3REKD

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekD00
5CPIB 3O62B 1AOID 4KHAB 3W97C 5AV5A 5AY8B 1P3OA 1M19A 2NZDB 1BFMA 1M18A 4H9NB 4XUJA 4WU9A 5DNMD 5AV8D 3LELA 4AWLC 2CV5A 1N1JB 3MGPA 4YM6C 2IO5B 3X1TA 5B2IB 3W97D 3AV1A 5DNNA 3LZ1B 3AYWB 1HTAA 3REHC 5FUGB 5BNVB 4CAYA 3C1BB 1EQZB 1KX4A 4R8PC 3KUYB 4J8XA 2BYKB 5C3IC 5CP6B 5CPJC 1P3PC 4J8VA 4YM6D 1F66B 3RELC 5GXQC 2NQBB 3W98B 5BS7C 3AZMA 1BH8B 5JRGC 3MGPB 5B32G 3REHD 4XZQC 5B31G 4H9QB 5B0YC 4DRBA 4R8PD 1KX5B 5AVBC 3AV2C 1P34A 5E5AC 5CPJD 3KXBA 1P3PD 5B0ZB 5B32B 3RELD 3UTAC 5CPKA 3R45B 5GXQD 3AN2A 3W99B 3WAAB 5CHLB 3WTPA 4EO5B 5JRGD 1ZLAA 3NQJB 4CSRB 5AV5C 4XZQD 3MGSB 1P3OC 3LJAB 5B0YD 3REKA 1M19C 1M18C 4KGCA 3X1UA 5AV9B 5AVBD 4WZSB 3AZHB 3AV2D 4XUJC 5E5AD 4DRAA 4WU9C 1S32B 1P3LB 1KU5A 2HIOD 1P3IA 3UTAD 1P3BB 3AZNC 2CV5C 5B40B 3X1TC 3KWQA 3VH5T 3AV1C 5AV5D 5B2JA 4J8UA 3B6FB 1P3OD 5DNNC 3WA9A 1M19D 4WNNB 4J8WC 1ID3B 1M18D 3KSYA 4WU9D 4XUJD 5B1LA 3AZEA 1KX4C 1R4VA 3AZLA 4J8XC 3REKB 3LELD 5BNXB 1AOIB 2CV5D 1P3GB 4X23A 3X1TD 3AV1D 4H9OB 5DNND 4H9PA 3MNNA 4J8WD 5DNMB 3REJA 3UTAA 4QLCA 5AV8B 4ZUXA 4ZBJC 1KX4D 4J8XD 3AZGB 1P3FA 1P34C 3KXBC 3REHA 4J8VD 3W97B 5CPKC 5AVCC 5AV6B 4KUDA 4UUZA 3AN2C 3WTPC 3UTBA 1P3MB 1ZLAC 4G91C 3V9RA 3WKJC 3AZIA 3B0DC 4AWLB 4KGCC 5B24A 3X1UC 1P34D 3KXBD 4YM6B 2F8NA 4H9SA 3B0CW 5CPKD 5AVCD 1P3IC 4H9RA 1JFIA 3AN2D 3AV2A 3WTPD 3REHB 1ZLAD 3KWQC 4J8UC 4R8PB 5JA4B 4UUZB 5C3IB 5CPJB 4KGCD 3X1UD 1P3PB 3MGRA 1KX3A 5B1LC 3AZEC 3RELB 3AZLC 5GXQB 1P3ID 4JJNC 5GSUA 5JRGB 4XZQB 4X23C 3KWQD 2YFVB 5B0YB 5B2JD 4J8UD 1TZYA 4WU8C 3WA9D 1JFIB 3AZNA 3MNNC 5AVBB 3AV2B 3C1CA 5E5AB 3REJC 1BH9A 3UT9C 4QLCC 2HIOB 4NE5A 5B1LD 3REIC 4ZUXC 3AZED 1P3KA 3UTAB 3AZLD 1P3FC 4J8WA 3MGQA 4JJND 3WTPE 5AV5B 4X23D 1P3OB 4KUDC 4WU8D 1M19B 2PYOA 3LZ0A 5F99A 4LD9A 1M18B 3UTBC 3MNND 4WU9B 4XUJB 4Z5TA 3REJD 3UT9D 4QLCD 3REID 4ZUXD 3AZIC 3LELB 3AZKA 2CV5B 5B24C 3AFAA 1P3FD 3X1TB 5GT3A 4G92C 3AV1B 4H9SC 5DNNB 4KUDD 1ULYA 5GT0A 4J8WB 3UTBD 2FJ7A 4CAYB 5B31A 1KX4B 5AVCA 4WV4B 4J8XB 5CPIC 2CWEA 3AZID 5B24D 4J8VB 3MGRC 3X1VA 3NQUA 1WWIA 5AY8C 1M1AA 1KX3C 2F8ND 4E44A 3WKJA 3AZJA 2L5AA 5GSUC 3W96C 3AZMB 1P3AA 1HQ3A 4ZBJB 1TZYC 5CPID 4NFTA 1P34B 3C1CC 3KXBB 1KX3D 3MGRD 2YFWA 5AY8D 2BYMA 5CPKB 1P3KC 3AN2B 3X1SA 3WTPB 2AROA 5GSUD 3MGQC 3W96D 1EQZC 1ZLAB 2PYOC 1TZYD 3LZ0C 5F99C 3B0DB 4JJNA 4LD9C 4KGCB 3AZND 3X1UB 5BO0A 3C1CD 4Z5TC 4WU8A 5KDMA 1P3KD 1P3IB 3AZKC 3AZFA 3AFAC 3MGQD 1EQZD 3UT9A 3KWQB 3REIA 5B1MC 5GT3C 5B2JB 4J8UB 3WA9B 2PYOD 3LZ0D 5F99D 5GT0C 4LD9D 2FJ7C 5B32C 3B6GA 4Z5TD 5B1LB 3AZEB 5B31C 3AZLB 3VH6W 4JJNB 3AZKD 5B33A 3AFAD 3X1VC 3TU4A 1M1AC 4X23B 3A6NA 5B1MD 5GT3D 3AZJC 1B6WA 1H3OA 4H9PB 1P3AC 3MNNB 5GT0D 3MVDA 1P3LC 3REJB 2FJ7D 1HQ3C 5B32D 3UT9B 4QLCB 4ZUXB 5B31D 1U35A 4Z66C 1P3FB 3X1VD 1M1AD 4YS3A 2HUEC 4KUDB 5CPIA 3O62A 3WKJD 3AZJD 3X1SC 2AROC 3UTBB 1P3AD 5AY8A 1F1EA 1HQ3D 3V9RB 2NZDA 3AZIB 1AOIC 3W96A 4Z66D 5B24B 1P3GC 2F8NB 4G92B 4H9RB 3AZFC 3X1SD 2AROD 5B2IA 1WWSA 3AYWA 3AZGC 1Q9CA 5FUGA 1KX3B 5BNVA 4M6BA 3MGRB 3C1BA 1P3GD 1EQZA 3B6GC 3KUYA 5AV6C 2BYKA 5CP6A 5GSUB 