3REKD

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekD00
3MGSD 5AY8B 5CHLB 3AFAC 4E44A 1M19A 2HIOC 3WAAC 5GXQC 5E5AA 5B40D 2F8NK 1BFMA 5CPJD 2YFVB 1M18A 3UTBB 5AV9A 1P34D 5B1MB 5FUGA 3REJC 3O62A 4KHAA 4G92B 3MGQA 1Q9CA 3AFAD 3W97A 1P3BB 2HIOD 5GXQD 5GT3A 1U35B 3WAAD 3WA9C 1WWIA 3AZNA 3REJD 5CPJB 1P34B 2CV5C 1KX3C 2F8ND 5B0ZB 5AVCA 1P3LC 4H9RB 3AFAB 4WU8C 3X1TC 2HIOB 5GXQB 5B24A 3WAAB 4J8VA 4QLCB 3B0DC 5B0YC 1P3FC 1ID3A 1KX3D 2IO5B 3REJB 1P3LD 5B1MA 4ZBJC 4WU8D 1HTAA 3X1TD 3R45A 2F8NB 3B0CT 4UUZB 3WA9B 1P3BA 5B0YD 5B31C 1P3FD 5JA4A 2NQBC 5F99A 3AZKA 5BO0B 4KUDA 4LD9C 1H3OB 2CV5B 1KX3B 1HQ3A 3REIA 4KGCC 3WTPE 4HGAC 1P3LB 2PYOA 2NQBD 2AROC 1B6WA 4LD9D 3MGPA 2YFWB 3B0DB 4XZQA 5B0YB 1P3FB 1M19C 5B2JA 5E5AC 4KGCD 4H9SA 3AV2A 5GSUD 5B32G 1M18C 5AV9C 3O62C 5KDMB 3MGQC 3W97C 2NQBB 5B31B 1M19D 5GT3C 3AV1B 4YS3A 5E5AD 4LD9B 4UUZA 1M18D 4CSRA 5AV9D 4Z5TA 4X23A 3LZ0B 3VH5A 5B2IA 3AZNC 5G49A 4KGCB 3MGQD 5B1LA 1ZLAC 3W97D 2AROB 5GT3D 3B6GD 5AVCC 3NQJA 1M19B 5B24C 3AZND 5E5AB 4EO5C 4J8VC 1M18B 5AV9B 5FUGB 5JRGA 1ID3C 1ZLAD 3O62B 3KXBA 4KHAB 5AVCD 3MGQB 3LJAA 5B1MC 3W97B 5AV8A 3AZHD 4J8XD 5GT3B 5B24D 4J8VD 4J8UA 4G92C 3NQUA 1JFIA 3V9RA 3MGRA 1P3BC 3X1SA 1ID3D 3AZNB 5AV6A 5F99C 3AZKC 1P3IA 4KUDC 3A6NA 5B1MD 3LZ0A 3WKJA 1HQ3C 3REIC 1P3PA 1P3GA 4JJNB 2PYOC 1P3BD 1U35D 5F99D 5B0ZC 4J8VB 1KX4B 2CWEA 4KUDD 1TZYA 3MGPC 3LELA 4XZQC 1ID3B 5B2JC 1HQ3D 3REID 4QLCC 4H9SC 3AV2C 3AZFA 3AYWA 2PYOD 2IO5C 3W99A 3R45B 5B0ZD 4NE3A 3AZJA 4XZQD 3X1UA 5JA4B 5B2JD 5F99B 3AZKB 4YS3C 4QLCD 5AV5A 4KUDB 3AV2D 5CPIA 4Z5TC 4X23C 1HQ3B 5CP6A 5B2IC 3REIB 3AZMA 3B6FA 3AZIA 3AN2A 2PYOB 5B1LC 1N1JA 4YS3D 4JJNA 3MGPB 3WA9D 4XZQB 4X23D 5B2JB 1KX4A 1M1AB 3AV2B 2CV5D 5B1LD 5JRGC 3KXBC 4H9PA 3LJAC 2BYKA 1BH8A 2F8NG 4AWLC 3AZLA 3TU4B 4YS3B 4J8UC 4Z2MH 4J8WA 2NZDA 5DNMA 3MGRC 4CSRB 4Z5TB 5JRGD 4X23B 3AV1C 5B2IB 1F1EA 3KXBD 5G49B 3X1VA 1P3IC 3A6NC 4DRBA 5B1LB 3LZ0C 3WKJC 3RELA 1P3PC 1P3GC 4J8UD 4M6BA 3NQJB 5B31D 3MGRD 1P3MA 3AV1D 2RVQC 3B0BA 1P3ID 3LELC 3A6ND 5JRGB 2HUEC 3LZ0D 1R4VA 3UT9A 3WKJD 3KXBB 1P3PD 1P3GD 1M1AA 3AZFC 3LJAB 5B33A 4YM6A 3AZEA 3AYWC 5AV8B 4Z2MG 3W99C 2AROD 4AWLB 5BS7A 4H9NB 2RVQD 4J8UB 3REKA 3NQUB 1P3OA 1JFIB 3AZJC 5B40A 3KUYA 5B31G 3V9RB 3LELD 3MGRB 3X1UC 3X1SB 3TU4A 5AV6B 4NFTA 5AV5C 1P3IB 4DRAA 1A7WA 3AZFD 3A6NB 5CPIC 3AYWD 3WKJB 3W99D 5CP6C 3O62D 3B6FC 1P3PB 1P3GB 3AZIC 3AN2C 2JSSA 3AZJD 1F66A 4NE5A 3UTAA 5AVBA 4JJNC 1TZYB 3LELB 2HUEB 5CPID 1KX4C 3B6FD 1P3AA 1AOIA 3AZID 3AN2D 3AZFB 1TAFA 3AYWB 3W99B 3VH6T 4JJND 3AZJB 1BH9B 3X1UB 4H9NA 1P3KA 1KX4D 5AV5B 4J8WC 4XUJA 2NZDC 5DNMC 5CPIB 5DNNA 4WU8A 5CP6B 3B6FB 3AZMB 3X1VC 3AZIB 3AN2B 1S32A 3RELC 4ZUXA 1N1JB 4J8WD 5DNMD 5B32A 3AZKD 3X1VD 3W98A 3UT9C 1M1AC 4H9PB 3AZEC 4YM6C 2BYKB 5B33C 1BH8B 3W96A 3AZLB 3MNNA 3AZGA 1P3OC 3REKC 3MGPD 5B40C 4E45A 4J8WB 3KUYC 1BH9A 3LZ1B 5DNMB 2NZDB 5GSUA 3UT9D 3TU4C 3MVDA 5BNVA 2F8NH 4H9OB 3C1BB 3X1VB 5GT0A 1M1AD 5CPKB 3AZED 5B33D 4YM6D 1KX5A 3RELB 1P3OD 3REKD 1F66C 3KUYD 5BNXA 1P3MB 4NE6A 3UTAC 4Z66B 3TU4D 5AVBC 3KWQA 3WTPA 4Z5TD 3VH6W 5B2ID 3UT9B 1P3AC 1AOIC 3AZEB 5B33B 4YM6B 3REHA 3MGSB 4H9QA 1F66D 3B6GA 3UTAD 5AVBD 3REKB 1P3OB 5B40B 4WU9A 5BT1C 5AV8C 3KUYB 2FJ7A 1P3KC 1ZLAA 1P3AD 1AOID 3C1CA 3LZ1A 4XUJC 3X1SC 5DNNC 5AV6C 1EQZA 4H9OA 3C1BA 3AZHA 4J8XA 5CPKA 4WZSB 1S32C 4R8PA 3LJAD 2BYMA 1F66B 5BT1D 5AY8A 5AV8D 3UTAB 4ZUXC 1P3KD 5AVBB 2YFVA 4XUJD 3UTBA 3X1SD 5B32C 5DNND 5AV6D 4Z66A 1P3AB 1AOIB 1TZYC 1S32D 1TAFB 3W98C 4CAYB 4ZUXD 1U35A 3MGSA 3W96C 5B32D 1P3KB 3MNNC 3AZGC 1TZYD 5CPJA 4XUJB 5GSUC 5DNNB 4WU8B 1P34A 3W98D 3MVDC 3X1TB 4G91C 5GT0C 1S32B 5B0ZA 2L5AA 4H9RA 3AFAA 1KX5C 3AZMC 3W96D 4ZUXB 2HIOA 5GXQA 3WAAA 3MNND 3AZGD 5C3IC 4QLCA 3X1UD 3VH5T 5B32B 4ZBJB 3MVDD 3REJA 3KWQC 5AV5D 5GT0D 4WNNB 3WTPC 1KX5D 5CP6D 3W98B 3AZMD 2F8NA 3REHC 3B6GC 4WV4B 3WA9A 3W96B 4CAYA 3MNNB 1ULYA 3AZGB 3KWQD 5BO0A 4WU9C 1H3OA 2LY8A 4HGAB 5GSUB 3WTPD 3AZLC 2FJ7C 2CV5A 1KX3A 3MVDB 5BNVB 4G91B 5GT0B 3C1CC 3LZ1C 1P3LA 3REHD 1KX5B 3X1TA 1EQZC 3AZHC 3C1BC 1WWSA 4J8XC 5CPKC 5C3IB 4R8PC 3VH6A 4WU9D 2YFWA 5AY8C 5BNXB 2FJ7D 3KSYA 5B0YA 3AZLD 1P3FA 3B0CW 3KWQB 1B67A 3C1CD 2NZDD 3LZ1D 3WTPB 1P3MC 3UTBC 4Z66C 1EQZD 3C1BD 5CPKD 4WNNA 4R8PD 5KDMA 3REHB 3B6GB 4H9QB 5AY8D 3RELD 2NQBA 5B31A 1U35C 1KU5A 3AV1A 4LD9A 4WU9B 3MGSC 1P3MD 3UTBD 2FJ7B 5BS7C 4Z66D 1ZLAB 3C1CB 4KGCA 5CPJC 5AVCB 1P34C 1EQZB 3AZHB 4J8XB 2AROA 5B24B 4R8PB 4EO5B 2BYMB 3VH5W
