 1P34A 3X1SC 3H0MC 5B1MC 5GT0A 1BFMA 3X1TB 5E5AC 3LZ1B 3VH5A 1P3GB 3REJA 2CWEA 5JRGB 2CV5A 3WAAD 1M1AB 5CP6C 1AOIC 3B6GC 4Z5TD 2AROD 2HUEC 4UPKA 1ID3B 4G91B 5BNXA 5C3IC 5GT3D 4NE6A 3EG5B 1P3AA 5AV6B 4Z66B 1KX3A 5CPIB 5B32D 3REKC 3LJAA 3LELB 4H9SA 3B0CW 5FUGB 3AZHC 3AYWB 4J8WD 3WKJB 5AVBD 1KX5A 3KSYA 4H9OB 5AV9C 5CPJC 5B0ZA 4XZQD 3KWQB 1P3IB 3VH6A 4X23D 4R8PC 2BYMA 3AZGA 3C1BB 3REHA 3KXBB 2Y2NA 2FFFB 1TAFB 4H9RB 5B2JC 5BO0B 1P3FB 5B0YC 3W96D 3MGPD 4J8VB 5BT1C 4YS3D 5AV5B 4WU8B 3WTPB 2F8NA 3UTAC 1P3BA 3W99A 3WA9C 3UT9A 3IP4C 4XUJA 5BS7C 3MVDA 1P3LC 1F1EA 1P3KD 4CAYA 3X1SA 5B1MA 3WAAB 2Y2QA 5E5AA 4DQYB 1WWSA 4KGCD 3B0CT 2DF4C 2AROB 2ZY5A 5GSUC 2NZDD 5CP6A 2FJ7C 1AOIA 3X1UD 1HTAA 3B6GA 4EO5C 5AVCC 3R45A 5B32B 5DNNC 3REKA 3VH5T 5AV8D 2YFWB 5B33D 5AVBB 3AZHA 3TU4C 5AV9A 5CPJA 4X23B 3NQUB 3WTPE 4R8PA 3AZIB 3AZEC 3W96B 5B24C 3MGPB 5B2JA 4YS3B 5CPKD 4WU9D 5B0YA 5BNXB 2JSSA 3AV2C 3W97D 2PYOC 1KX4D 3UTAA 3WA9A 3MGRD 3VH6T 3MNND 3AFAD 4Z2MH 5BS7A 3MGQC 1P3KB 4ZUXD 2ZY3A 3X1TD 1P3LA 3AZLC 5JRGD 4G92C 1ZLAC 1BH9A 3AZJD 4HGAB 4KGCB 4KHAA 1P3OC 3UTBC 1TZYD 4H9NB 4KUDD 2NZDB 5GSUA 5AV6D 2FJ7A 5AVCA 4J8WC 2Y2GA 3O62C 4XZQC 1F66C 5DNNA 4H9PB 5AV8B 4DRAA 3WKJD 5B33B 4NE3A 3RELB 1T3UA 3B0DB 5AY8C 3AZKD 3KWQD 5GXQB 3MVDB 4NFTA 3P5JB 3X1VD 3TU4A 3AN2D 3AZNC 1BH8B 1H3OA 2F8NH 4ZBJC 4J8VD 4JJNC 5AV5D 3AZEA 5B24A 1S32C 2Y2IA 3WTPD 3LZ0D 3AZFB 1KX4B 3AV2A 3R45B 4YM6D 1M18D 4J8UC 2PYOA 3REID 3MGRB 3AZMB 3MNNB 3AFAB 5BNVA 4ZUXB 3REKB 4LD9C 3MGQA 3X1UC 5F99C 3AZLA 3AZJB 1HQ3C 1EQZD 5JA4B 3B6FC 2NQBC 1TZYB 3C1CD 1ZLAA 2HIOD 4KUDB 1P3OA 2J8PA 3UTBA 5G49A 5B31G 3KUYD 5B40D 3MGSC 5B0YB 2XD1A 4J8WA 3O62A 4XZQA 1F66A 1P3MD 5B1LC 3NQJA 2BG1A 3AZKB 3WA9B 2Y2OA 5AY8A 3X1VB 1U35C 1P3LB 4UUZA 4WU9C 3AN2B 4J8XC 3REJD 3AZID 3W97C 1BH9B 5KDMB 3AZNA 3H0RC 2YFVB 4WNNA 2ZY2A 1Z2CB 1N1JB 4JJNA 1P3AD 4WZSB 3LZ0B 5DNMB 3LZ1C 5AVCB 1S32A 1KX3D 1P3GC 5B31C 4YM6B 1M18B 3REIB 3W98C 1M1AC 4H9QA 4J8UA 1JFIB 1ID3C 4G91C 4CSRB 1KX5D 4NE5A 4LD9A 4Z66C 3X1UA 5F99A 1EQZB 2JCHA 2IO5B 4E45A 5CPIC 3C1CB 2HIOB 1HQ3A 3REHD 3AZGD 3LELC 3B6FA 1M19C 3KUYB 2NQBA 5B2IB 1Q9CA 2UWXA 3A6NC 5B40B 3AYWC 3WKJC 2Y2HA 4QLCC 3KWQC 3MGSA 1P3IC 2RIQA 3V9RA 1R4VA 5CHLB 2F8ND 1P3BD 3C1BC 3W99D 3AV1B 1P3MB 3RELD 3KXBC 3H0LC 1P34B 1P3PC 5GXQD 5B32G 3MVDD 5BNVB 1P3FC 5B1LA 5GT0B 3X1SD 5AV5C 5B1MD 2ZM5A 1B6WA 3MGQB 3REJB 1U35A 4WU8C 2CV5B 4WU9A 4AWLB 4J8XA 2RVQC 3W97A 1ZLAB 3F6TA 5CP6D 1AOID 3B6GD 2F8NK 1P3AB 3AZFD 1KX3B 3WAAC 3LZ1A 3LJAB 1P3GA 5B31A 3AZMD 2Y2MA 3REKD 4Z5TC 2AROC 3W98A 1M1AA 1KX5B 3AZHD 5GT3C 1ID3A 5B0ZB 5CPJD 3B0BA 3AZGB 2BYMB 3REHB 5B32C 4Z66A 3FDDA 4R8PD 5CPIA 3LELA 1M19A 5FUGA 5AVBC 1W2EA 5B2JD 3A6NA 3AYWA 5B0YD 3WKJA 4H9OA 5BT1D 2F8NB 4QLCA 4X23C 3KWQA 1P3BB 1P3IA 1S32B 3W99B 3UT9B 4XUJB 3UTAD 3C1BA 3WA9D 3AZIC 3KXBA 3W96C 4CAYB 3MGPC 1P3PA 1TAFA 4H9RA 1P3LD 2F2AC 3X1SB 4YS3C 5B1MB 5BO0A 1P3FA 2G5IC 5E5AB 5AV5A 4LD9B 4WU8A 3KFUG 3EPKA 5CP6B 1AOIB 3B6GB 2HUEB 4M6BA 1P3KC 