3W96B 1P3MC 5B33C 3AZFD 3TU4C 1F66A 3B0CT 3A6NC 2NQBA 3W98A 1TZYB 1BH8A 3AZGD 3AZNB 3MVDC 3C1CB 4E45A 1BH9B 4Z2MH 3VH6A 3B6GD 4H9QA 5B1MA 5AV6D 1KX5A 1U35C 1P3KB 3MGQB 1P3MD 5B0ZA 5B33D 3TU4D 5B32A 4HGAC 4YS3C 3A6ND 3VH5W 3R45A 2PYOB 3W99A 3WAAA 3O62C 5F99B 3LZ0B 4LD9B 3NQJA 3MVDD 4CSRA 4Z5TB 3MGSA 3LJAA 2NZDC 1U35D 4Z2MG 3AZKB 5AV9A 1S32A 3AZHA 3AFAB 1P3LA 5B1MB 5GT3B 1A7WA 4YS3D 1P3BA 4Z66A 3O62D 5GT0B 5B40A 2IO5C 2FJ7B 5B2IC 2HIOC 3B6FA 5G49A 5B31B 3AYWC 3LZ1C 2JSSA 5AVCB 2NZDD 4NE6A 4WNNA 1ID3A 3X1VB 3C1BC 3NQUB 1M1AB 3KUYC 4G91B 3WKJB 5BNXA 3AZJB 1AOIA 5CP6C 1P3AB 1B67A 1P3GA 1F66C 1HQ3B 5B2ID 2NQBC 4H9OA 3LELC 3W98C 3AYWD 3LZ1D 4Z66B 3MGPC 5DNMA 2YFWB 5AV8A 2BYMB 3C1BD 5G49B 3KUYD 2HUEB 1KX5C 3AZGA 5BT1C 5CP6D 3X1SB 2AROB 5B0ZC 3W97A 1F66D 5AV6A 2NQBD 3W98D 3WAAC 3W99C 4J8VC 4EO5C 1P3MA 3MGPD 5BO0B 3MGSC 3REKD 3LJAC 2F8NH 4WU8B 5KDMB 3AZMC 1KX5D 4NE3A 5AV9C 1S32C 5BT1D 3AZHC 3AZFB 2LY8A 3VH5A 4YM6A 5B0ZD 2F8NK 3REIB 1P3BC 3W99D 3WAAD 5B40C 3B6GB 3MGSD 4R8PA 3B6FC 1TAFA 5JA4A 3LJAD 1ID3C 3AZMD 5CPJA 4KHAA 2RVQC 5AV9D 5B33B 3AZHD 1S32D 3TU4B 1P3PA 2F8NG 1P3LD 3A6NB 3RELA 3REKC 5GXQA 5BS7A 1P3BD 1H3OB 5JRGA 4H9NA 3MVDB 5B40D 4XZQA 2YFVA 5B0YA 3B6FD 1U35B 5AVBA 1N1JA 1ID3D 5E5AA 5DNMC 2RVQD 2HIOA 5AV8C 5B2JC 1TAFB 4HGAB 4YS3B 3VH6T 3WA9C 3LZ1A 3B0BA
chains in the Genus database with same CATH superfamily
5CPIB 3O62B 2FFFB 1AOID 4KHAB 3W97C 5AV5A 5AY8B 1P3OA 1M19A 2NZDB 1BFMA 1M18A 4H9NB 4XUJA 4WU9A 5DNMD 5AV8D 3LELA 2Y2OA 4AWLC 2CV5A 1N1JB 3MGPA 3KFUG 4YM6C 2IO5B 3X1TA 5B2IB 3W97D 3AV1A 2W8SA 5DNNA 3LZ1B 3AYWB 1HTAA 3REHC 5FUGB 5BNVB 4CAYA 3C1BB 1EQZB 1KX4A 4R8PC 3KUYB 4J8XA 2BYKB 2Y2HA 5C3IC 5CP6B 5CPJC 1P3PC 4J8VA 4YM6D 1F66B 2BG1A 3RELC 2JCHA 5GXQC 3W98B 2NQBB 5BS7C 3AZMA 1BH8B 5JRGC 3MGPB 5B32G 2Y2GA 4XZQC 3REHD 5B31G 4H9QB 5B0YC 4DRBA 4R8PD 1KX5B 2J8PA 5AVBC 3AV2C 1P34A 5E5AC 5CPJD 3KXBA 1P3PD 5B0ZB 5B32B 3RELD 3UTAC 5CPKA 3R45B 5GXQD 3AN2A 3W99B 3WAAB 5CHLB 3WTPA 3A1IA 4EO5B 5JRGD 1ZLAA 3NQJB 4CSRB 5AV5C 4XZQD 3MGSB 2JE5A 1P3OC 3LJAB 5B0YD 3REKA 1M19C 1M18C 4KGCA 3X1UA 5AV9B 5AVBD 4WZSB 3AZHB 3AV2D 4XUJC 5E5AD 4DRAA 4WU9C 1S32B 2DF4C 1P3LB 4UPKA 1KU5A 2HIOD 1P3IA 3UTAD 1P3BB 3AZNC 2CV5C 5B40B 3X1TC 3KWQA 3VH5T 3AV1C 5AV5D 5B2JA 4J8UA 3B6FB 1P3OD 5DNNC 3WA9A 1M19D 4WNNB 4J8WC 1ID3B 1M18D 3KSYA 4WU9D 4XUJD 5B1LA 3AZEA 1KX4C 1R4VA 3AZLA 4J8XC 3REKB 3LELD 5BNXB 1AOIB 2CV5D 1P3GB 4X23A 3X1TD 3AV1D 4H9OB 5DNND 4H9PA 3MNNA 4J8WD 5DNMB 3REJA 3UTAA 4QLCA 5AV8B 4ZUXA 4ZBJC 1KX4D 4J8XD 3AZGB 1P3FA 1P34C 3KXBC 3REHA 4J8VD 2ZY2A 1W2EA 3W97B 3EG5B 5CPKC 5AVCC 5AV6B 4KUDA 4UUZA 3AN2C 3WTPC 3UTBA 1P3MB 1ZLAC 4G91C 3V9RA 3WKJC 3AZIA 3B0DC 4AWLB 4KGCC 5B24A 3X1UC 1P34D 3KXBD 4YM6B 2F8NA 4H9SA 3B0CW 5CPKD 5AVCD 1P3IC 4H9RA 1JFIA 3AN2D 3AV2A 3WTPD 3REHB 1ZLAD 3KWQC 3EPKA 4J8UC 4R8PB 5JA4B 4UUZB 5C3IB 5CPJB 4KGCD 3X1UD 1P3PB 2UWXA 3MGRA 1KX3A 5B1LC 3AZEC 2Y2MA 3RELB 2VQRA 3EPHA 3AZLC 5GXQB 1P3ID 4JJNC 5GSUA 5JRGB 4XZQB 4X23C 3KWQD 2YFVB 5B0YB 5B2JD 4J8UD 1TZYA 4WU8C 3WA9D 1JFIB 3AZNA 3MNNC 5AVBB 3AV2B 3C1CA 5E5AB 3REJC 1BH9A 