chains in the Genus database with same CATH superfamily
3MGSD 5AY8B 5CHLB 3AFAC 4E44A 1M19A 2HIOC 3WAAC 5GXQC 5E5AA 5B40D 2F8NK 1BFMA 5CPJD 2YFVB 1M18A 3UTBB 3EPHA 5AV9A 1P34D 5B1MB 5FUGA 3REJC 3O62A 2RIQA 4KHAA 4G92B 3MGQA 1Q9CA 3AFAD 3W97A 1P3BB 2HIOD 5GXQD 5GT3A 1U35B 3WAAD 3P5JB 3IP4C 3WA9C 1WWIA 3AZNA 3REJD 5CPJB 1T3UA 1P34B 2CV5C 1KX3C 2F8ND 5B0ZB 5AVCA 1P3LC 4H9RB 3AFAB 4WU8C 3X1TC 2HIOB 5GXQB 5B24A 3WAAB 4J8VA 4QLCB 3B0DC 5B0YC 1P3FC 1ID3A 1KX3D 2IO5B 3REJB 1P3LD 5B1MA 4ZBJC 4WU8D 1HTAA 3X1TD 3R45A 2F8NB 3B0CT 4UUZB 3WA9B 1P3BA 5B0YD 5B31C 1P3FD 5JA4A 2NQBC 5F99A 3AZKA 5BO0B 4KUDA 4LD9C 1H3OB 2CV5B 1KX3B 1HQ3A 3REIA 2BG1A 4KGCC 3WTPE 2G5IC 4HGAC 1P3LB 2PYOA 2NQBD 2AROC 1B6WA 2Y2QA 4LD9D 3MGPA 2YFWB 3B0DB 4XZQA 5B0YB 1P3FB 1M19C 5B2JA 5E5AC 4KGCD 4H9SA 3AV2A 5GSUD 5B32G 1M18C 5AV9C 3O62C 5KDMB 3MGQC 3W97C 2NQBB 5B31B 2ZY3A 1M19D 5GT3C 3AV1B 2ZM5A 5E5AD 4YS3A 2Y2OA 4UUZA 4LD9B 1M18D 4CSRA 5AV9D 4Z5TA 4X23A 3LZ0B 3H0LC 3VH5A 5B2IA 3AZNC 5G49A 4KGCB 3MGQD 5B1LA 1ZLAC 3W97D 2AROB 5GT3D 3B6GD 5AVCC 3NQJA 1M19B 5B24C 3AZND 5E5AB 4EO5C 4J8VC 1M18B 5AV9B 5FUGB 5JRGA 1ID3C 1ZLAD 3O62B 3KXBA 4KHAB 5AVCD 3MGQB 3LJAA 5B1MC 3W97B 5AV8A 3AZHD 4J8XD 5GT3B 5B24D 4J8VD 4J8UA 4G92C 3NQUA 1JFIA 2J8PA 3V9RA 3MGRA 1P3BC 3X1SA 1ID3D 3AZNB 5AV6A 5F99C 3AZKC 1Z2CB 1P3IA 4KUDC 4WJ3C 3A6NA 5B1MD 3LZ0A 3WKJA 1HQ3C 3REIC 1P3PA 1P3GA 4JJNB 2PYOC 1P3BD 1U35D 5F99D 5B0ZC 4J8VB 1KX4B 2Y2JA 2CWEA 4KUDD 1TZYA 3MGPC 3LELA 4XZQC 1ID3B 5B2JC 1HQ3D 3REID 4QLCC 4H9SC 3AV2C 3AZFA 3AYWA 2PYOD 2IO5C 3W99A 3R45B 5B0ZD 4NE3A 3AZJA 3H0RC 4XZQD 3X1UA 5JA4B 3A1IA 5B2JD 5F99B 3AZKB 4YS3C 2DQNC 4QLCD 5AV5A 4KUDB 3AV2D 5CPIA 4Z5TC 4X23C 1HQ3B 5CP6A 5B2IC 3REIB 3AZMA 3B6FA 3AZIA 3AN2A 2PYOB 5B1LC 1N1JA 4YS3D 4JJNA 3MGPB 3WA9D 4XZQB 4X23D 5B2JB 1KX4A 1M1AB 3EPJA 3AV2B 2Y2GA 2CV5D 3EG5B 2ZY4A 5B1LD 5JRGC 3KXBC 4H9PA 3LJAC 2BYKA 1BH8A 2F8NG 4AWLC 3AZLA 3TU4B 4YS3B 4J8UC 4Z2MH 4J8WA 2NZDA 5DNMA 3MGRC 4CSRB 4Z5TB 5JRGD 4X23B 3AV1C 5B2IB 1F1EA 3KXBD 3A1KA 5G49B 3X1VA 1P3IC 2W8SA 3A6NC 4DRBA 5B1LB 3LZ0C 3WKJC 3RELA 1P3PC 1P3GC 4J8UD 4M6BA 3NQJB 5B31D 3MGRD 1P3MA 3F6TA 3AV1D 2RVQC 3B0BA 1P3ID 3LELC 3A6ND 5JRGB 2HUEC 3LZ0D 1R4VA 3UT9A 3WKJD 3KXBB 1P3PD 1P3GD 1M1AA 3AZFC 3LJAB 5B33A 4YM6A 3AZEA 3AYWC 5AV8B 4Z2MG 3W99C 2AROD 4AWLB 5BS7A 4H9NB 2RVQD 4J8UB 3REKA 3NQUB 1P3OA 1JFIB 4DQYB 3AZJC 5B40A 3KUYA 5B31G 3V9RB 3LELD 3MGRB 3X1UC 3X1SB 3TU4A 5AV6B 4NFTA 5AV5C 1P3IB 4DRAA 1A7WA 3AZFD 3A6NB 5CPIC 3AYWD 3WKJB 3W99D 5CP6C 3O62D 3B6FC 1P3PB 1P3GB 3AZIC 3AN2C 2JSSA 3AZJD 1F66A 4NE5A 3UTAA 5AVBA 4JJNC 2Y2IA 1TZYB 3LELB 2HUEB 5CPID 1KX4C 3B6FD 1P3AA 1AOIA 3AZID 3AN2D 3AZFB 1TAFA 3AYWB 3W99B 3VH6T 4JJND 3AZJB 1BH9B 3X1UB 2ZY2A 4H9NA 1P3KA 2Y2KA 1KX4D 5AV5B 4J8WC 4XUJA 2NZDC 5DNMC 5CPIB 5DNNA 4WU8A 5CP6B 3B6FB 3AZMB 3AL0C 3X1VC 3AZIB 3AN2B 1S32A 3RELC 4ZUXA 1N1JB 3EPKA 3EPLA 4J8WD 5DNMD 5B32A 3AZKD 3X1VD 3W98A 3UT9C 1M1AC 4H9PB 3AZEC 4YM6C 2BYKB 5B33C 1BH8B 3W96A 3AZLB 3MNNA 3AZGA 1P3OC 3REKC 3MGPD 5B40C 4E45A 4J8WB 3KUYC 1BH9A 3LZ1B 5DNMB 2NZDB 5GSUA 2XD1A 3UT9D 3TU4C 3MVDA 5BNVA 2F8NH 4H9OB 3C1BB 3X1VB 5GT0A 2DF4C 1M1AD 5CPKB 3AZED 5B33D 4YM6D 1KX5A 3RELB 1P3OD 3REKD 1F66C 3KUYD 1W2EA 5BNXA 1P3MB 4NE6A 3UTAC 4Z66B 3TU4D 5AVBC 3KWQA 3WTPA 4Z5TD 3VH6W 5B2ID 3UT9B 1P3AC 1AOIC 3AZEB 5B33B 4YM6B 3REHA 3MGSB 4H9QA 1F66D 3B6GA 2ZY5A 3UTAD 5AVBD 3REKB 1P3OB 5B40B 4WU9A 5BT1C 5AV8C 3KUYB 2FJ7A 1P3KC 1ZLAA 1P3AD 1AOID 2JCHA 3C1CA 3LZ1A 4XUJC 3X1SC 5DNNC 5AV6C 1EQZA 4H9OA 3C1BA 3AZHA 4J8XA 2UWXA 5CPKA 4WZSB 1S32C 4R8PA 3LJAD 2BYMA 1F66B 2Y2NA 5AY8A 2Y2HA 5BT1D 5AV8D 3UTAB 4ZUXC 1P3KD 5AVBB 2YFVA 4XUJD 3UTBA 3X1SD 5B32C 5DNND 5AV6D 4Z66A 1P3AB 1AOIB 1TZYC 1S32D 4UPKA 1TAFB 3W98C 2FFFB 4CAYB 4ZUXD 2XD5A 1U35A 3MGSA 3W96C 5B32D 1P3KB 2VQRA 3MNNC 3AZGC 1TZYD 5CPJA 4XUJB 1PZRA 5GSUC 5DNNB 4WU8B 1P34A 3W98D 3MVDC 3X1TB 4G91C 5GT0C 1S32B 5B0ZA 2L5AA 4H9RA 3AFAA 1KX5C 3AZMC 3W96D 4ZUXB 2HIOA 5GXQA 3WAAA 3MNND 3AZGD 5C3IC 4QLCA 3H0MC 3X1UD 3VH5T 5B32B 4ZBJB 3MVDD 3REJA 3KWQC 2Y2MA 5AV5D 5GT0D 4WNNB 3WTPC 2Y2LA 1KX5D 5CP6D 3W98B 3AZMD 2F8NA 2JE5A 3REHC 3B6GC 4WV4B 3WA9A 3W96B 4CAYA 3MNNB 1ULYA 3AZGB 3KWQD 5BO0A 4WU9C 1H3OA 2LY8A 4HGAB 5GSUB 3WTPD 3AZLC 2FJ7C 2CV5A 1KX3A 3MVDB 5BNVB 4G91B 5GT0B 3C1CC 3LZ1C 1P3LA 3REHD 1KX5B 3X1TA 3KFUG 1EQZC 3AZHC 3C1BC 1WWSA 4J8XC 2G5HC 5CPKC 5C3IB 4R8PC 3VH6A 4WU9D 2YFWA 5AY8C 5BNXB 2FJ7D 3KSYA 5B0YA 3AZLD 1P3FA 3B0CW 3KWQB 1B67A 3C1CD 2NZDD 3LZ1D 3WTPB 1P3MC 3UTBC 2Y2PA 4Z66C 1EQZD 3C1BD 5CPKD 3FDDA 4WNNA 5KDMA 4R8PD 3REHB 3B6GB 4H9QB 5AY8D 3RELD 2NQBA 5B31A 1U35C 1KU5A 3AV1A 4LD9A 4WU9B 3MGSC 1P3MD 3UTBD 2FJ7B 5BS7C 4Z66D 2F2AC 1ZLAB 3C1CB 4KGCA 5CPJC 5AVCB 1P34C 1EQZB 3AZHB 4J8XB 2AROA 5B24B 4R8PB 4EO5B 2BYMB 3VH5W