2Y2JA 5C3IB 5DNMD 5AVCD 4HGAC 4KGCC 5DNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZD C;  3AZH B;  4Z5T A;  2ARO A;  5AV9 B;  5CPJ B;  5GT3 A;  5B1L B;  4E44 A;  4R8P B;  5B2I D;  5B32 A;  5AV8 C;  5B33 C;  3REL C;  3B0D C;  5B2J B;  3AZE D;  2YFW A;  5GXQ C;  5B24 D;  5AVB A;  2LY8 A;  3AV1 D;  3AV2 D;  4X23 A;  3WAA A;  1P34 D;  3UTA B;  2PYO D;  3NQU A;  5B31 B;  5GT0 D;  3AZI A;  3W98 B;  5CPK C;  3MGQ D;  3W96 A;  3MGP A;  2CV5 D;  3AZL D;  4YS3 A;  4KHA B;  3AZF C;  1KX4 C;  1ZLA D;  1P3O D;  1A7W A;  3UTB D;  5GSU B;  3MGR C;  3AZM C;  3MNN C;  3AFA C;  4ZUX C;  2FJ7 B;  3X1T C;  4EO5 B;  1M19 B;  3A6N B;  1P3K A;  5JRG C;  3LJA D;  3AZJ C;  5DNN B;  4QLC B;  3O62 D;  1TZY C;  1F66 D;  4KUD C;  4KGC A;  4H9N A;  5B0Z D;  2NZD A;  2BYK A;  5AV6 C;  5AY8 D;  1P3P B;  3TU4 B;  3VH5 W;  1H3O B;  4WV4 B;  4DRB A;  3AZN D;  4H9P A;  3AZE B;  3AZK C;  5AV8 A;  5B24 B;  5B33 A;  4JJN D;  3REL A;  3X1V C;  5GXQ A;  1S32 D;  3UT9 D;  3AV2 B;  3AN2 C;  4XUJ D;  2PYO B;  1BH8 A;  4J8V C;  4J8U D;  4Z5T B;  1WWI A;  5E5A D;  5CPK A;  3AZL B;  3WTP C;  4LD9 D;  3LZ0 C;  5DNM C;  5F99 D;  5GT3 B;  3VH6 W;  4G92 B;  1HQ3 D;  4YM6 C;  1M18 C;  3AZF A;  1P3O B;  1KX4 A;  3REI C;  3UTB B;  5G49 B;  2NQB D;  3B6F D;  3MGR A;  3AZM A;  3MNN A;  3AFA A;  4Z2M G;  4ZUX A;  3X1T A;  3MGS D;  4J8W B;  1EQZ C;  5JRG A;  3O62 B;  4XZQ B;  2IO5 C;  3C1C C;  3AZJ A;  1F66 B;  2HIO C;  5JA4 A;  1TZY A;  3KUY C;  3NQJ B;  5B2I C;  4KUD A;  5B40 C;  5AV9 D;  5AY8 B;  5B1L D;  5AV6 A;  4UUZ B;  1U35 D;  3AZN B;  4J8X D;  3AV1 C;  1P3M C;  4ZBJ B;  1P34 C;  4WNN B;  4JJN B;  1ULY A;  3AZK A;  5GT0 C;  3X1V A;  3REJ C;  2CV5 C;  3LZ1 D;  1P3G D;  4AWL C;  5B31 D;  3AN2 A;  4H9Q B;  4J8U B;  2F8N G;  3W98 D;  5KDM A;  1M1A D;  4J8V A;  1ID3 D;  1P3A C;  2YFV A;  2BYK B;  3X1U B;  5F99 B;  1N1J A;  1KX3 C;  3WTP A;  3LZ0 A;  1HQ3 B;  5DNM A;  4Z66 D;  3LJA C;  5GSU D;  3B6F B;  5CPI D;  2NQB B;  4H9S C;  4YM6 A;  1M18 A;  2FJ7 D;  3LEL D;  3REI A;  1M19 D;  3A6N D;  3AYW D;  1KX5 C;  1JFI A;  5B0Z C;  3MGS B;  4CSR A;  3V9R B;  4QLC D;  3AZG C;  1P3I D;  3REH C;  1B67 A;  1EQZ A;  3C1C A;  3C1B D;  2HIO A;  3KXB D;  3KUY A;  1P3P D;  5B2I A;  5B40 A;  3TU4 D;  1P3F D;  1U35 B;  5CPK B;  4WU9 B;  1P3B C;  4J8X B;  3W99 C;  4WU8 D;  3UT9 C;  4XUJ C;  3W97 B;  2L5A A;  3AV1 A;  1P3M A;  3MVD C;  2RVQ D;  1KU5 A;  1P34 A;  3X1S C;  5B1M C;  5GT0 A;  1BFM A;  3X1T B;  5E5A C;  3LZ1 B;  3VH5 A;  1P3G B;  3REJ A;  2CWE A;  5JRG B;  2CV5 A;  3WAA D;  1M1A B;  5CP6 C;  1AOI C;  3B6G C;  4Z5T D;  2ARO D;  2HUE C;  1ID3 B;  4G91 B;  5BNX A;  5C3I C;  5GT3 D;  4NE6 A;  1P3A A;  5AV6 B;  4Z66 B;  1KX3 A;  5CPI B;  5B32 D;  3REK C;  3LJA A;  3LEL B;  4H9S A;  3B0C W;  5FUG B;  3AZH C;  3AYW B;  4J8W D;  3WKJ B;  5AVB D;  1KX5 A;  3KSY A;  4H9O B;  5AV9 C;  5CPJ C;  5B0Z A;  4XZQ D;  3KWQ B;  1P3I B;  3VH6 A;  4X23 D;  4R8P C;  2BYM A;  3AZG