3UT9C 4QLCC 2HIOB 4NE5A 5B1LD 3REIC 4ZUXC 3AZED 1P3KA 3UTAB 3AZLD 1P3FC 4J8WA 3MGQA 4JJND 3WTPE 5AV5B 4X23D 3F6TA 1P3OB 4KUDC 4WU8D 1M19B 2PYOA 3LZ0A 5F99A 4LD9A 1M18B 3UTBC 3MNND 4WU9B 2G5HC 4XUJB 4Z5TA 3REJD 1PZRA 3UT9D 4QLCD 3REID 4ZUXD 1Z2CB 3AZIC 3LELB 3AZKA 2CV5B 5B24C 3AFAA 1P3FD 3X1TB 5GT3A 4G92C 3AV1B 4H9SC 5DNNB 4KUDD 1ULYA 5GT0A 4J8WB 3UTBD 2FJ7A 2Y2QA 4CAYB 3H0RC 5B31A 1KX4B 4WJ3C 5AVCA 4WV4B 4J8XB 5CPIC 2CWEA 3AZID 2XD1A 5B24D 4J8VB 3MGRC 3X1VA 3NQUA 1WWIA 5AY8C 1M1AA 1KX3C 2F8ND 4E44A 3WKJA 3AZJA 2L5AA 2Y2LA 5GSUC 3W96C 3AZMB 1P3AA 2ZY4A 1HQ3A 4ZBJB 1TZYC 5CPID 4NFTA 1P34B 3C1CC 3KXBB 1KX3D 3MGRD 2YFWA 5AY8D 2BYMA 2Y2JA 5CPKB 1P3KC 3AN2B 3X1SA 3WTPB 2AROA 5GSUD 3MGQC 3W96D 1EQZC 1ZLAB 2RIQA 2PYOC 1TZYD 3LZ0C 5F99C 3B0DB 4JJNA 4LD9C 4KGCB 3AZND 3X1UB 5BO0A 3C1CD 4Z5TC 4WU8A 5KDMA 1P3KD 1P3IB 3AZKC 3AZFA 3AFAC 3MGQD 1EQZD 3UT9A 3KWQB 3REIA 5B1MC 5GT3C 5B2JB 4J8UB 3WA9B 2PYOD 3LZ0D 5F99D 5GT0C 4LD9D 2FJ7C 5B32C 3B6GA 4Z5TD 5B1LB 3AZEB 5B31C 3AZLB 3VH6W 4JJNB 1T3UA 3AZKD 5B33A 3AFAD 3X1VC 3TU4A 1M1AC 4X23B 3A6NA 5B1MD 5GT3D 3AZJC 1B6WA 1H3OA 4H9PB 1P3AC 3MNNB 5GT0D 3MVDA 1P3LC 3REJB 2FJ7D 1HQ3C 3H0LC 5B32D 3UT9B 4QLCB 4ZUXB 5B31D 1U35A 4Z66C 1P3FB 3X1VD 2ZY3A 1M1AD 4YS3A 2HUEC 3H0MC 4KUDB 5CPIA 3O62A 3WKJD 3AZJD 2DQNC 3X1SC 2AROC 3UTBB 1P3AD 5AY8A 1F1EA 1HQ3D 3V9RB 2NZDA 3AZIB 1AOIC 3W96A 4Z66D 5B24B 1P3GC 2F8NB 4G92B 4H9RB 3AZFC 3X1SD 2AROD 5B2IA 1WWSA 3AYWA 3AZGC 1Q9CA 5FUGA 1KX3B 5BNVA 4M6BA 3MGRB 3C1BA 1P3GD 1EQZA 3B6GC 3KUYA 5AV6C 2BYKA 2Y2PA 2ZM5A 5CP6A 5GSUB 3W96B 1P3MC 5B33C 3AZFD 3TU4C 1F66A 3P5JB 3B0CT 3A6NC 3AL0C 2NQBA 3W98A 1TZYB 1BH8A 3AZGD 3AZNB 3MVDC 3C1CB 4E45A 1BH9B 4Z2MH 3VH6A 3B6GD 4H9QA 5B1MA 5AV6D 1KX5A 1U35C 1P3KB 3MGQB 1P3MD 5B0ZA 5B33D 3TU4D 5B32A 4HGAC 4YS3C 3A6ND 3VH5W 3R45A 2PYOB 3W99A 3WAAA 3O62C 5F99B 3LZ0B 4LD9B 3NQJA 3MVDD 4CSRA 4Z5TB 3MGSA 3LJAA 2NZDC 1U35D 4Z2MG 3AZKB 5AV9A 1S32A 3AZHA 3AFAB 1P3LA 4DQYB 5B1MB 5GT3B 1A7WA 4YS3D 1P3BA 4Z66A 3O62D 5GT0B 5B40A 2IO5C 2FJ7B 5B2IC 2HIOC 3B6FA 5G49A 5B31B 3AYWC 3LZ1C 2JSSA 5AVCB 2NZDD 2ZY5A 4NE6A 4WNNA 1ID3A 3X1VB 3C1BC 3NQUB 1M1AB 2Y2KA 3KUYC 4G91B 3WKJB 5BNXA 3AZJB 1AOIA 5CP6C 1P3AB 1B67A 1P3GA 1F66C 1HQ3B 5B2ID 2NQBC 4H9OA 3LELC 3W98C 3AYWD 2Y2IA 3LZ1D 4Z66B 3MGPC 3A1KA 5DNMA 2YFWB 3IP4C 2BYMB 5AV8A 3C1BD 5G49B 3KUYD 2HUEB 2Y2NA 1KX5C 3AZGA 5BT1C 5CP6D 3X1SB 2AROB 5B0ZC 3W97A 2F2AC 1F66D 5AV6A 2NQBD 3W98D 3WAAC 3W99C 3EPLA 4J8VC 4EO5C 1P3MA 3MGPD 5BO0B 3MGSC 3REKD 3LJAC 2F8NH 4WU8B 5KDMB 3AZMC 1KX5D 4NE3A 5AV9C 1S32C 5BT1D 3AZHC 3AZFB 2LY8A 3VH5A 4YM6A 5B0ZD 2F8NK 3REIB 1P3BC 3W99D 3WAAD 2XD5A 5B40C 3B6GB 3MGSD 4R8PA 3B6FC 1TAFA 5JA4A 3LJAD 1ID3C 3AZMD 5CPJA 4KHAA 2RVQC 5AV9D 5B33B 3AZHD 1S32D 3TU4B 1P3PA 2F8NG 1P3LD 3EPJA 3A6NB 3RELA 3REKC 5GXQA 5BS7A 1P3BD 1H3OB 3FDDA 5JRGA 4H9NA 3MVDB 5B40D 2G5IC 4XZQA 2YFVA 5B0YA 3B6FD 1U35B 5AVBA 1N1JA 1ID3D 5E5AA 5DNMC 2RVQD 2HIOA 5AV8C 5B2JC 1TAFB 4HGAB 4YS3B 3VH6T 3WA9C 3LZ1A 3B0BA
chains in the Genus database with same CATH topology
5CPIB 3O62B 2FFFB 1AOID 4KHAB 3W97C 5AV5A 5AY8B 1P3OA 1M19A 2NZDB 1BFMA 1M18A 4H9NB 4XUJA 4WU9A 5DNMD 5AV8D 3LELA 2Y2OA 4AWLC 2CV5A 1N1JB 3MGPA 3KFUG 4YM6C 2IO5B 3X1TA 5B2IB 3W97D 3AV1A 2W8SA 5DNNA 3LZ1B 3AYWB 1HTAA 3REHC 5FUGB 5BNVB 4CAYA 3C1BB 1EQZB 1KX4A 4R8PC 3KUYB 4J8XA 2BYKB 2Y2HA 5C3IC 5CP6B 5CPJC 1P3PC 4J8VA 4YM6D 1F66B 2BG1A 3RELC 2JCHA 5GXQC 3W98B 2NQBB 5BS7C 3AZMA 1BH8B 5JRGC 3MGPB 5B32G 2Y2GA 4XZQC 3REHD 5B31G 4H9QB 5B0YC 4DRBA 4R8PD 1KX5B 2J8PA 5AVBC 3AV2C 1P34A 5E5AC 5CPJD 3KXBA 1P3PD 5B0ZB 5B32B 3RELD 3UTAC 5CPKA 3R45B 5GXQD 3AN2A 3W99B 3WAAB 5CHLB 3WTPA 3A1IA 4EO5B 5JRGD 1ZLAA 3NQJB 4CSRB 5AV5C 4XZQD 3MGSB 2JE5A 1P3OC 3LJAB 5B0YD 3REKA 1M19C 1M18C 4KGCA 3X1UA 5AV9B 5AVBD 4WZSB 3AZHB 3AV2D 4XUJC 5E5AD 4DRAA 4WU9C 1S32B 2DF4C 1P3LB 4UPKA 1KU5A 2HIOD 1P3IA 3UTAD 1P3BB 3AZNC 2CV5C 5B40B 3X1TC 3KWQA 3VH5T 3AV1C 5AV5D 5B2JA 4J8UA 3B6FB 1P3OD 5DNNC 3WA9A 1M19D 4WNNB 4J8WC 1ID3B 1M18D 3KSYA 4WU9D 4XUJD 5B1LA 3AZEA 1KX4C 1R4VA 3AZLA 4J8XC 3REKB 3LELD 5BNXB 1AOIB 2CV5D 1P3GB 4X23A 3X1TD 3AV1D 4H9OB 5DNND 4H9PA 3MNNA 4J8WD 5DNMB 3REJA 3UTAA 4QLCA 5AV8B 4ZUXA 4ZBJC 1KX4D 4J8XD 3AZGB 1P3FA 1P34C 3KXBC 3REHA 4J8VD 2ZY2A 1W2EA 3W97B 3EG5B 5CPKC 5AVCC 5AV6B 4KUDA 4UUZA 3AN2C 3WTPC 3UTBA 1P3MB 1ZLAC 4G91C 3V9RA 3WKJC 3AZIA 3B0DC 4AWLB 4KGCC 5B24A 3X1UC 1P34D 3KXBD 4YM6B 2F8NA 4H9SA 3B0CW 5CPKD 5AVCD 1P3IC 4H9RA 1JFIA 3AN2D 3AV2A 3WTPD 3REHB 1ZLAD 3KWQC 3EPKA 4J8UC 4R8PB 5JA4B 4UUZB 5C3IB 5CPJB 4KGCD 3X1UD 1P3PB 2UWXA 3MGRA 1KX3A 5B1LC 3AZEC 2Y2MA 3RELB 2VQRA 3EPHA 3AZLC 5GXQB 1P3ID 4JJNC 5GSUA 5JRGB 4XZQB 4X23C 3KWQD 2YFVB 5B0YB 5B2JD 4J8UD 1TZYA 4WU8C 3WA9D 1JFIB 3AZNA 3MNNC 5AVBB 3AV2B 3C1CA 5E5AB 3REJC 1BH9A 3UT9C 4QLCC 2HIOB 4NE5A 5B1LD 3REIC 4ZUXC 3AZED 1P3KA 3UTAB 3AZLD 1P3FC 4J8WA 3MGQA 4JJND 3WTPE 5AV5B 4X23D 3F6TA 1P3OB 4KUDC 4WU8D 1M19B 2PYOA 3LZ0A 5F99A 4LD9A 1M18B 3UTBC 3MNND 4WU9B 2G5HC 4XUJB 4Z5TA 3REJD 1PZRA 3UT9D 4QLCD 3REID 4ZUXD 1Z2CB 3AZIC 3LELB 3AZKA 2CV5B 5B24C 3AFAA 1P3FD 3X1TB 5GT3A 4G92C 3AV1B 4H9SC 5DNNB 4KUDD 1ULYA 5GT0A 4J8WB 3UTBD 2FJ7A 2Y2QA 4CAYB 3H0RC 5B31A 1KX4B 4WJ3C 5AVCA 4WV4B 4J8XB 5CPIC 2CWEA 3AZID 2XD1A 5B24D 4J8VB 3MGRC 3X1VA 3NQUA 1WWIA 5AY8C 1M1AA 1KX3C 2F8ND 4E44A 3WKJA 3AZJA 2L5AA 2Y2LA 5GSUC 3W96C 3AZMB 1P3AA 2ZY4A 1HQ3A 4ZBJB 1TZYC 5CPID 4NFTA 1P34B 3C1CC 3KXBB 1KX3D 3MGRD 2YFWA 5AY8D 2BYMA 2Y2JA 5CPKB 1P3KC 3AN2B 3X1SA 3WTPB 2AROA 5GSUD 3MGQC 3W96D 1EQZC 1ZLAB 2RIQA 2PYOC 1TZYD 3LZ0C 5F99C 3B0DB 4JJNA 4LD9C 4KGCB 3AZND 3X1UB 5BO0A 3C1CD 4Z5TC 4WU8A 5KDMA 1P3KD 1P3IB 3AZKC 3AZFA 3AFAC 3MGQD 1EQZD 3UT9A 3KWQB 3REIA 5B1MC 5GT3C 5B2JB 4J8UB 3WA9B 2PYOD 3LZ0D 5F99D 5GT0C 4LD9D 2FJ7C 5B32C 3B6GA 4Z5TD 5B1LB 3AZEB 5B31C 3AZLB 3VH6W 4JJNB 1T3UA 3AZKD 5B33A 3AFAD 3X1VC 3TU4A 1M1AC 4X23B 3A6NA 5B1MD 5GT3D 3AZJC 1B6WA 1H3OA 4H9PB 1P3AC 3MNNB 5GT0D 3MVDA 1P3LC 3REJB 2FJ7D 1HQ3C 3H0LC 5B32D 3UT9B 4QLCB 4ZUXB 5B31D 1U35A 4Z66C 1P3FB 3X1VD 2ZY3A 1M1AD 4YS3A 2HUEC 3H0MC 4KUDB 5CPIA 3O62A 3WKJD 3AZJD 2DQNC 3X1SC 2AROC 3UTBB 1P3AD 5AY8A 1F1EA 1HQ3D 3V9RB 2NZDA 3AZIB 1AOIC 3W96A 4Z66D 5B24B 1P3GC 2F8NB 4G92B 4H9RB 3AZFC 3X1SD 2AROD 