chains in the Genus database with same CATH topology
3MGSD 5AY8B 5CHLB 3AFAC 4E44A 1M19A 2HIOC 3WAAC 5GXQC 5E5AA 5B40D 2F8NK 1BFMA 5CPJD 2YFVB 1M18A 3UTBB 3EPHA 5AV9A 1P34D 5B1MB 5FUGA 3REJC 3O62A 2RIQA 4KHAA 4G92B 3MGQA 1Q9CA 3AFAD 3W97A 1P3BB 2HIOD 5GXQD 5GT3A 1U35B 3WAAD 3P5JB 3IP4C 3WA9C 1WWIA 3AZNA 3REJD 5CPJB 1T3UA 1P34B 2CV5C 1KX3C 2F8ND 5B0ZB 5AVCA 1P3LC 4H9RB 3AFAB 4WU8C 3X1TC 2HIOB 5GXQB 5B24A 3WAAB 4J8VA 4QLCB 3B0DC 5B0YC 1P3FC 1ID3A 1KX3D 2IO5B 3REJB 1P3LD 5B1MA 4ZBJC 4WU8D 1HTAA 3X1TD 3R45A 2F8NB 3B0CT 4UUZB 3WA9B 1P3BA 5B0YD 5B31C 1P3FD 5JA4A 2NQBC 5F99A 3AZKA 5BO0B 4KUDA 4LD9C 1H3OB 2CV5B 1KX3B 1HQ3A 3REIA 2BG1A 4KGCC 3WTPE 2G5IC 4HGAC 1P3LB 2PYOA 2NQBD 2AROC 1B6WA 2Y2QA 4LD9D 3MGPA 2YFWB 3B0DB 4XZQA 5B0YB 1P3FB 1M19C 5B2JA 5E5AC 4KGCD 4H9SA 3AV2A 5GSUD 5B32G 1M18C 5AV9C 3O62C 5KDMB 3MGQC 3W97C 2NQBB 5B31B 2ZY3A 1M19D 5GT3C 3AV1B 2ZM5A 5E5AD 4YS3A 2Y2OA 4UUZA 4LD9B 1M18D 4CSRA 5AV9D 4Z5TA 4X23A 3LZ0B 3H0LC 3VH5A 5B2IA 3AZNC 5G49A 4KGCB 3MGQD 5B1LA 1ZLAC 3W97D 2AROB 5GT3D 3B6GD 5AVCC 3NQJA 1M19B 5B24C 3AZND 5E5AB 4EO5C 4J8VC 1M18B 5AV9B 5FUGB 5JRGA 1ID3C 1ZLAD 3O62B 3KXBA 4KHAB 5AVCD 3MGQB 3LJAA 5B1MC 3W97B 5AV8A 3AZHD 4J8XD 5GT3B 5B24D 4J8VD 4J8UA 4G92C 3NQUA 1JFIA 2J8PA 3V9RA 3MGRA 1P3BC 3X1SA 1ID3D 3AZNB 5AV6A 5F99C 3AZKC 1Z2CB 1P3IA 4KUDC 4WJ3C 3A6NA 5B1MD 3LZ0A 3WKJA 1HQ3C 3REIC 1P3PA 1P3GA 4JJNB 2PYOC 1P3BD 1U35D 5F99D 5B0ZC 4J8VB 1KX4B 2Y2JA 2CWEA 4KUDD 1TZYA 3MGPC 3LELA 4XZQC 1ID3B 5B2JC 1HQ3D 3REID 4QLCC 4H9SC 3AV2C 3AZFA 3AYWA 2PYOD 2IO5C 3W99A 3R45B 5B0ZD 4NE3A 3AZJA 3H0RC 4XZQD 3X1UA 5JA4B 3A1IA 5B2JD 5F99B 3AZKB 4YS3C 2DQNC 4QLCD 5AV5A 4KUDB 3AV2D 5CPIA 4Z5TC 4X23C 1HQ3B 5CP6A 5B2IC 3REIB 3AZMA 3B6FA 3AZIA 3AN2A 2PYOB 5B1LC 1N1JA 4YS3D 4JJNA 3MGPB 3WA9D 4XZQB 4X23D 5B2JB 1KX4A 1M1AB 3EPJA 3AV2B 2Y2GA 2CV5D 3EG5B 2ZY4A 5B1LD 5JRGC 3KXBC 4H9PA 3LJAC 2BYKA 1BH8A 2F8NG 4AWLC 3AZLA 3TU4B 4YS3B 4J8UC 4Z2MH 4J8WA 2NZDA 5DNMA 3MGRC 4CSRB 4Z5TB 5JRGD 4X23B 3AV1C 5B2IB 1F1EA 3KXBD 3A1KA 5G49B 3X1VA 1P3IC 2W8SA 3A6NC 4DRBA 5B1LB 3LZ0C 3WKJC 3RELA 1P3PC 1P3GC 4J8UD 4M6BA 3NQJB 5B31D 3MGRD 1P3MA 3F6TA 3AV1D 2RVQC 3B0BA 1P3ID 3LELC 3A6ND 5JRGB 2HUEC 3LZ0D 1R4VA 3UT9A 3WKJD 3KXBB 1P3PD 1P3GD 1M1AA 3AZFC 3LJAB 5B33A 4YM6A 3AZEA 3AYWC 5AV8B 4Z2MG 3W99C 2AROD 4AWLB 5BS7A 4H9NB 2RVQD 4J8UB 3REKA 3NQUB 1P3OA 1JFIB 4DQYB 3AZJC 5B40A 3KUYA 5B31G 3V9RB 3LELD 3MGRB 3X1UC 3X1SB 3TU4A 5AV6B 4NFTA 5AV5C 1P3IB 4DRAA 1A7WA 3AZFD 3A6NB 5CPIC 3AYWD 3WKJB 3W99D 5CP6C 3O62D 3B6FC 1P3PB 1P3GB 3AZIC 3AN2C 2JSSA 3AZJD 1F66A 4NE5A 3UTAA 5AVBA 4JJNC 2Y2IA 1TZYB 3LELB 2HUEB 5CPID 1KX4C 3B6FD 1P3AA 1AOIA 3AZID 3AN2D 3AZFB 1TAFA 3AYWB 3W99B 3VH6T 4JJND 3AZJB 1BH9B 3X1UB 2ZY2A 4H9NA 1P3KA 2Y2KA 1KX4D 5AV5B 4J8WC 4XUJA 2NZDC 5DNMC 5CPIB 5DNNA 4WU8A 5CP6B 3B6FB 3AZMB 3AL0C 3X1VC 3AZIB 3AN2B 1S32A 3RELC 4ZUXA 1N1JB 3EPKA 3EPLA 4J8WD 5DNMD 5B32A 3AZKD 3X1VD 3W98A 3UT9C 1M1AC 4H9PB 3AZEC 4YM6C 2BYKB 5B33C 1BH8B 3W96A 3AZLB 3MNNA 3AZGA 1P3OC 3REKC 3MGPD 5B40C 4E45A 4J8WB 3KUYC 1BH9A 3LZ1B 5DNMB 2NZDB 5GSUA 2XD1A 3UT9D 3TU4C 3MVDA 5BNVA 2F8NH 4H9OB 3C1BB 3X1VB 5GT0A 2DF4C 1M1AD 5CPKB 3AZED 5B33D 4YM6D 1KX5A 3RELB 1P3OD 3REKD 1F66C 3KUYD 1W2EA 5BNXA 1P3MB 4NE6A 3UTAC 4Z66B 3TU4D 5AVBC 3KWQA 3WTPA 4Z5TD 3VH6W 5B2ID 3UT9B 1P3AC 1AOIC 3AZEB 5B33B 4YM6B 3REHA 3MGSB 4H9QA 1F66D 3B6GA 2ZY5A 3UTAD 5AVBD 3REKB 1P3OB 5B40B 4WU9A 5BT1C 5AV8C 3KUYB 2FJ7A 1P3KC 1ZLAA 1P3AD 1AOID 2JCHA 3C1CA 3LZ1A 4XUJC 3X1SC 5DNNC 5AV6C 1EQZA 4H9OA 3C1BA 3AZHA 4J8XA 2UWXA 5CPKA 4WZSB 1S32C 4R8PA 3LJAD 2BYMA 1F66B 2Y2NA 5AY8A 2Y2HA 5BT1D 5AV8D 3UTAB 4ZUXC 1P3KD 5AVBB 2YFVA 4XUJD 3UTBA 3X1SD 5B32C 5DNND 5AV6D 4Z66A 1P3AB 1AOIB 1TZYC 1S32D 4UPKA 1TAFB 3W98C 2FFFB 4CAYB 4ZUXD 2XD5A 1U35A 3MGSA 3W96C 5B32D 1P3KB 2VQRA 3MNNC 3AZGC 1TZYD 5CPJA 4XUJB 1PZRA 5GSUC 5DNNB 4WU8B 1P34A 3W98D 3MVDC 