A;  3C1B B;  3REH A;  3KXB B;  1TAF B;  4H9R B;  5B2J C;  5BO0 B;  1P3F B;  5B0Y C;  3W96 D;  3MGP D;  4J8V B;  5BT1 C;  4YS3 D;  5AV5 B;  4WU8 B;  3WTP B;  2F8N A;  3UTA C;  1P3B A;  3W99 A;  3WA9 C;  3UT9 A;  4XUJ A;  5BS7 C;  3MVD A;  1P3L C;  1F1E A;  1P3K D;  4CAY A;  3X1S A;  5B1M A;  3WAA B;  5E5A A;  1WWS A;  4KGC D;  3B0C T;  5GSU C;  2ARO B;  2NZD D;  5CP6 A;  2FJ7 C;  1AOI A;  3X1U D;  1HTA A;  3B6G A;  5AVC C;  4EO5 C;  3R45 A;  5B32 B;  5DNN C;  3REK A;  3VH5 T;  5AV8 D;  2YFW B;  5B33 D;  5AVB B;  3AZH A;  3TU4 C;  5AV9 A;  5CPJ A;  4X23 B;  3NQU B;  3WTP E;  4R8P A;  3AZI B;  3AZE C;  3W96 B;  5B24 C;  3MGP B;  5B2J A;  4YS3 B;  5CPK D;  4WU9 D;  5B0Y A;  5BNX B;  2JSS A;  3AV2 C;  3W97 D;  2PYO C;  1KX4 D;  3UTA A;  3WA9 A;  3MGR D;  3VH6 T;  3MNN D;  3AFA D;  4Z2M H;  5BS7 A;  3MGQ C;  1P3K B;  4ZUX D;  3X1T D;  1P3L A;  3AZL C;  5JRG D;  4G92 C;  1ZLA C;  1BH9 A;  3AZJ D;  4HGA B;  4KGC B;  4KHA A;  1P3O C;  3UTB C;  1TZY D;  4H9N B;  4KUD D;  2NZD B;  5GSU A;  5AV6 D;  2FJ7 A;  5AVC A;  4J8W C;  3O62 C;  4XZQ C;  1F66 C;  5DNN A;  4H9P B;  5AV8 B;  4DRA A;  3WKJ D;  5B33 B;  4NE3 A;  3REL B;  3B0D B;  5AY8 C;  3AZK D;  3KWQ D;  5GXQ B;  3MVD B;  4NFT A;  3X1V D;  3TU4 A;  3AN2 D;  3AZN C;  1BH8 B;  1H3O A;  2F8N H;  4ZBJ C;  4J8V D;  4JJN C;  5AV5 D;  3AZE A;  5B24 A;  1S32 C;  3WTP D;  3LZ0 D;  3AZF B;  1KX4 B;  3AV2 A;  3R45 B;  4YM6 D;  1M18 D;  4J8U C;  2PYO A;  3REI D;  3MGR B;  3AZM B;  3MNN B;  3AFA B;  5BNV A;  4ZUX B;  3REK B;  4LD9 C;  3MGQ A;  3X1U C;  5F99 C;  3AZL A;  3AZJ B;  1HQ3 C;  1EQZ D;  5JA4 B;  3B6F C;  2NQB C;  1TZY B;  3C1C D;  1ZLA A;  2HIO D;  4KUD B;  1P3O A;  3UTB A;  5G49 A;  5B31 G;  3KUY D;  5B40 D;  3MGS C;  5B0Y B;  4J8W A;  3O62 A;  4XZQ A;  1F66 A;  1P3M D;  5B1L C;  3NQJ A;  3AZK B;  3WA9 B;  5AY8 A;  3X1V B;  1U35 C;  1P3L B;  4UUZ A;  4WU9 C;  3AN2 B;  4J8X C;  3REJ D;  3AZI D;  3W97 C;  1BH9 B;  5KDM B;  3AZN A;  2YFV B;  4WNN A;  1N1J B;  4JJN A;  1P3A D;  4WZS B;  3LZ0 B;  5DNM B;  3LZ1 C;  5AVC B;  1S32 A;  1KX3 D;  1P3G C;  5B31 C;  4YM6 B;  1M18 B;  3REI B;  3W98 C;  1M1A C;  4H9Q A;  4J8U A;  1JFI B;  1ID3 C;  4G91 C;  4CSR B;  1KX5 D;  4NE5 A;  4LD9 A;  4Z66 C;  3X1U A;  5F99 A;  1EQZ B;  5CPI C;  2IO5 B;  4E45 A;  3C1C B;  3REH D;  2HIO B;  1HQ3 A;  3AZG D;  3LEL C;  3B6F A;  1M19 C;  3KUY B;  2NQB A;  5B2I B;  1Q9C A;  3A6N C;  3AYW C;  5B40 B;  3WKJ C;  4QLC C;  3KWQ C;  3MGS A;  1P3I C;  3V9R A;  1R4V A;  5CHL B;  2F8N D;  1P3B D;  3C1B C;  3W99 D;  3AV1 B;  1P3M B;  3REL D;  3KXB C;  1P34 B;  1P3P C;  5GXQ D;  5B32 G;  3MVD D;  5BNV B;  1P3F C;  5B1L A;  5GT0 B;  3X1S D;  5AV5 C;  5B1M D;  1B6W A;  3MGQ B;  3REJ B;  1U35 A;  4WU8 C;  2CV5 B;  4WU9 A;  4AWL B;  4J8X A;  2RVQ C;  3W97 A;  1ZLA B;  5CP6 D;  1AOI D;  3B6G D;  2F8N K;  1P3A B;  3AZF D;  1KX3 B;  3WAA C;  3LZ1 A;  3LJA B;  1P3G A;  5B31 A;  3AZM D;  3REK D;  4Z5T C;  2ARO C;  