5B2IA 1WWSA 3AYWA 3AZGC 1Q9CA 5FUGA 1KX3B 5BNVA 4M6BA 3MGRB 3C1BA 1P3GD 1EQZA 3B6GC 3KUYA 5AV6C 2BYKA 2Y2PA 2ZM5A 5CP6A 5GSUB 3W96B 1P3MC 5B33C 3AZFD 3TU4C 1F66A 3P5JB 3B0CT 3A6NC 3AL0C 2NQBA 3W98A 1TZYB 1BH8A 3AZGD 3AZNB 3MVDC 3C1CB 4E45A 1BH9B 4Z2MH 3VH6A 3B6GD 4H9QA 5B1MA 5AV6D 1KX5A 1U35C 1P3KB 3MGQB 1P3MD 5B0ZA 5B33D 3TU4D 5B32A 4HGAC 4YS3C 3A6ND 3VH5W 3R45A 2PYOB 3W99A 3WAAA 3O62C 5F99B 3LZ0B 4LD9B 3NQJA 3MVDD 4CSRA 4Z5TB 3MGSA 3LJAA 2NZDC 1U35D 4Z2MG 3AZKB 5AV9A 1S32A 3AZHA 3AFAB 1P3LA 4DQYB 5B1MB 5GT3B 1A7WA 4YS3D 1P3BA 4Z66A 3O62D 5GT0B 5B40A 2IO5C 2FJ7B 5B2IC 2HIOC 3B6FA 5G49A 5B31B 3AYWC 3LZ1C 2JSSA 5AVCB 2NZDD 2ZY5A 4NE6A 4WNNA 1ID3A 3X1VB 3C1BC 3NQUB 1M1AB 2Y2KA 3KUYC 4G91B 3WKJB 5BNXA 3AZJB 1AOIA 5CP6C 1P3AB 1B67A 1P3GA 1F66C 1HQ3B 5B2ID 2NQBC 4H9OA 3LELC 3W98C 3AYWD 2Y2IA 3LZ1D 4Z66B 3MGPC 3A1KA 5DNMA 2YFWB 3IP4C 2BYMB 5AV8A 3C1BD 5G49B 3KUYD 2HUEB 2Y2NA 1KX5C 3AZGA 5BT1C 5CP6D 3X1SB 2AROB 5B0ZC 3W97A 2F2AC 1F66D 5AV6A 2NQBD 3W98D 3WAAC 3W99C 3EPLA 4J8VC 4EO5C 1P3MA 3MGPD 5BO0B 3MGSC 3REKD 3LJAC 2F8NH 4WU8B 5KDMB 3AZMC 1KX5D 4NE3A 5AV9C 1S32C 5BT1D 3AZHC 3AZFB 2LY8A 3VH5A 4YM6A 5B0ZD 2F8NK 3REIB 1P3BC 3W99D 3WAAD 2XD5A 5B40C 3B6GB 3MGSD 4R8PA 3B6FC 1TAFA 5JA4A 3LJAD 1ID3C 3AZMD 5CPJA 4KHAA 2RVQC 5AV9D 5B33B 3AZHD 1S32D 3TU4B 1P3PA 2F8NG 1P3LD 3EPJA 3A6NB 3RELA 3REKC 5GXQA 5BS7A 1P3BD 1H3OB 3FDDA 5JRGA 4H9NA 3MVDB 5B40D 2G5IC 4XZQA 2YFVA 5B0YA 3B6FD 1U35B 5AVBA 1N1JA 1ID3D 5E5AA 5DNMC 2RVQD 2HIOA 5AV8C 5B2JC 1TAFB 4HGAB 4YS3B 3VH6T 3WA9C 3LZ1A 3B0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI B;  3O62 B;  1AOI D;  4KHA B;  3W97 C;  5AV5 A;  5AY8 B;  1P3O A;  1M19 A;  2NZD B;  1BFM A;  1M18 A;  4H9N B;  4XUJ A;  4WU9 A;  5DNM D;  5AV8 D;  3LEL A;  4AWL C;  2CV5 A;  1N1J B;  3MGP A;  4YM6 C;  2IO5 B;  3X1T A;  5B2I B;  3W97 D;  3AV1 A;  5DNN A;  3LZ1 B;  3AYW B;  1HTA A;  3REH C;  5FUG B;  5BNV B;  4CAY A;  3C1B B;  1EQZ B;  1KX4 A;  4R8P C;  3KUY B;  4J8X A;  2BYK B;  5C3I C;  5CP6 B;  5CPJ C;  1P3P C;  4J8V A;  4YM6 D;  1F66 B;  3REL C;  5GXQ C;  2NQB B;  3W98 B;  5BS7 C;  3AZM A;  1BH8 B;  5JRG C;  3MGP B;  5B32 G;  3REH D;  4XZQ C;  5B31 G;  4H9Q B;  5B0Y C;  4DRB A;  4R8P D;  1KX5 B;  5AVB C;  3AV2 C;  1P34 A;  5E5A C;  5CPJ D;  3KXB A;  1P3P D;  5B0Z B;  5B32 B;  3REL D;  3UTA C;  5CPK A;  3R45 B;  5GXQ D;  3AN2 A;  3W99 B;  3WAA B;  5CHL B;  3WTP A;  4EO5 B;  5JRG D;  1ZLA A;  3NQJ B;  4CSR B;  5AV5 C;  4XZQ D;  3MGS B;  1P3O C;  3LJA B;  5B0Y D;  3REK A;  1M19 C;  1M18 C;  4KGC A;  3X1U A;  5AV9 B;  5AVB D;  4WZS B;  3AZH B;  3AV2 D;  4XUJ C;  5E5A D;  4DRA A;  4WU9 C;  1S32 B;  1P3L B;  1KU5 A;  2HIO D;  1P3I A;  3UTA D;  1P3B B;  3AZN C;  2CV5 C;  5B40 B;  3X1T C;  3KWQ A;  3VH5 T;  3AV1 C;  5AV5 D;  5B2J A;  4J8U A;  3B6F B;  1P3O D;  5DNN C;  3WA9 A;  1M19 D;  4WNN B;  4J8W C;  1ID3 B;  1M18 D;  3KSY A;  4WU9 D;  4XUJ D;  5B1L A;  3AZE A;  1KX4 C;  1R4V A;  3AZL A;  4J8X C;  3REK B;  3LEL D;  5BNX B;  1AOI B;  2CV5 D;  1P3G B;  4X23 A;  3X1T D;  3AV1 D;  4H9O B;  5DNN D;  4H9P