3X1TB 4G91C 5GT0C 1S32B 5B0ZA 2L5AA 4H9RA 3AFAA 1KX5C 3AZMC 3W96D 4ZUXB 2HIOA 5GXQA 3WAAA 3MNND 3AZGD 5C3IC 4QLCA 3H0MC 3X1UD 3VH5T 5B32B 4ZBJB 3MVDD 3REJA 3KWQC 2Y2MA 5AV5D 5GT0D 4WNNB 3WTPC 2Y2LA 1KX5D 5CP6D 3W98B 3AZMD 2F8NA 2JE5A 3REHC 3B6GC 4WV4B 3WA9A 3W96B 4CAYA 3MNNB 1ULYA 3AZGB 3KWQD 5BO0A 4WU9C 1H3OA 2LY8A 4HGAB 5GSUB 3WTPD 3AZLC 2FJ7C 2CV5A 1KX3A 3MVDB 5BNVB 4G91B 5GT0B 3C1CC 3LZ1C 1P3LA 3REHD 1KX5B 3X1TA 3KFUG 1EQZC 3AZHC 3C1BC 1WWSA 4J8XC 2G5HC 5CPKC 5C3IB 4R8PC 3VH6A 4WU9D 2YFWA 5AY8C 5BNXB 2FJ7D 3KSYA 5B0YA 3AZLD 1P3FA 3B0CW 3KWQB 1B67A 3C1CD 2NZDD 3LZ1D 3WTPB 1P3MC 3UTBC 2Y2PA 4Z66C 1EQZD 3C1BD 5CPKD 3FDDA 4WNNA 5KDMA 4R8PD 3REHB 3B6GB 4H9QB 5AY8D 3RELD 2NQBA 5B31A 1U35C 1KU5A 3AV1A 4LD9A 4WU9B 3MGSC 1P3MD 3UTBD 2FJ7B 5BS7C 4Z66D 2F2AC 1ZLAB 3C1CB 4KGCA 5CPJC 5AVCB 1P34C 1EQZB 3AZHB 4J8XB 2AROA 5B24B 4R8PB 4EO5B 2BYMB 3VH5W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGS D;  5AY8 B;  5CHL B;  3AFA C;  4E44 A;  1M19 A;  2HIO C;  3WAA C;  5GXQ C;  5E5A A;  5B40 D;  2F8N K;  1BFM A;  5CPJ D;  2YFV B;  1M18 A;  3UTB B;  5AV9 A;  1P34 D;  5B1M B;  5FUG A;  3REJ C;  3O62 A;  4KHA A;  4G92 B;  3MGQ A;  1Q9C A;  3AFA D;  3W97 A;  1P3B B;  2HIO D;  5GXQ D;  5GT3 A;  1U35 B;  3WAA D;  3WA9 C;  1WWI A;  3AZN A;  3REJ D;  5CPJ B;  1P34 B;  2CV5 C;  1KX3 C;  2F8N D;  5B0Z B;  5AVC A;  1P3L C;  4H9R B;  3AFA B;  4WU8 C;  3X1T C;  2HIO B;  5GXQ B;  5B24 A;  3WAA B;  4J8V A;  4QLC B;  3B0D C;  5B0Y C;  1P3F C;  1ID3 A;  1KX3 D;  2IO5 B;  3REJ B;  1P3L D;  5B1M A;  4ZBJ C;  4WU8 D;  1HTA A;  3X1T D;  3R45 A;  2F8N B;  3B0C T;  4UUZ B;  3WA9 B;  1P3B A;  5B0Y D;  5B31 C;  1P3F D;  5JA4 A;  2NQB C;  5F99 A;  3AZK A;  5BO0 B;  4KUD A;  4LD9 C;  1H3O B;  2CV5 B;  1KX3 B;  1HQ3 A;  3REI A;  4KGC C;  3WTP E;  4HGA C;  1P3L B;  2PYO A;  2NQB D;  2ARO C;  1B6W A;  4LD9 D;  3MGP A;  2YFW B;  3B0D B;  4XZQ A;  5B0Y B;  1P3F B;  1M19 C;  5B2J A;  5E5A C;  4KGC D;  4H9S A;  3AV2 A;  5GSU D;  5B32 G;  1M18 C;  5AV9 C;  3O62 C;  5KDM B;  3MGQ C;  3W97 C;  2NQB B;  5B31 B;  1M19 D;  5GT3 C;  3AV1 B;  4YS3 A;  5E5A D;  4LD9 B;  4UUZ A;  1M18 D;  4CSR A;  5AV9 D;  4Z5T A;  4X23 A;  3LZ0 B;  3VH5 A;  5B2I A;  3AZN C;  5G49 A;  4KGC B;  3MGQ D;  5B1L A;  1ZLA C;  3W97 D;  2ARO B;  5GT3 D;  3B6G D;  5AVC C;  3NQJ A;  1M19 B;  5B24 C;  3AZN D;  5E5A B;  4EO5 C;  4J8V C;  1M18 B;  5AV9 B;  5FUG B;  5JRG A;  1ID3 C;  1ZLA D;  3O62 B;  3KXB A;  4KHA B;  5AVC D;  3MGQ B;  3LJA A;  5B1M C;  3W97 B;  5AV8 A;  3AZH D;  4J8X D;  5GT3 B;  5B24 D;  4J8V D;  4J8U A;  4G92 C;  3NQU A;  1JFI A;  3V9R A;  3MGR A;  1P3B C;  3X1S A;  1ID3 D;  3AZN B;  5AV6 A;  5F99 C;  3AZK C;  1P3I A;  4KUD C;  3A6N A;  5B1M D;  3LZ0 A;  3WKJ A;  1HQ3 C;  3REI C;  1P3P A;  1P3G A;  4JJN B;  2PYO C;  1P3B D;  1U35 D;  5F99 D;  5B0Z C;  4J8V B;  1KX4 B;  2CWE A;  4KUD D;  1TZY A;  3MGP C;  3LEL A;  4XZQ C;  1ID3 B;  5B2J C;  1HQ3 D;  3REI D;  4QLC C;  4H9S C;  3AV2 C;  3AZF A;  3AYW A;  2PYO D;  2IO5 C;  3W99 A;  3R45 B;  5B0Z D;  4NE3 A;  3AZJ A;  4XZQ D;  3X1U A;  5JA4 B;  5B2J D;  5F99 B;  3AZK B;  4YS3 C;  4QLC D;  5AV5 A;  4KUD B;  3AV2 D;  5CPI A;  4Z5T C;  4X23 C;  1HQ3 B;  5CP6 A;  5B2I C;  3REI B;  3AZM A;  3B6F A;  3AZI A;  3AN2 A;  2PYO B;  5B1L C;  1N1J A;  4YS3 D;  4JJN A;  3MGP B;  3WA9 D;  4XZQ B;  4X23 D;  5B2J B;  1KX4 A;  1M1A B;  3AV2 B;  2CV5 D;  5B1L D;  5JRG C;  3KXB C;  4H9P A;  3LJA C;  2BYK A;  1BH8 A;  2F8N G;  4AWL C;  3AZL A;  3TU4 B;  4YS3 B;  4J8U C;  4Z2M H;  4J8W A;  2NZD A;  5DNM A;  3MGR C;  4CSR B;  4Z5T B;  5JRG D;  4X23 B;  3AV1 C;  5B2I B;  1F1E A;  3KXB D;  5G49 B;  3X1V A;  1P3I C;  3A6N C;  4DRB A;  5B1L B;  3LZ0 C;  3WKJ C;  3REL A;  1P3P C;  1P3G C;  4J8U D;  4M6B A;  3NQJ B;  5B31 D;  3MGR D;  1P3M A;  3AV1 D;  2RVQ C;  3B0B A;  1P3I D;  3LEL C;  3A6N D;  5JRG B;  2HUE C;  3LZ0 D;  1R4V A;  3UT9 A;  3WKJ D;  3KXB B;  1P3P D;  1P3G D;  1M1A A;  3AZF C;  3LJA B;  5B33 A;  4YM6 A;  3AZE A;  3AYW C;  5AV8 B;  4Z2M G;  3W99 C;  2ARO D;  4AWL B;  5BS7 A;  4H9N B;  2RVQ D;  4J8U B;  3REK A;  3NQU B;  1P3O A;  1JFI B;  3AZJ C;  5B40 A;  3KUY A;  5B31 G;  3V9R B;  3LEL D;  3MGR B;  3X1U C;  3X1S B;  3TU4 A;  5AV6 B;  4NFT A;  5AV5 C;  1P3I B;  4DRA A;  1A7W A;  3AZF D;  3A6N B;  5CPI C;  3AYW D;  3WKJ B;  3W99 D;  5CP6 C;  3O62 D;  3B6F C;  1P3P B;  1P3G B;  3AZI C;  3AN2 C;  2JSS A;  3AZJ D;  1F66 A;  4NE5 A;  3UTA A;  5AVB A;  4JJN C;  1TZY B;  3LEL B;  2HUE B;  5CPI D;  1KX4 C;  3B6F D;  1P3A A;  1AOI A;  3AZI D;  3AN2 D;  3AZF B;  1TAF A;  3AYW B;  3W99 B;  3VH6 T;  4JJN D;  3AZJ B;  1BH9 B;  3X1U B;  4H9N A;  1P3K A;  1KX4 D;  5AV5 B;  4J8W C;  4XUJ A;  2NZD C;  5DNM C;  5CPI B;  5DNN A;  4WU8 A;  5CP6 B;  3B6F B;  3AZM B;  3X1V C;  3AZI B;  3AN2 B;  1S32 A;  3REL C;  4ZUX A;  1N1J B;  4J8W D;  5DNM D;  5B32 A;  3AZK D;  3X1V D;  3W98 A;  3UT9 C;  1M1A C;  4H9P B;  3AZE C;  4YM6 C;  2BYK B;  5B33 C;  1BH8 B;  3W96 A;  3AZL B;  3MNN A;  3AZG A;  1P3O C;  3REK C;  3MGP D;  5B40 C;  4E45 A;  4J8W B;  3KUY C;  1BH9 A;  3LZ1 B;  5DNM B;  2NZD B;  5GSU A;  3UT9 D;  3TU4 C;  3MVD A;  5BNV A;  2F8N H;  4H9O B;  3C1B B;  3X1V B;  5GT0 A;  1M1A D;  5CPK B;  3AZE D;  5B33 D;  4YM6 D;  1KX5 A;  3REL B;  1P3O D;  3REK D;  1F66 C;  3KUY D;  5BNX A;  1P3M B;  4NE6 A;  3UTA C;  4Z66 B;  3TU4 D;  5AVB C;  3KWQ A;  3WTP A;  4Z5T D;  3VH6 W;  5B2I D;  3UT9 B;  1P3A C;  1AOI C;  3AZE B;  5B33 B;  4YM6 B;  3REH A;  3MGS B;  4H9Q A;  1F66 D;  3B6G A;  3UTA D;  5AVB D;  3REK B;  1P3O B;  5B40 B;  4WU9 A;  5BT1 C;  5AV8 C;  3KUY B;  2FJ7 A;  1P3K C;  1ZLA A;  1P3A D;  1AOI D;  3C1C A;  3LZ1 A;  4XUJ C;  3X1S C;  5DNN C;  5AV6 C;  1EQZ A;  4H9O A;  3C1B A;  3AZH A;  4J8X A;  5CPK A;  4WZS B;  1S32 C;  4R8P A;  3LJA D;  2BYM A;  1F66 B;  5BT1 D;  5AY8 A;  5AV8 D;  3UTA B;  4ZUX C;  1P3K D;  5AVB B;  2YFV A;  4XUJ D;  3UTB A;  3X1S D;  5B32 C;  5DNN D;  5AV6 D;  4Z66 A;  1P3A B;  1AOI B;  1TZY C;  1S32 D;  1TAF B;  3W98 C;  4CAY B;  4ZUX D;  1U35 A;  3MGS A;  3W96 C;  5B32 D;  1P3K B;  3MNN C;  3AZG C;  1TZY D;  5CPJ A;  4XUJ B;  5GSU C;  5DNN B;  4WU8 B;  1P34 A;  3W98 D;  3MVD C;  3X1T B;  4G91 C;  5GT0 C;  1S32 B;  5B0Z A;  2L5A A;  4H9R A;  3AFA A;  1KX5 C;  3AZM C;  3W96 D;  4ZUX B;  2HIO A;  5GXQ A;  3WAA A;  3MNN D;  3AZG D;  5C3I C;  4QLC A;  3X1U D;  3VH5 T;  5B32 B;  4ZBJ B;  3MVD D;  3REJ A;  3KWQ C;  5AV5 D;  5GT0 D;  4WNN B;  3WTP C;  1KX5 D;  5CP6 D;  3W98 B;  3AZM D;  2F8N A;  3REH C;  3B6G C;  4WV4 B;  3WA9 A;  3W96 B;  4CAY A;  3MNN B;  1ULY A;  3AZG B;  3KWQ D;  5BO0 A;  4WU9 C;  1H3O A;  2LY8 A;  4HGA B;  5GSU B;  3WTP D;  3AZL C;  2FJ7 C;  2CV5 A;  1KX3 A;  3MVD B;  5BNV B;  4G91 B;  5GT0 B;  3C1C C;  3LZ1 C;  1P3L A;  3REH D;  1KX5 B;  3X1T A;  1EQZ C;  3AZH C;  3C1B C;  1WWS A;  4J8X C;  5CPK C;  5C3I B;  4R8P C;  3VH6 A;  4WU9 D;  2YFW A;  5AY8 C;  5BNX B;  2FJ7 D;  3KSY A;  5B0Y A;  3AZL D;  1P3F A;  3B0C W;  3KWQ B;  1B67 A;  3C1C D;  2NZD D;  3LZ1 D;  3WTP B;  1P3M C;  3UTB C;  4Z66 C;  1EQZ D;  3C1B D;  5CPK D;  4WNN A;  4R8P D;  5KDM A;  3REH B;  3B6G B;  4H9Q B;  5AY8 D;  3REL D;  2NQB A;  5B31 A;  1U35 C;  1KU5 A;  3AV1 A;  4LD9 A;  4WU9 B;  3MGS C;  1P3M D;  3UTB D;  2FJ7 B;  5BS7 C;  4Z66 D;  1ZLA B;  3C1C B;  4KGC A;  5CPJ C;  5AVC B;  1P34 C;  1EQZ B;  3AZH B;  4J8X B;  2ARO A;  5B24 B;  4R8P B;  4EO5 B;  2BYM B;  3VH5 W; 
#chains in the Genus database with same CATH topology
 3MGS D;  5AY8 B;  5CHL B;  3AFA C;  4E44 A;  1M19 A;  2HIO C;  3WAA C;  5GXQ C;  5E5A A;  5B40 D;  2F8N K;  1BFM A;  5CPJ D;  2YFV B;  1M18 A;  3UTB B;  3EPH A;  5AV9 A;  1P34 D;  5B1M B;  5FUG A;  3REJ C;  3O62 A;  2RIQ A;  4KHA A;  4G92 B;  3MGQ A;  1Q9C A;  3AFA D;  3W97 A;  1P3B B;  2HIO D;  5GXQ D;  5GT3 A;  1U35 B;  3WAA D;  3P5J B;  3IP4 C;  3WA9 C;  1WWI A;  3AZN A;  3REJ D;  5CPJ B;  1T3U A;  1P34 B;  2CV5 C;  1KX3 C;  2F8N D;  5B0Z B;  5AVC A;  1P3L C;  4H9R B;  3AFA B;  4WU8 C;  3X1T C;  2HIO B;  5GXQ B;  5B24 A;  3WAA B;  4J8V A;  4QLC B;  3B0D C;  5B0Y C;  1P3F C;  1ID3 A;  1KX3 D;  2IO5 B;  3REJ B;  1P3L D;  5B1M A;  4ZBJ C;  4WU8 D;  1HTA A;  3X1T D;  3R45 A;  2F8N B;  3B0C T;  4UUZ B;  3WA9 B;  1P3B A;  5B0Y D;  5B31 C;  1P3F D;  5JA4 A;  2NQB C;  5F99 A;  3AZK A;  5BO0 B;  4KUD A;  4LD9 C;  1H3O B;  2CV5 B;  1KX3 B;  1HQ3 A;  3REI A;  2BG1 A;  4KGC C;  3WTP E;  2G5I C;  4HGA C;  1P3L B;  2PYO A;  2NQB D;  2ARO C;  1B6W A;  2Y2Q A;  4LD9 D;  3MGP A;  2YFW B;  3B0D B;  4XZQ A;  5B0Y B;  1P3F B;  1M19 C;  5B2J A;  5E5A C;  4KGC D;  4H9S A;  3AV2 A;  5GSU D;  5B32 G;  1M18 C;  5AV9 C;  