3W98 A;  1M1A A;  1KX5 B;  3AZH D;  5GT3 C;  1ID3 A;  5B0Z B;  5CPJ D;  3B0B A;  3AZG B;  2BYM B;  3REH B;  5B32 C;  4Z66 A;  4R8P D;  5CPI A;  3LEL A;  1M19 A;  5FUG A;  5AVB C;  3A6N A;  5B2J D;  3AYW A;  5B0Y D;  3WKJ A;  4H9O A;  5BT1 D;  2F8N B;  4QLC A;  4X23 C;  3KWQ A;  1P3B B;  1P3I A;  1S32 B;  3W99 B;  3UT9 B;  4XUJ B;  3UTA D;  3C1B A;  3WA9 D;  3AZI C;  3KXB A;  3W96 C;  4CAY B;  3MGP C;  1P3P A;  1TAF A;  4H9R A;  1P3L D;  3X1S B;  4YS3 C;  5B1M B;  5BO0 A;  1P3F A;  5E5A B;  5AV5 A;  4LD9 B;  4WU8 A;  5CP6 B;  1AOI B;  3B6G B;  2HUE B;  4M6B A;  1P3K C;  5DNM D;  5C3I B;  5AVC D;  4HGA C;  4KGC C;  5DNN D; 
#chains in the Genus database with same CATH topology
 2VQR A;  2NZD C;  2JE5 A;  3AZH B;  4Z5T A;  2ARO A;  5AV9 B;  5CPJ B;  5GT3 A;  5B1L B;  4E44 A;  4R8P B;  5B2I D;  5B32 A;  5AV8 C;  5B33 C;  4WJ3 C;  3REL C;  3B0D C;  5B2J B;  3AZE D;  2YFW A;  5GXQ C;  5B24 D;  5AVB A;  2LY8 A;  3AV1 D;  3AV2 D;  4X23 A;  3WAA A;  1P34 D;  3UTA B;  2PYO D;  3NQU A;  5B31 B;  5GT0 D;  3AZI A;  3W98 B;  5CPK C;  3MGQ D;  3W96 A;  3MGP A;  2CV5 D;  3AZL D;  4YS3 A;  2Y2L A;  4KHA B;  3AZF C;  1KX4 C;  1ZLA D;  1P3O D;  1A7W A;  3UTB D;  5GSU B;  3MGR C;  3EPJ A;  3MNN C;  3AFA C;  3AZM C;  4ZUX C;  2FJ7 B;  3X1T C;  4EO5 B;  1M19 B;  3A6N B;  1P3K A;  5JRG C;  3EPH A;  3LJA D;  3AZJ C;  5DNN B;  4QLC B;  3O62 D;  1TZY C;  1F66 D;  4KUD C;  4KGC A;  4H9N A;  5B0Z D;  2NZD A;  2BYK A;  5AV6 C;  5AY8 D;  1P3P B;  3TU4 B;  3VH5 W;  2W8S A;  1H3O B;  4WV4 B;  4DRB A;  3AZN D;  4H9P A;  3AZE B;  3AZK C;  5AV8 A;  5B24 B;  5B33 A;  4JJN D;  3REL A;  3X1V C;  2Y2P A;  5GXQ A;  1S32 D;  3UT9 D;  3AV2 B;  3AN2 C;  4XUJ D;  2PYO B;  1BH8 A;  4J8V C;  4J8U D;  2G5H C;  4Z5T B;  1WWI A;  5E5A D;  5CPK A;  3AZL B;  3WTP C;  4LD9 D;  3LZ0 C;  5DNM C;  5F99 D;  5GT3 B;  3VH6 W;  4G92 B;  1HQ3 D;  4YM6 C;  1M18 C;  3EPL A;  3AZF A;  1P3O B;  3REI C;  3UTB B;  5G49 B;  1KX4 A;  2NQB D;  3B6F D;  2ZY4 A;  3MGR A;  3AZM A;  3MNN A;  3AFA A;  4Z2M G;  4ZUX A;  3X1T A;  3MGS D;  4J8W B;  1EQZ C;  5JRG A;  3O62 B;  4XZQ B;  2IO5 C;  3C1C C;  3AZJ A;  1F66 B;  2HIO C;  5JA4 A;  1TZY A;  3KUY C;  3NQJ B;  5B2I C;  4KUD A;  5B40 C;  5AV9 D;  5AY8 B;  5B1L D;  5AV6 A;  4UUZ B;  1U35 D;  3AZN B;  4J8X D;  3AV1 C;  1P3M C;  4ZBJ B;  1P34 C;  4WNN B;  4JJN B;  1ULY A;  3AZK A;  5GT0 C;  3X1V A;  3REJ C;  2CV5 C;  3LZ1 D;  1P3G D;  4AWL C;  5B31 D;  3AN2 A;  4H9Q B;  4J8U B;  2F8N G;  3W98 D;  5KDM A;  3A1I A;  1M1A D;  4J8V A;  1ID3 D;  1P3A C;  2YFV A;  1PZR A;  2BYK B;  3X1U B;  5F99 B;  1N1J A;  1KX3 C;  2XD5 A;  3WTP A;  3LZ0 A;  1HQ3 B;  5DNM A;  4Z66 D;  3LJA C;  5GSU D;  3B6F B;  5CPI D;  2NQB B;  4H9S C;  4YM6 A;  1M18 A;  2FJ7 D;  3LEL D;  3REI A;  1M19 D;  3A6N D;  3AYW D;  1KX5 C;  1JFI A;  5B0Z C;  3MGS B;  4CSR A;  3V9R B;  4QLC D;  3AZG C;  1P3I D;  3REH C;  1B67 A;  3AL0 C;  1EQZ A;  2Y2K A;  3C1B D;  3C1C A;  2HIO