A;  3MNN A;  4J8W D;  5DNM B;  3REJ A;  3UTA A;  4QLC A;  5AV8 B;  4ZUX A;  4ZBJ C;  1KX4 D;  4J8X D;  3AZG B;  1P3F A;  1P34 C;  3KXB C;  3REH A;  4J8V D;  3W97 B;  5CPK C;  5AVC C;  5AV6 B;  4KUD A;  4UUZ A;  3AN2 C;  3WTP C;  3UTB A;  1P3M B;  1ZLA C;  4G91 C;  3V9R A;  3WKJ C;  3AZI A;  3B0D C;  4AWL B;  4KGC C;  5B24 A;  3X1U C;  1P34 D;  3KXB D;  4YM6 B;  2F8N A;  4H9S A;  3B0C W;  5CPK D;  5AVC D;  1P3I C;  4H9R A;  1JFI A;  3AN2 D;  3AV2 A;  3WTP D;  3REH B;  1ZLA D;  3KWQ C;  4J8U C;  4R8P B;  5JA4 B;  4UUZ B;  5C3I B;  5CPJ B;  4KGC D;  3X1U D;  1P3P B;  3MGR A;  1KX3 A;  5B1L C;  3AZE C;  3REL B;  3AZL C;  5GXQ B;  1P3I D;  4JJN C;  5GSU A;  5JRG B;  4XZQ B;  4X23 C;  3KWQ D;  2YFV B;  5B0Y B;  5B2J D;  4J8U D;  1TZY A;  4WU8 C;  3WA9 D;  1JFI B;  3AZN A;  3MNN C;  5AVB B;  3AV2 B;  3C1C A;  5E5A B;  3REJ C;  1BH9 A;  3UT9 C;  4QLC C;  2HIO B;  4NE5 A;  5B1L D;  3REI C;  4ZUX C;  3AZE D;  1P3K A;  3UTA B;  3AZL D;  1P3F C;  4J8W A;  3MGQ A;  4JJN D;  3WTP E;  5AV5 B;  4X23 D;  1P3O B;  4KUD C;  4WU8 D;  1M19 B;  2PYO A;  3LZ0 A;  5F99 A;  4LD9 A;  1M18 B;  3UTB C;  3MNN D;  4WU9 B;  4XUJ B;  4Z5T A;  3REJ D;  3UT9 D;  4QLC D;  3REI D;  4ZUX D;  3AZI C;  3LEL B;  3AZK A;  2CV5 B;  5B24 C;  3AFA A;  1P3F D;  3X1T B;  5GT3 A;  4G92 C;  3AV1 B;  4H9S C;  5DNN B;  4KUD D;  1ULY A;  5GT0 A;  4J8W B;  3UTB D;  2FJ7 A;  4CAY B;  5B31 A;  1KX4 B;  5AVC A;  4WV4 B;  4J8X B;  5CPI C;  2CWE A;  3AZI D;  5B24 D;  4J8V B;  3MGR C;  3X1V A;  3NQU A;  1WWI A;  5AY8 C;  1M1A A;  1KX3 C;  2F8N D;  4E44 A;  3WKJ A;  3AZJ A;  2L5A A;  5GSU C;  3W96 C;  3AZM B;  1P3A A;  1HQ3 A;  4ZBJ B;  1TZY C;  5CPI D;  4NFT A;  1P34 B;  3C1C C;  3KXB B;  1KX3 D;  3MGR D;  2YFW A;  5AY8 D;  2BYM A;  5CPK B;  1P3K C;  3AN2 B;  3X1S A;  3WTP B;  2ARO A;  5GSU D;  3MGQ C;  3W96 D;  1EQZ C;  1ZLA B;  2PYO C;  1TZY D;  3LZ0 C;  5F99 C;  3B0D B;  4JJN A;  4LD9 C;  4KGC B;  3AZN D;  3X1U B;  5BO0 A;  3C1C D;  4Z5T C;  4WU8 A;  5KDM A;  1P3K D;  1P3I B;  3AZK C;  3AZF A;  3AFA C;  3MGQ D;  1EQZ D;  3UT9 A;  3KWQ B;  3REI A;  5B1M C;  5GT3 C;  5B2J B;  4J8U B;  3WA9 B;  2PYO D;  3LZ0 D;  5F99 D;  5GT0 C;  4LD9 D;  2FJ7 C;  5B32 C;  3B6G A;  4Z5T D;  5B1L B;  3AZE B;  5B31 C;  3AZL B;  3VH6 W;  4JJN B;  3AZK D;  5B33 A;  3AFA D;  3X1V C;  3TU4 A;  1M1A C;  4X23 B;  3A6N A;  5B1M D;  5GT3 D;  3AZJ C;  1B6W A;  1H3O A;  4H9P B;  1P3A C;  3MNN B;  5GT0 D;  3MVD A;  1P3L C;  3REJ B;  2FJ7 D;  1HQ3 C;  5B32 D;  3UT9 B;  4QLC B;  4ZUX B;  5B31 D;  1U35 A;  4Z66 C;  1P3F B;  3X1V D;  1M1A D;  4YS3 A;  2HUE C;  4KUD B;  5CPI A;  3O62 A;  3WKJ D;  3AZJ D;  3X1S C;  2ARO C;  3UTB B;  1P3A D;  5AY8 A;  1F1E A;  1HQ3 D;  3V9R B;  2NZD A;  3AZI B;  1AOI C;  3W96 A;  4Z66 D;  5B24 B;  1P3G C;  2F8N B;  4G92 B;  4H9R B;  3AZF C;  3X1S D;  2ARO D;  5B2I A;  1WWS A;  3AYW A;  3AZG C;  1Q9C A;  5FUG A;  1KX3 B;  5BNV A;  4M6B A;  3MGR B;  3C1B A;  1P3G D;  1EQZ A;  3B6G C;  3KUY A;  5AV6 C;  2BYK A;  5CP6 A;  5GSU B;  3W96 B;  1P3M C;  5B33 C;  3AZF D;  3TU4 C;  