3O62 C;  5KDM B;  3MGQ C;  3W97 C;  2NQB B;  5B31 B;  2ZY3 A;  1M19 D;  5GT3 C;  3AV1 B;  2ZM5 A;  5E5A D;  4YS3 A;  2Y2O A;  4UUZ A;  4LD9 B;  1M18 D;  4CSR A;  5AV9 D;  4Z5T A;  4X23 A;  3LZ0 B;  3H0L C;  3VH5 A;  5B2I A;  3AZN C;  5G49 A;  4KGC B;  3MGQ D;  5B1L A;  1ZLA C;  3W97 D;  2ARO B;  5GT3 D;  3B6G D;  5AVC C;  3NQJ A;  1M19 B;  5B24 C;  3AZN D;  5E5A B;  4EO5 C;  4J8V C;  1M18 B;  5AV9 B;  5FUG B;  5JRG A;  1ID3 C;  1ZLA D;  3O62 B;  3KXB A;  4KHA B;  5AVC D;  3MGQ B;  3LJA A;  5B1M C;  3W97 B;  5AV8 A;  3AZH D;  4J8X D;  5GT3 B;  5B24 D;  4J8V D;  4J8U A;  4G92 C;  3NQU A;  1JFI A;  2J8P A;  3V9R A;  3MGR A;  1P3B C;  3X1S A;  1ID3 D;  3AZN B;  5AV6 A;  5F99 C;  3AZK C;  1Z2C B;  1P3I A;  4KUD C;  4WJ3 C;  3A6N A;  5B1M D;  3LZ0 A;  3WKJ A;  1HQ3 C;  3REI C;  1P3P A;  1P3G A;  4JJN B;  2PYO C;  1P3B D;  1U35 D;  5F99 D;  5B0Z C;  4J8V B;  1KX4 B;  2Y2J A;  2CWE A;  4KUD D;  1TZY A;  3MGP C;  3LEL A;  4XZQ C;  1ID3 B;  5B2J C;  1HQ3 D;  3REI D;  4QLC C;  4H9S C;  3AV2 C;  3AZF A;  3AYW A;  2PYO D;  2IO5 C;  3W99 A;  3R45 B;  5B0Z D;  4NE3 A;  3AZJ A;  3H0R C;  4XZQ D;  3X1U A;  5JA4 B;  3A1I A;  5B2J D;  5F99 B;  3AZK B;  4YS3 C;  2DQN C;  4QLC D;  5AV5 A;  4KUD B;  3AV2 D;  5CPI A;  4Z5T C;  4X23 C;  1HQ3 B;  5CP6 A;  5B2I C;  3REI B;  3AZM A;  3B6F A;  3AZI A;  3AN2 A;  2PYO B;  5B1L C;  1N1J A;  4YS3 D;  4JJN A;  3MGP B;  3WA9 D;  4XZQ B;  4X23 D;  5B2J B;  1KX4 A;  1M1A B;  3EPJ A;  3AV2 B;  2Y2G A;  2CV5 D;  3EG5 B;  2ZY4 A;  5B1L D;  5JRG C;  3KXB C;  4H9P A;  3LJA C;  2BYK A;  1BH8 A;  2F8N G;  4AWL C;  3AZL A;  3TU4 B;  4YS3 B;  4J8U C;  4Z2M H;  4J8W A;  2NZD A;  5DNM A;  3MGR C;  4CSR B;  4Z5T B;  5JRG D;  4X23 B;  3AV1 C;  5B2I B;  1F1E A;  3KXB D;  3A1K A;  5G49 B;  3X1V A;  1P3I C;  2W8S A;  3A6N C;  4DRB A;  5B1L B;  3LZ0 C;  3WKJ C;  3REL A;  1P3P C;  1P3G C;  4J8U D;  4M6B A;  3NQJ B;  5B31 D;  3MGR D;  1P3M A;  3F6T A;  3AV1 D;  2RVQ C;  3B0B A;  1P3I D;  3LEL C;  3A6N D;  5JRG B;  2HUE C;  3LZ0 D;  1R4V A;  3UT9 A;  3WKJ D;  3KXB B;  1P3P D;  1P3G D;  1M1A A;  3AZF C;  3LJA B;  5B33 A;  4YM6 A;  3AZE A;  3AYW C;  5AV8 B;  4Z2M G;  3W99 C;  2ARO D;  4AWL B;  5BS7 A;  4H9N B;  2RVQ D;  4J8U B;  3REK A;  3NQU B;  1P3O A;  1JFI B;  4DQY B;  3AZJ C;  5B40 A;  3KUY A;  5B31 G;  3V9R B;  3LEL D;  3MGR B;  3X1U C;  3X1S B;  3TU4 A;  5AV6 B;  4NFT A;  5AV5 C;  1P3I B;  4DRA A;  1A7W A;  3AZF D;  3A6N B;  5CPI C;  3AYW D;  3WKJ B;  3W99 D;  5CP6 C;  3O62 D;  3B6F C;  1P3P B;  1P3G B;  3AZI C;  3AN2 C;  2JSS A;  3AZJ D;  1F66 A;  4NE5 A;  3UTA A;  5AVB A;  4JJN C;  2Y2I A;  1TZY B;  3LEL B;  2HUE B;  5CPI D;  1KX4 C;  3B6F D;  1P3A A;  1AOI A;  3AZI D;  3AN2 D;  3AZF B;  1TAF A;  3AYW B;  3W99 B;  3VH6 T;  4JJN D;  3AZJ B;  1BH9 B;  3X1U B;  2ZY2 A;  4H9N A;  1P3K A;  2Y2K A;  1KX4 D;  5AV5 B;  4J8W C;  4XUJ A;  2NZD C;  5DNM C;  5CPI B;  5DNN A;  4WU8 A;  5CP6 B;  3B6F B;  3AZM B;  3AL0 C;  3X1V C;  3AZI B;  3AN2 B;  1S32 A;  3REL C;  4ZUX A;  1N1J B;  3EPK A;  3EPL A;  4J8W D;  5DNM D;  5B32 A;  3AZK D;  3X1V D;  3W98 A;  3UT9 C;  1M1A C;  4H9P B;  3AZE C;  4YM6 C;  2BYK B;  5B33 C;  1BH8 B;  3W96 A;  3AZL B;  3MNN A;  3AZG A;  1P3O C;  3REK C;  3MGP D;  5B40 C;  4E45 A;  4J8W B;  3KUY C;  1BH9 A;  3LZ1 B;  5DNM B;  2NZD B;  5GSU A;  2XD1 A;  3UT9 D;  3TU4 C;  3MVD A;  5BNV A;  2F8N H;  4H9O B;  3C1B B;  3X1V B;  5GT0 A;  2DF4 C;  1M1A D;  5CPK B;  3AZE D;  5B33 D;  4YM6 D;  1KX5 A;  3REL B;  1P3O D;  3REK D;  1F66 C;  3KUY D;  1W2E A;  5BNX A;  1P3M B;  4NE6 A;  3UTA C;  4Z66 B;  3TU4 D;  5AVB C;  3KWQ A;  3WTP A;  4Z5T D;  3VH6 W;  5B2I D;  3UT9 B;  1P3A C;  1AOI C;  3AZE B;  5B33 B;  4YM6 B;  3REH A;  3MGS B;  4H9Q A;  1F66 D;  3B6G A;  2ZY5 A;  3UTA D;  5AVB D;  3REK B;  1P3O B;  5B40 B;  4WU9 A;  5BT1 C;  5AV8 C;  3KUY B;  2FJ7 A;  1P3K C;  1ZLA A;  1P3A D;  1AOI D;  2JCH A;  3C1C A;  3LZ1 A;  4XUJ C;  3X1S C;  5DNN C;  5AV6 C;  1EQZ A;  4H9O A;  3C1B A;  3AZH A;  4J8X A;  2UWX A;  5CPK A;  4WZS B;  1S32 C;  4R8P A;  3LJA D;  2BYM A;  1F66 B;  2Y2N A;  5AY8 A;  2Y2H A;  5BT1 D;  5AV8 D;  3UTA B;  4ZUX C;  1P3K D;  5AVB B;  2YFV A;  4XUJ D;  3UTB A;  3X1S D;  5B32 C;  5DNN D;  5AV6 D;  4Z66 A;  1P3A B;  1AOI B;  1TZY C;  1S32 D;  4UPK A;  1TAF B;  3W98 C;  2FFF