A;  3KXB D;  3KUY A;  1P3P D;  2DQN C;  5B2I A;  5B40 A;  3TU4 D;  1P3F D;  1U35 B;  5CPK B;  4WU9 B;  1P3B C;  4J8X B;  3W99 C;  4WU8 D;  3UT9 C;  4XUJ C;  3W97 B;  2L5A A;  3A1K A;  3AV1 A;  1P3M A;  3MVD C;  2RVQ D;  1KU5 A;  1P34 A;  3X1S C;  3H0M C;  5B1M C;  5GT0 A;  1BFM A;  3X1T B;  5E5A C;  3LZ1 B;  3VH5 A;  1P3G B;  3REJ A;  2CWE A;  5JRG B;  2CV5 A;  3WAA D;  1M1A B;  5CP6 C;  1AOI C;  3B6G C;  4Z5T D;  2ARO D;  2HUE C;  4UPK A;  1ID3 B;  4G91 B;  5BNX A;  5C3I C;  5GT3 D;  4NE6 A;  3EG5 B;  1P3A A;  5AV6 B;  4Z66 B;  1KX3 A;  5CPI B;  5B32 D;  3REK C;  3LJA A;  3LEL B;  4H9S A;  3B0C W;  5FUG B;  3AZH C;  3AYW B;  4J8W D;  3WKJ B;  5AVB D;  1KX5 A;  3KSY A;  4H9O B;  5AV9 C;  5CPJ C;  5B0Z A;  4XZQ D;  3KWQ B;  1P3I B;  3VH6 A;  4X23 D;  4R8P C;  2BYM A;  3AZG A;  3C1B B;  3REH A;  3KXB B;  2Y2N A;  2FFF B;  1TAF B;  4H9R B;  5B2J C;  5BO0 B;  1P3F B;  5B0Y C;  3W96 D;  3MGP D;  4J8V B;  5BT1 C;  4YS3 D;  5AV5 B;  4WU8 B;  3WTP B;  2F8N A;  3UTA C;  1P3B A;  3W99 A;  3WA9 C;  3UT9 A;  3IP4 C;  4XUJ A;  5BS7 C;  3MVD A;  1P3L C;  1F1E A;  1P3K D;  4CAY A;  3X1S A;  5B1M A;  3WAA B;  2Y2Q A;  5E5A A;  4DQY B;  1WWS A;  4KGC D;  3B0C T;  2DF4 C;  2ARO B;  2ZY5 A;  5GSU C;  2NZD D;  5CP6 A;  2FJ7 C;  1AOI A;  3X1U D;  1HTA A;  3B6G A;  4EO5 C;  5AVC C;  3R45 A;  5B32 B;  5DNN C;  3REK A;  3VH5 T;  5AV8 D;  2YFW B;  5B33 D;  5AVB B;  3AZH A;  3TU4 C;  5AV9 A;  5CPJ A;  4X23 B;  3NQU B;  3WTP E;  4R8P A;  3AZI B;  3AZE C;  3W96 B;  5B24 C;  3MGP B;  5B2J A;  4YS3 B;  5CPK D;  4WU9 D;  5B0Y A;  5BNX B;  2JSS A;  3AV2 C;  3W97 D;  2PYO C;  1KX4 D;  3UTA A;  3WA9 A;  3MGR D;  3VH6 T;  3MNN D;  3AFA D;  4Z2M H;  5BS7 A;  3MGQ C;  1P3K B;  4ZUX D;  2ZY3 A;  3X1T D;  1P3L A;  3AZL C;  5JRG D;  4G92 C;  1ZLA C;  1BH9 A;  3AZJ D;  4HGA B;  4KGC B;  4KHA A;  1P3O C;  3UTB C;  1TZY D;  4H9N B;  4KUD D;  2NZD B;  5GSU A;  5AV6 D;  2FJ7 A;  5AVC A;  4J8W C;  2Y2G A;  3O62 C;  4XZQ C;  1F66 C;  5DNN A;  4H9P B;  5AV8 B;  4DRA A;  3WKJ D;  5B33 B;  4NE3 A;  3REL B;  1T3U A;  3B0D B;  5AY8 C;  3AZK D;  3KWQ D;  5GXQ B;  3MVD B;  4NFT A;  3P5J B;  3X1V D;  3TU4 A;  3AN2 D;  3AZN C;  1BH8 B;  1H3O A;  2F8N H;  4ZBJ C;  4J8V D;  4JJN C;  5AV5 D;  3AZE A;  5B24 A;  1S32 C;  2Y2I A;  3WTP D;  3LZ0 D;  3AZF B;  1KX4 B;  3AV2 A;  3R45 B;  4YM6 D;  1M18 D;  4J8U C;  2PYO A;  3REI D;  3MGR B;  3AZM B;  3MNN B;  3AFA B;  5BNV A;  4ZUX B;  3REK B;  4LD9 C;  3MGQ A;  3X1U C;  5F99 C;  3AZL A;  3AZJ B;  1HQ3 C;  1EQZ D;  5JA4 B;  3B6F C;  2NQB C;  1TZY B;  3C1C D;  1ZLA A;  2HIO D;  4KUD B;  1P3O A;  2J8P A;  3UTB A;  5G49 A;  5B31 G;  3KUY D;  5B40 D;  3MGS C;  5B0Y B;  2XD1 A;  4J8W A;  3O62 A;  4XZQ A;  1F66 A;  1P3M D;  5B1L C;  3NQJ A;  2BG1 A;  3AZK B;  3WA9 B;  2Y2O A;  5AY8 A;  3X1V B;  1U35 C;  1P3L B;  4UUZ A;  4WU9 C;  3AN2 B;  4J8X C;  3REJ D;  3AZI D;  3W97 C;  1BH9 B;  5KDM B;  3AZN A;  3H0R C;  2YFV B;  4WNN A;  