1F66 A;  3B0C T;  3A6N C;  2NQB A;  3W98 A;  1TZY B;  1BH8 A;  3AZG D;  3AZN B;  3MVD C;  3C1C B;  4E45 A;  1BH9 B;  4Z2M H;  3VH6 A;  3B6G D;  4H9Q A;  5B1M A;  5AV6 D;  1KX5 A;  1U35 C;  1P3K B;  3MGQ B;  1P3M D;  5B0Z A;  5B33 D;  3TU4 D;  5B32 A;  4HGA C;  4YS3 C;  3A6N D;  3VH5 W;  3R45 A;  2PYO B;  3W99 A;  3WAA A;  3O62 C;  5F99 B;  3LZ0 B;  4LD9 B;  3NQJ A;  3MVD D;  4CSR A;  4Z5T B;  3MGS A;  3LJA A;  2NZD C;  1U35 D;  4Z2M G;  3AZK B;  5AV9 A;  1S32 A;  3AZH A;  3AFA B;  1P3L A;  5B1M B;  5GT3 B;  1A7W A;  4YS3 D;  1P3B A;  4Z66 A;  3O62 D;  5GT0 B;  5B40 A;  2IO5 C;  2FJ7 B;  5B2I C;  2HIO C;  3B6F A;  5G49 A;  5B31 B;  3AYW C;  3LZ1 C;  2JSS A;  5AVC B;  2NZD D;  4NE6 A;  4WNN A;  1ID3 A;  3X1V B;  3C1B C;  3NQU B;  1M1A B;  3KUY C;  4G91 B;  3WKJ B;  5BNX A;  3AZJ B;  1AOI A;  5CP6 C;  1P3A B;  1B67 A;  1P3G A;  1F66 C;  1HQ3 B;  5B2I D;  2NQB C;  4H9O A;  3LEL C;  3W98 C;  3AYW D;  3LZ1 D;  4Z66 B;  3MGP C;  5DNM A;  2YFW B;  5AV8 A;  2BYM B;  3C1B D;  5G49 B;  3KUY D;  2HUE B;  1KX5 C;  3AZG A;  5BT1 C;  5CP6 D;  3X1S B;  2ARO B;  5B0Z C;  3W97 A;  1F66 D;  5AV6 A;  2NQB D;  3W98 D;  3WAA C;  3W99 C;  4J8V C;  4EO5 C;  1P3M A;  3MGP D;  5BO0 B;  3MGS C;  3REK D;  3LJA C;  2F8N H;  4WU8 B;  5KDM B;  3AZM C;  1KX5 D;  4NE3 A;  5AV9 C;  1S32 C;  5BT1 D;  3AZH C;  3AZF B;  2LY8 A;  3VH5 A;  4YM6 A;  5B0Z D;  2F8N K;  3REI B;  1P3B C;  3W99 D;  3WAA D;  5B40 C;  3B6G B;  3MGS D;  4R8P A;  3B6F C;  1TAF A;  5JA4 A;  3LJA D;  1ID3 C;  3AZM D;  5CPJ A;  4KHA A;  2RVQ C;  5AV9 D;  5B33 B;  3AZH D;  1S32 D;  3TU4 B;  1P3P A;  2F8N G;  1P3L D;  3A6N B;  3REL A;  3REK C;  5GXQ A;  5BS7 A;  1P3B D;  1H3O B;  5JRG A;  4H9N A;  3MVD B;  5B40 D;  4XZQ A;  2YFV A;  5B0Y A;  3B6F D;  1U35 B;  5AVB A;  1N1J A;  1ID3 D;  5E5A A;  5DNM C;  2RVQ D;  2HIO A;  5AV8 C;  5B2J C;  1TAF B;  4HGA B;  4YS3 B;  3VH6 T;  3WA9 C;  3LZ1 A;  3B0B A; 
#chains in the Genus database with same CATH topology
 5CPI B;  3O62 B;  2FFF B;  1AOI D;  4KHA B;  3W97 C;  5AV5 A;  5AY8 B;  1P3O A;  1M19 A;  2NZD B;  1BFM A;  1M18 A;  4H9N B;  4XUJ A;  4WU9 A;  5DNM D;  5AV8 D;  3LEL A;  2Y2O A;  4AWL C;  2CV5 A;  1N1J B;  3MGP A;  3KFU G;  4YM6 C;  2IO5 B;  3X1T A;  5B2I B;  3W97 D;  3AV1 A;  2W8S A;  5DNN A;  3LZ1 B;  3AYW B;  1HTA A;  3REH C;  5FUG B;  5BNV B;  4CAY A;  3C1B B;  1EQZ B;  1KX4 A;  4R8P C;  3KUY B;  4J8X A;  2BYK B;  2Y2H A;  5C3I C;  5CP6 B;  5CPJ C;  1P3P C;  4J8V A;  4YM6 D;  1F66 B;  2BG1 A;  3REL C;  2JCH A;  5GXQ C;  3W98 B;  2NQB B;  5BS7 C;  3AZM A;  1BH8 B;  5JRG C;  3MGP B;  5B32 G;  2Y2G A;  4XZQ C;  3REH D;  5B31 G;  4H9Q B;  5B0Y C;  4DRB A;  4R8P D;  1KX5 B;  2J8P A;  5AVB C;  3AV2 C;  1P34 A;  5E5A C;  5CPJ D;  3KXB A;  1P3P D;  5B0Z B;  5B32 B;  3REL D;  3UTA C;  5CPK A;  3R45 B;  5GXQ D;  3AN2 A;  3W99 B;  3WAA B;  5CHL B;  3WTP A;  3A1I A;  4EO5 B;  5JRG D;  1ZLA A;  3NQJ B;  4CSR B;  5AV5 C;  4XZQ D;  3MGS B;  2JE5 A;  1P3O C;  3LJA B;  5B0Y D;  3REK A;  1M19 C;  1M18 C;  4KGC A;  3X1U A;  5AV9 B;  5AVB D;  4WZS