B;  4CAY B;  4ZUX D;  2XD5 A;  1U35 A;  3MGS A;  3W96 C;  5B32 D;  1P3K B;  2VQR A;  3MNN C;  3AZG C;  1TZY D;  5CPJ A;  4XUJ B;  1PZR A;  5GSU C;  5DNN B;  4WU8 B;  1P34 A;  3W98 D;  3MVD C;  3X1T B;  4G91 C;  5GT0 C;  1S32 B;  5B0Z A;  2L5A A;  4H9R A;  3AFA A;  1KX5 C;  3AZM C;  3W96 D;  4ZUX B;  2HIO A;  5GXQ A;  3WAA A;  3MNN D;  3AZG D;  5C3I C;  4QLC A;  3H0M C;  3X1U D;  3VH5 T;  5B32 B;  4ZBJ B;  3MVD D;  3REJ A;  3KWQ C;  2Y2M A;  5AV5 D;  5GT0 D;  4WNN B;  3WTP C;  2Y2L A;  1KX5 D;  5CP6 D;  3W98 B;  3AZM D;  2F8N A;  2JE5 A;  3REH C;  3B6G C;  4WV4 B;  3WA9 A;  3W96 B;  4CAY A;  3MNN B;  1ULY A;  3AZG B;  3KWQ D;  5BO0 A;  4WU9 C;  1H3O A;  2LY8 A;  4HGA B;  5GSU B;  3WTP D;  3AZL C;  2FJ7 C;  2CV5 A;  1KX3 A;  3MVD B;  5BNV B;  4G91 B;  5GT0 B;  3C1C C;  3LZ1 C;  1P3L A;  3REH D;  1KX5 B;  3X1T A;  3KFU G;  1EQZ C;  3AZH C;  3C1B C;  1WWS A;  4J8X C;  2G5H C;  5CPK C;  5C3I B;  4R8P C;  3VH6 A;  4WU9 D;  2YFW A;  5AY8 C;  5BNX B;  2FJ7 D;  3KSY A;  5B0Y A;  3AZL D;  1P3F A;  3B0C W;  3KWQ B;  1B67 A;  3C1C D;  2NZD D;  3LZ1 D;  3WTP B;  1P3M C;  3UTB C;  2Y2P A;  4Z66 C;  1EQZ D;  3C1B D;  5CPK D;  3FDD A;  4WNN A;  5KDM A;  4R8P D;  3REH B;  3B6G B;  4H9Q B;  5AY8 D;  3REL D;  2NQB A;  5B31 A;  1U35 C;  1KU5 A;  3AV1 A;  4LD9 A;  4WU9 B;  3MGS C;  1P3M D;  3UTB D;  2FJ7 B;  5BS7 C;  4Z66 D;  2F2A C;  1ZLA B;  3C1C B;  4KGC A;  5CPJ C;  5AVC B;  1P34 C;  1EQZ B;  3AZH B;  4J8X B;  2ARO A;  5B24 B;  4R8P B;  4EO5 B;  2BYM B;  3VH5 W; 
#chains in the Genus database with same CATH homology
 3MGS D;  5AY8 B;  5CHL B;  3AFA C;  4E44 A;  1M19 A;  2HIO C;  3WAA C;  5GXQ C;  5E5A A;  5B40 D;  2F8N K;  1BFM A;  5CPJ D;  2YFV B;  1M18 A;  3UTB B;  3EPH A;  5AV9 A;  1P34 D;  5B1M B;  5FUG A;  3REJ C;  3O62 A;  2RIQ A;  4KHA A;  4G92 B;  3MGQ A;  1Q9C A;  3AFA D;  3W97 A;  1P3B B;  2HIO D;  5GXQ D;  5GT3 A;  1U35 B;  3WAA D;  3P5J B;  3IP4 C;  3WA9 C;  1WWI A;  3AZN A;  3REJ D;  5CPJ B;  1T3U A;  1P34 B;  2CV5 C;  1KX3 C;  2F8N D;  5B0Z B;  5AVC A;  1P3L C;  4H9R B;  3AFA B;  4WU8 C;  3X1T C;  2HIO B;  5GXQ B;  5B24 A;  3WAA B;  4J8V A;  4QLC B;  3B0D C;  5B0Y C;  1P3F C;  1ID3 A;  1KX3 D;  2IO5 B;  3REJ B;  1P3L D;  5B1M A;  4ZBJ C;  4WU8 D;  1HTA A;  3X1T D;  3R45 A;  2F8N B;  3B0C T;  4UUZ B;  3WA9 B;  1P3B A;  5B0Y D;  5B31 C;  1P3F D;  5JA4 A;  2NQB C;  5F99 A;  3AZK A;  5BO0 B;  4KUD A;  4LD9 C;  1H3O B;  2CV5 B;  1KX3 B;  1HQ3 A;  3REI A;  2BG1 A;  4KGC C;  3WTP E;  2G5I C;  4HGA C;  1P3L B;  2PYO A;  2NQB D;  2ARO C;  1B6W A;  2Y2Q A;  4LD9 D;  3MGP A;  2YFW B;  3B0D B;  4XZQ A;  5B0Y B;  1P3F B;  1M19 C;  5B2J A;  5E5A C;  4KGC D;  4H9S A;  3AV2 A;  5GSU D;  5B32 G;  1M18 C;  5AV9 C;  3O62 C;  5KDM B;  3MGQ C;  3W97 C;  2NQB B;  5B31 B;  2ZY3 A;  1M19 D;  5GT3 C;  3AV1 B;  2ZM5 A;  5E5A D;  4YS3 A;  2Y2O A;  4UUZ A;  4LD9 B;  1M18 D;  4CSR A;  5AV9 D;  4Z5T A;  4X23 A;  3LZ0 B;  3H0L C;  3VH5 A;  5B2I A;  3AZN C;  5G49 A;  4KGC B;  3MGQ D;  5B1L A;  1ZLA C;  3W97 D;  2ARO B;  5GT3 D;  3B6G D;  5AVC C;  3NQJ A;  1M19 B;  5B24 C;  3AZN D;  5E5A B;  4EO5 C;  4J8V C;  1M18 B;  5AV9 B;  5FUG B;  5JRG A;  1ID3 C;  1ZLA D;  3O62 B;  3KXB A;  4KHA B;  5AVC D;  3MGQ B;  3LJA A;  5B1M C;  3W97 B;  5AV8 A;  3AZH D;  4J8X D;  5GT3 B;  5B24 D;  4J8V D;  4J8U A;  4G92 C;  3NQU A;  1JFI A;  2J8P A;  3V9R A;  3MGR A;  1P3B C;  3X1S A;  1ID3 D;  3AZN B;  5AV6 A;  5F99 C;  3AZK C;  1Z2C B;  1P3I A;  4KUD C;  4WJ3 C;  3A6N A;  5B1M D;  3LZ0 A;  3WKJ A;  1HQ3 C;  3REI C;  1P3P A;  1P3G A;  4JJN B;  2PYO C;  1P3B D;  1U35 D;  5F99 D;  5B0Z C;  4J8V B;  1KX4 B;  2Y2J A;  2CWE A;  4KUD D;  1TZY A;  3MGP C;  3LEL A;  4XZQ C;  1ID3 B;  5B2J C;  1HQ3 D;  3REI D;  4QLC C;  4H9S C;  3AV2 C;  3AZF A;  3AYW A;  2PYO D;  2IO5 C;  3W99 A;  3R45 B;  5B0Z D;  4NE3 A;  3AZJ A;  3H0R C;  4XZQ D;  3X1U A;  5JA4 B;  3A1I A;  5B2J D;  5F99 B;  3AZK B;  4YS3 C;  2DQN C;  4QLC D;  5AV5 A;  4KUD B;  3AV2 D;  5CPI A;  4Z5T C;  4X23 C;  1HQ3 B;  5CP6 A;  5B2I C;  3REI B;  3AZM A;  3B6F A;  3AZI A;  3AN2 A;  2PYO B;  5B1L C;  1N1J A;  4YS3 D;  4JJN A;  3MGP B;  3WA9 D;  4XZQ B;  4X23 D;  5B2J B;  1KX4 A;  1M1A B;  3EPJ A;  3AV2 B;  2Y2G A;  2CV5 D;  3EG5 B;  2ZY4 A;  5B1L D;  5JRG C;  3KXB C;  4H9P A;  3LJA C;  2BYK A;  