2ZY2 A;  1Z2C B;  1N1J B;  4JJN A;  1P3A D;  4WZS B;  3LZ0 B;  5DNM B;  3LZ1 C;  5AVC B;  1S32 A;  1KX3 D;  1P3G C;  5B31 C;  4YM6 B;  1M18 B;  3REI B;  3W98 C;  1M1A C;  4H9Q A;  4J8U A;  1JFI B;  1ID3 C;  4G91 C;  4CSR B;  1KX5 D;  4NE5 A;  4LD9 A;  4Z66 C;  3X1U A;  5F99 A;  1EQZ B;  2JCH A;  2IO5 B;  4E45 A;  5CPI C;  3C1C B;  2HIO B;  1HQ3 A;  3REH D;  3AZG D;  3LEL C;  3B6F A;  1M19 C;  3KUY B;  2NQB A;  5B2I B;  1Q9C A;  2UWX A;  3A6N C;  5B40 B;  3AYW C;  3WKJ C;  2Y2H A;  4QLC C;  3KWQ C;  3MGS A;  1P3I C;  2RIQ A;  3V9R A;  1R4V A;  5CHL B;  2F8N D;  1P3B D;  3C1B C;  3W99 D;  3AV1 B;  1P3M B;  3REL D;  3KXB C;  3H0L C;  1P34 B;  1P3P C;  5GXQ D;  5B32 G;  3MVD D;  5BNV B;  1P3F C;  5B1L A;  5GT0 B;  3X1S D;  5AV5 C;  5B1M D;  2ZM5 A;  1B6W A;  3MGQ B;  3REJ B;  1U35 A;  4WU8 C;  2CV5 B;  4WU9 A;  4AWL B;  4J8X A;  2RVQ C;  3W97 A;  1ZLA B;  3F6T A;  5CP6 D;  1AOI D;  3B6G D;  2F8N K;  1P3A B;  3AZF D;  1KX3 B;  3WAA C;  3LZ1 A;  3LJA B;  1P3G A;  5B31 A;  3AZM D;  2Y2M A;  3REK D;  4Z5T C;  2ARO C;  3W98 A;  1M1A A;  1KX5 B;  3AZH D;  5GT3 C;  1ID3 A;  5B0Z B;  5CPJ D;  3B0B A;  3AZG B;  2BYM B;  3REH B;  5B32 C;  4Z66 A;  3FDD A;  4R8P D;  5CPI A;  3LEL A;  1M19 A;  5FUG A;  5AVB C;  1W2E A;  5B2J D;  3A6N A;  3AYW A;  5B0Y D;  3WKJ A;  4H9O A;  5BT1 D;  2F8N B;  4QLC A;  4X23 C;  3KWQ A;  1P3B B;  1P3I A;  1S32 B;  3W99 B;  3UT9 B;  4XUJ B;  3UTA D;  3C1B A;  3WA9 D;  3AZI C;  3KXB A;  3W96 C;  4CAY B;  3MGP C;  1P3P A;  1TAF A;  4H9R A;  1P3L D;  2F2A C;  3X1S B;  4YS3 C;  5B1M B;  5BO0 A;  1P3F A;  2G5I C;  5E5A B;  5AV5 A;  4LD9 B;  4WU8 A;  3KFU G;  3EPK A;  5CP6 B;  1AOI B;  3B6G B;  2HUE B;  4M6B A;  1P3K C;  2Y2J A;  5C3I B;  5DNM D;  5AVC D;  4HGA C;  4KGC C;  5DNN D; 
#chains in the Genus database with same CATH homology
 2VQR A;  2NZD C;  2JE5 A;  3AZH B;  4Z5T A;  2ARO A;  5AV9 B;  5CPJ B;  5GT3 A;  5B1L B;  4E44 A;  4R8P B;  5B2I D;  5B32 A;  5AV8 C;  5B33 C;  4WJ3 C;  3REL C;  3B0D C;  5B2J B;  3AZE D;  2YFW A;  5GXQ C;  5B24 D;  5AVB A;  2LY8 A;  3AV1 D;  3AV2 D;  4X23 A;  3WAA A;  1P34 D;  3UTA B;  2PYO D;  3NQU A;  5B31 B;  5GT0 D;  3AZI A;  3W98 B;  5CPK C;  3MGQ D;  3W96 A;  3MGP A;  2CV5 D;  3AZL D;  4YS3 A;  2Y2L A;  4KHA B;  3AZF C;  1KX4 C;  1ZLA D;  1P3O D;  1A7W A;  3UTB D;  5GSU B;  3MGR C;  3EPJ A;  3MNN C;  3AFA C;  3AZM C;  4ZUX C;  2FJ7 B;  3X1T C;  4EO5 B;  1M19 B;  3A6N B;  1P3K A;  5JRG C;  3EPH A;  3LJA D;  3AZJ C;  5DNN B;  4QLC B;  3O62 D;  1TZY C;  1F66 D;  4KUD C;  4KGC A;  4H9N A;  5B0Z D;  2NZD A;  2BYK A;  5AV6 C;  5AY8 D;  1P3P B;  3TU4 B;  3VH5 W;  2W8S A;  1H3O B;  4WV4 B;  4DRB A;  3AZN D;  4H9P A;  3AZE B;  3AZK C;  5AV8 A;  5B24 B;  5B33 A;  4JJN D;  3REL A;  3X1V C;  2Y2P A;  5GXQ A;  1S32 D;  3UT9 D;  3AV2 B;  3AN2 C;  4XUJ D;  2PYO B;  1BH8 A;  4J8V C;  4J8U D;  2G5H C;  4Z5T B;  1WWI A;  5E5A D;  5CPK A;  3AZL B;  3WTP C;  4LD9 D;  3LZ0 C;  5DNM