1BH8 A;  2F8N G;  4AWL C;  3AZL A;  3TU4 B;  4YS3 B;  4J8U C;  4Z2M H;  4J8W A;  2NZD A;  5DNM A;  3MGR C;  4CSR B;  4Z5T B;  5JRG D;  4X23 B;  3AV1 C;  5B2I B;  1F1E A;  3KXB D;  3A1K A;  5G49 B;  3X1V A;  1P3I C;  2W8S A;  3A6N C;  4DRB A;  5B1L B;  3LZ0 C;  3WKJ C;  3REL A;  1P3P C;  1P3G C;  4J8U D;  4M6B A;  3NQJ B;  5B31 D;  3MGR D;  1P3M A;  3F6T A;  3AV1 D;  2RVQ C;  3B0B A;  1P3I D;  3LEL C;  3A6N D;  5JRG B;  2HUE C;  3LZ0 D;  1R4V A;  3UT9 A;  3WKJ D;  3KXB B;  1P3P D;  1P3G D;  1M1A A;  3AZF C;  3LJA B;  5B33 A;  4YM6 A;  3AZE A;  3AYW C;  5AV8 B;  4Z2M G;  3W99 C;  2ARO D;  4AWL B;  5BS7 A;  4H9N B;  2RVQ D;  4J8U B;  3REK A;  3NQU B;  1P3O A;  1JFI B;  4DQY B;  3AZJ C;  5B40 A;  3KUY A;  5B31 G;  3V9R B;  3LEL D;  3MGR B;  3X1U C;  3X1S B;  3TU4 A;  5AV6 B;  4NFT A;  5AV5 C;  1P3I B;  4DRA A;  1A7W A;  3AZF D;  3A6N B;  5CPI C;  3AYW D;  3WKJ B;  3W99 D;  5CP6 C;  3O62 D;  3B6F C;  1P3P B;  1P3G B;  3AZI C;  3AN2 C;  2JSS A;  3AZJ D;  1F66 A;  4NE5 A;  3UTA A;  5AVB A;  4JJN C;  2Y2I A;  1TZY B;  3LEL B;  2HUE B;  5CPI D;  1KX4 C;  3B6F D;  1P3A A;  1AOI A;  3AZI D;  3AN2 D;  3AZF B;  1TAF A;  3AYW B;  3W99 B;  3VH6 T;  4JJN D;  3AZJ B;  1BH9 B;  3X1U B;  2ZY2 A;  4H9N A;  1P3K A;  2Y2K A;  1KX4 D;  5AV5 B;  4J8W C;  4XUJ A;  2NZD C;  5DNM C;  5CPI B;  5DNN A;  4WU8 A;  5CP6 B;  3B6F B;  3AZM B;  3AL0 C;  3X1V C;  3AZI B;  3AN2 B;  1S32 A;  3REL C;  4ZUX A;  1N1J B;  3EPK A;  3EPL A;  4J8W D;  5DNM D;  5B32 A;  3AZK D;  3X1V D;  3W98 A;  3UT9 C;  1M1A C;  4H9P B;  3AZE C;  4YM6 C;  2BYK B;  5B33 C;  1BH8 B;  3W96 A;  3AZL B;  3MNN A;  3AZG A;  1P3O C;  3REK C;  3MGP D;  5B40 C;  4E45 A;  4J8W B;  3KUY C;  1BH9 A;  3LZ1 B;  5DNM B;  2NZD B;  5GSU A;  2XD1 A;  3UT9 D;  3TU4 C;  3MVD A;  5BNV A;  2F8N H;  4H9O B;  3C1B B;  3X1V B;  5GT0 A;  2DF4 C;  1M1A D;  5CPK B;  3AZE D;  5B33 D;  4YM6 D;  1KX5 A;  3REL B;  1P3O D;  3REK D;  1F66 C;  3KUY D;  1W2E A;  5BNX A;  1P3M B;  4NE6 A;  3UTA C;  4Z66 B;  3TU4 D;  5AVB C;  3KWQ A;  3WTP A;  4Z5T D;  3VH6 W;  5B2I D;  3UT9 B;  1P3A C;  1AOI C;  3AZE B;  5B33 B;  4YM6 B;  3REH A;  3MGS B;  4H9Q A;  1F66 D;  3B6G A;  2ZY5 A;  3UTA D;  5AVB D;  3REK B;  1P3O B;  5B40 B;  4WU9 A;  5BT1 C;  5AV8 C;  3KUY B;  2FJ7 A;  1P3K C;  1ZLA A;  1P3A D;  1AOI D;  2JCH A;  3C1C A;  3LZ1 A;  4XUJ C;  3X1S C;  5DNN C;  5AV6 C;  1EQZ A;  4H9O A;  3C1B A;  3AZH A;  4J8X A;  2UWX A;  5CPK A;  4WZS B;  1S32 C;  4R8P A;  3LJA D;  2BYM A;  1F66 B;  2Y2N A;  5AY8 A;  2Y2H A;  5BT1 D;  5AV8 D;  3UTA B;  4ZUX C;  1P3K D;  5AVB B;  2YFV A;  4XUJ D;  3UTB A;  3X1S D;  5B32 C;  5DNN D;  5AV6 D;  4Z66 A;  1P3A B;  1AOI B;  1TZY C;  1S32 D;  4UPK A;  1TAF B;  3W98 C;  2FFF B;  4CAY B;  4ZUX D;  2XD5 A;  1U35 A;  3MGS A;  3W96 C;  5B32 D;  1P3K B;  2VQR A;  3MNN C;  3AZG C;  1TZY D;  5CPJ A;  4XUJ B;  1PZR A;  5GSU C;  5DNN B;  4WU8 B;  1P34 A;  3W98 D;  3MVD C;  3X1T B;  4G91 C;  5GT0 C;  1S32 B;  5B0Z A;  2L5A A;  4H9R A;  3AFA A;  1KX5 C;  3AZM C;  3W96 D;  4ZUX B;  2HIO A;  5GXQ A;  3WAA A;  3MNN D;  3AZG D;  5C3I C;  4QLC A;  3H0M C;  3X1U D;  3VH5 T;  5B32 B;  4ZBJ B;  3MVD D;  3REJ A;  3KWQ C;  2Y2M A;  5AV5 D;  5GT0 D;  4WNN B;  3WTP C;  2Y2L A;  1KX5 D;  5CP6 D;  3W98 B;  3AZM D;  2F8N A;  2JE5 A;  3REH C;  3B6G C;  4WV4 B;  3WA9 A;  3W96 B;  4CAY A;  3MNN B;  1ULY A;  3AZG B;  3KWQ D;  5BO0 A;  4WU9 C;  1H3O A;  2LY8 A;  4HGA B;  5GSU B;  3WTP D;  3AZL C;  2FJ7 C;  2CV5 A;  1KX3 A;  3MVD B;  5BNV B;  4G91 B;  5GT0 B;  3C1C C;  3LZ1 C;  1P3L A;  3REH D;  1KX5 B;  3X1T A;  3KFU G;  1EQZ C;  3AZH C;  3C1B C;  1WWS A;  4J8X C;  2G5H C;  5CPK C;  5C3I B;  4R8P C;  3VH6 A;  4WU9 D;  2YFW A;  5AY8 C;  5BNX B;  2FJ7 D;  3KSY A;  5B0Y A;  3AZL D;  1P3F A;  3B0C W;  3KWQ B;  1B67 A;  3C1C D;  2NZD D;  3LZ1 D;  3WTP B;  1P3M C;  3UTB C;  2Y2P A;  4Z66 C;  1EQZ D;  3C1B D;  5CPK D;  3FDD A;  4WNN A;  5KDM A;  4R8P D;  3REH B;  3B6G B;  4H9Q B;  5AY8 D;  3REL D;  2NQB A;  5B31 A;  1U35 C;  1KU5 A;  3AV1 A;  4LD9 A;  4WU9 B;  3MGS C;  1P3M D;  3UTB D;  2FJ7 B;  5BS7 C;  4Z66 D;  2F2A C;  1ZLA B;  3C1C B;  4KGC A;  5CPJ C;  5AVC B;  1P34 C;  1EQZ B;  3AZH B;  4J8X B;  2ARO A;  5B24 B;  4R8P B;  4EO5 B;  2BYM B;  3VH5 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...