C;  5F99 D;  5GT3 B;  3VH6 W;  4G92 B;  1HQ3 D;  4YM6 C;  1M18 C;  3EPL A;  3AZF A;  1P3O B;  3REI C;  3UTB B;  5G49 B;  1KX4 A;  2NQB D;  3B6F D;  2ZY4 A;  3MGR A;  3AZM A;  3MNN A;  3AFA A;  4Z2M G;  4ZUX A;  3X1T A;  3MGS D;  4J8W B;  1EQZ C;  5JRG A;  3O62 B;  4XZQ B;  2IO5 C;  3C1C C;  3AZJ A;  1F66 B;  2HIO C;  5JA4 A;  1TZY A;  3KUY C;  3NQJ B;  5B2I C;  4KUD A;  5B40 C;  5AV9 D;  5AY8 B;  5B1L D;  5AV6 A;  4UUZ B;  1U35 D;  3AZN B;  4J8X D;  3AV1 C;  1P3M C;  4ZBJ B;  1P34 C;  4WNN B;  4JJN B;  1ULY A;  3AZK A;  5GT0 C;  3X1V A;  3REJ C;  2CV5 C;  3LZ1 D;  1P3G D;  4AWL C;  5B31 D;  3AN2 A;  4H9Q B;  4J8U B;  2F8N G;  3W98 D;  5KDM A;  3A1I A;  1M1A D;  4J8V A;  1ID3 D;  1P3A C;  2YFV A;  1PZR A;  2BYK B;  3X1U B;  5F99 B;  1N1J A;  1KX3 C;  2XD5 A;  3WTP A;  3LZ0 A;  1HQ3 B;  5DNM A;  4Z66 D;  3LJA C;  5GSU D;  3B6F B;  5CPI D;  2NQB B;  4H9S C;  4YM6 A;  1M18 A;  2FJ7 D;  3LEL D;  3REI A;  1M19 D;  3A6N D;  3AYW D;  1KX5 C;  1JFI A;  5B0Z C;  3MGS B;  4CSR A;  3V9R B;  4QLC D;  3AZG C;  1P3I D;  3REH C;  1B67 A;  3AL0 C;  1EQZ A;  2Y2K A;  3C1B D;  3C1C A;  2HIO A;  3KXB D;  3KUY A;  1P3P D;  2DQN C;  5B2I A;  5B40 A;  3TU4 D;  1P3F D;  1U35 B;  5CPK B;  4WU9 B;  1P3B C;  4J8X B;  3W99 C;  4WU8 D;  3UT9 C;  4XUJ C;  3W97 B;  2L5A A;  3A1K A;  3AV1 A;  1P3M A;  3MVD C;  2RVQ D;  1KU5 A;  1P34 A;  3X1S C;  3H0M C;  5B1M C;  5GT0 A;  1BFM A;  3X1T B;  5E5A C;  3LZ1 B;  3VH5 A;  1P3G B;  3REJ A;  2CWE A;  5JRG B;  2CV5 A;  3WAA D;  1M1A B;  5CP6 C;  1AOI C;  3B6G C;  4Z5T D;  2ARO D;  2HUE C;  4UPK A;  1ID3 B;  4G91 B;  5BNX A;  5C3I C;  5GT3 D;  4NE6 A;  3EG5 B;  1P3A A;  5AV6 B;  4Z66 B;  1KX3 A;  5CPI B;  5B32 D;  3REK C;  3LJA A;  3LEL B;  4H9S A;  3B0C W;  5FUG B;  3AZH C;  3AYW B;  4J8W D;  3WKJ B;  5AVB D;  1KX5 A;  3KSY A;  4H9O B;  5AV9 C;  5CPJ C;  5B0Z A;  4XZQ D;  3KWQ B;  1P3I B;  3VH6 A;  4X23 D;  4R8P C;  2BYM A;  3AZG A;  3C1B B;  3REH A;  3KXB B;  2Y2N A;  2FFF B;  1TAF B;  4H9R B;  5B2J C;  5BO0 B;  1P3F B;  5B0Y C;  3W96 D;  3MGP D;  4J8V B;  5BT1 C;  4YS3 D;  5AV5 B;  4WU8 B;  3WTP B;  2F8N A;  3UTA C;  1P3B A;  3W99 A;  3WA9 C;  3UT9 A;  3IP4 C;  4XUJ A;  5BS7 C;  3MVD A;  1P3L C;  1F1E A;  1P3K D;  4CAY A;  3X1S A;  5B1M A;  3WAA B;  2Y2Q A;  5E5A A;  4DQY B;  1WWS A;  4KGC D;  3B0C T;  2DF4 C;  2ARO B;  2ZY5 A;  5GSU C;  2NZD D;  5CP6 A;  2FJ7 C;  1AOI A;  3X1U D;  1HTA A;  3B6G A;  4EO5 C;  5AVC C;  3R45 A;  5B32 B;  5DNN C;  3REK A;  3VH5 T;  5AV8 D;  2YFW B;  5B33 D;  5AVB B;  3AZH A;  3TU4 C;  5AV9 A;  5CPJ A;  4X23 B;  3NQU B;  3WTP E;  4R8P A;  3AZI B;  3AZE C;  3W96 B;  5B24 C;  3MGP B;  5B2J A;  4YS3 B;  5CPK D;  4WU9 D;  5B0Y A;  5BNX B;  2JSS A;  3AV2 C;  3W97 D;  2PYO C;  1KX4 D;  3UTA A;  3WA9 A;  3MGR D;  3VH6 T;  3MNN D;  3AFA D;  4Z2M H;  5BS7 A;  3MGQ C;  1P3K B;  4ZUX D;  2ZY3 A;  3X1T D;  1P3L A;  3AZL C;  5JRG D;  4G92 C;  1ZLA C;  1BH9 A;  3AZJ D;  4HGA B;  4KGC B;  4KHA A;  1P3O C;  3UTB C;  1TZY D;  4H9N B;  4KUD D;  2NZD B;  5GSU A;  5AV6 D;  2FJ7 A;  5AVC A;  4J8W C;  2Y2G A;  3O62 C;  4XZQ C;  1F66 C;  5DNN A;  4H9P B;  5AV8 B;  4DRA A;  3WKJ D;  5B33 B;  4NE3 A;  3REL B;  1T3U A;  3B0D B;  5AY8 C;  3AZK D;  3KWQ D;  5GXQ B;  3MVD B;  4NFT A;  3P5J B;  3X1V D;  3TU4 A;  3AN2 D;  3AZN C;  1BH8 B;  1H3O A;  2F8N H;  4ZBJ C;  4J8V D;  4JJN C;  5AV5 D;  3AZE A;  5B24 A;  1S32 C;  2Y2I A;  3WTP D;  3LZ0 D;  3AZF B;  1KX4 B;  3AV2 A;  3R45 B;  4YM6 D;  1M18 D;  4J8U C;  2PYO A;  3REI D;  3MGR B;  3AZM B;  3MNN B;  3AFA B;  5BNV A;  4ZUX B;  3REK B;  4LD9 C;  3MGQ A;  3X1U C;  5F99 C;  3AZL A;  3AZJ B;  1HQ3 C;  1EQZ D;  5JA4 B;  3B6F C;  2NQB C;  1TZY B;  3C1C D;  1ZLA A;  2HIO D;  4KUD B;  1P3O A;  2J8P A;  3UTB A;  5G49 A;  5B31 G;  3KUY D;  5B40 D;  3MGS C;  5B0Y B;  2XD1 A;  4J8W A;  3O62 A;  4XZQ A;  1F66 A;  1P3M D;  5B1L C;  3NQJ A;  2BG1 A;  3AZK B;  3WA9 B;  2Y2O A;  5AY8 A;  3X1V B;  1U35 C;  1P3L B;  4UUZ A;  4WU9 C;  3AN2 B;  4J8X C;  3REJ D;  3AZI D;  3W97 C;  1BH9 B;  5KDM B;  3AZN A;  3H0R C;  2YFV B;  4WNN A;  2ZY2 A;  1Z2C B;  1N1J B;  4JJN A;  1P3A D;  4WZS B;  3LZ0 B;  5DNM B;  3LZ1 C;  5AVC B;  1S32 A;  1KX3 D;  1P3G C;  5B31 C;  4YM6 B;  1M18 B;  3REI B;  3W98 C;  1M1A C;  4H9Q A;  4J8U A;  1JFI B;  1ID3 C;  4G91 C;  4CSR B;  1KX5 D;  4NE5 A;  4LD9 A;  4Z66 C;  3X1U A;  5F99 A;  1EQZ B;  2JCH A;  2IO5 B;  4E45 A;  5CPI C;  3C1C B;  2HIO B;  1HQ3 A;  3REH D;  3AZG D;  3LEL C;  3B6F A;  1M19 C;  3KUY B;  2NQB A;  5B2I B;  1Q9C A;  2UWX A;  3A6N C;  5B40 B;  3AYW C;  3WKJ C;  2Y2H A;  4QLC C;  3KWQ C;  3MGS A;  1P3I C;  2RIQ A;  3V9R A;  1R4V A;  5CHL B;  2F8N D;  1P3B D;  3C1B C;  3W99 D;  3AV1 B;  1P3M B;  3REL D;  3KXB C;  3H0L C;  1P34 B;  1P3P C;  5GXQ D;  5B32 G;  3MVD D;  5BNV B;  1P3F C;  5B1L A;  5GT0 B;  3X1S D;  5AV5 C;  5B1M D;  2ZM5 A;  1B6W A;  3MGQ B;  3REJ B;  1U35 A;  4WU8 C;  2CV5 B;  4WU9 A;  4AWL B;  4J8X A;  2RVQ C;  3W97 A;  1ZLA B;  3F6T A;  5CP6 D;  1AOI D;  3B6G D;  2F8N K;  1P3A B;  3AZF D;  1KX3 B;  3WAA C;  3LZ1 A;  3LJA B;  1P3G A;  5B31 A;  3AZM D;  2Y2M A;  3REK D;  4Z5T C;  2ARO C;  3W98 A;  1M1A A;  1KX5 B;  3AZH D;  5GT3 C;  1ID3 A;  5B0Z B;  5CPJ D;  3B0B A;  3AZG B;  2BYM B;  3REH B;  5B32 C;  4Z66 A;  3FDD A;  4R8P D;  5CPI A;  3LEL A;  1M19 A;  5FUG A;  5AVB C;  1W2E A;  5B2J D;  3A6N A;  3AYW A;  5B0Y D;  3WKJ A;  4H9O A;  5BT1 D;  2F8N B;  4QLC A;  4X23 C;  3KWQ A;  1P3B B;  1P3I A;  1S32 B;  3W99 B;  3UT9 B;  4XUJ B;  3UTA D;  3C1B A;  3WA9 D;  3AZI C;  3KXB A;  3W96 C;  4CAY B;  3MGP C;  1P3P A;  1TAF A;  4H9R A;  1P3L D;  2F2A C;  3X1S B;  4YS3 C;  5B1M B;  5BO0 A;  1P3F A;  2G5I C;  5E5A B;  5AV5 A;  4LD9 B;  4WU8 A;  3KFU G;  3EPK A;  5CP6 B;  1AOI B;  3B6G B;  2HUE B;  4M6B A;  1P3K C;  2Y2J A;  5C3I B;  5DNM D;  5AVC D;  4HGA C;  4KGC C;  5DNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...