B;  3AZH B;  3AV2 D;  4XUJ C;  5E5A D;  4DRA A;  4WU9 C;  1S32 B;  2DF4 C;  1P3L B;  4UPK A;  1KU5 A;  2HIO D;  1P3I A;  3UTA D;  1P3B B;  3AZN C;  2CV5 C;  5B40 B;  3X1T C;  3KWQ A;  3VH5 T;  3AV1 C;  5AV5 D;  5B2J A;  4J8U A;  3B6F B;  1P3O D;  5DNN C;  3WA9 A;  1M19 D;  4WNN B;  4J8W C;  1ID3 B;  1M18 D;  3KSY A;  4WU9 D;  4XUJ D;  5B1L A;  3AZE A;  1KX4 C;  1R4V A;  3AZL A;  4J8X C;  3REK B;  3LEL D;  5BNX B;  1AOI B;  2CV5 D;  1P3G B;  4X23 A;  3X1T D;  3AV1 D;  4H9O B;  5DNN D;  4H9P A;  3MNN A;  4J8W D;  5DNM B;  3REJ A;  3UTA A;  4QLC A;  5AV8 B;  4ZUX A;  4ZBJ C;  1KX4 D;  4J8X D;  3AZG B;  1P3F A;  1P34 C;  3KXB C;  3REH A;  4J8V D;  2ZY2 A;  1W2E A;  3W97 B;  3EG5 B;  5CPK C;  5AVC C;  5AV6 B;  4KUD A;  4UUZ A;  3AN2 C;  3WTP C;  3UTB A;  1P3M B;  1ZLA C;  4G91 C;  3V9R A;  3WKJ C;  3AZI A;  3B0D C;  4AWL B;  4KGC C;  5B24 A;  3X1U C;  1P34 D;  3KXB D;  4YM6 B;  2F8N A;  4H9S A;  3B0C W;  5CPK D;  5AVC D;  1P3I C;  4H9R A;  1JFI A;  3AN2 D;  3AV2 A;  3WTP D;  3REH B;  1ZLA D;  3KWQ C;  3EPK A;  4J8U C;  4R8P B;  5JA4 B;  4UUZ B;  5C3I B;  5CPJ B;  4KGC D;  3X1U D;  1P3P B;  2UWX A;  3MGR A;  1KX3 A;  5B1L C;  3AZE C;  2Y2M A;  3REL B;  2VQR A;  3EPH A;  3AZL C;  5GXQ B;  1P3I D;  4JJN C;  5GSU A;  5JRG B;  4XZQ B;  4X23 C;  3KWQ D;  2YFV B;  5B0Y B;  5B2J D;  4J8U D;  1TZY A;  4WU8 C;  3WA9 D;  1JFI B;  3AZN A;  3MNN C;  5AVB B;  3AV2 B;  3C1C A;  5E5A B;  3REJ C;  1BH9 A;  3UT9 C;  4QLC C;  2HIO B;  4NE5 A;  5B1L D;  3REI C;  4ZUX C;  3AZE D;  1P3K A;  3UTA B;  3AZL D;  1P3F C;  4J8W A;  3MGQ A;  4JJN D;  3WTP E;  5AV5 B;  4X23 D;  3F6T A;  1P3O B;  4KUD C;  4WU8 D;  1M19 B;  2PYO A;  3LZ0 A;  5F99 A;  4LD9 A;  1M18 B;  3UTB C;  3MNN D;  4WU9 B;  2G5H C;  4XUJ B;  4Z5T A;  3REJ D;  1PZR A;  3UT9 D;  4QLC D;  3REI D;  4ZUX D;  1Z2C B;  3AZI C;  3LEL B;  3AZK A;  2CV5 B;  5B24 C;  3AFA A;  1P3F D;  3X1T B;  5GT3 A;  4G92 C;  3AV1 B;  4H9S C;  5DNN B;  4KUD D;  1ULY A;  5GT0 A;  4J8W B;  3UTB D;  2FJ7 A;  2Y2Q A;  4CAY B;  3H0R C;  5B31 A;  1KX4 B;  4WJ3 C;  5AVC A;  4WV4 B;  4J8X B;  5CPI C;  2CWE A;  3AZI D;  2XD1 A;  5B24 D;  4J8V B;  3MGR C;  3X1V A;  3NQU A;  1WWI A;  5AY8 C;  1M1A A;  1KX3 C;  2F8N D;  4E44 A;  3WKJ A;  3AZJ A;  2L5A A;  2Y2L A;  5GSU C;  3W96 C;  3AZM B;  1P3A A;  2ZY4 A;  1HQ3 A;  4ZBJ B;  1TZY C;  5CPI D;  4NFT A;  1P34 B;  3C1C C;  3KXB B;  1KX3 D;  3MGR D;  2YFW A;  5AY8 D;  2BYM A;  2Y2J A;  5CPK B;  1P3K C;  3AN2 B;  3X1S A;  3WTP B;  2ARO A;  5GSU D;  3MGQ C;  3W96 D;  1EQZ C;  1ZLA B;  2RIQ A;  2PYO C;  1TZY D;  3LZ0 C;  5F99 C;  3B0D B;  4JJN A;  4LD9 C;  4KGC B;  3AZN D;  3X1U B;  5BO0 A;  3C1C D;  4Z5T C;  4WU8 A;  5KDM A;  1P3K D;  1P3I B;  3AZK C;  3AZF A;  3AFA C;  3MGQ D;  1EQZ D;  3UT9 A;  3KWQ B;  3REI A;  5B1M C;  5GT3 C;  5B2J B;  4J8U B;  3WA9 B;  2PYO D;  3LZ0 D;  5F99 D;  5GT0 C;  4LD9 D;  2FJ7 C;  5B32 C;  3B6G A;  4Z5T D;  5B1L B;  3AZE B;  5B31 C;  3AZL B;  3VH6 W;  4JJN B;  1T3U A;  3AZK D;  5B33 A;  3AFA D;  3X1V C;  3TU4 A;  1M1A C;  4X23 B;  3A6N A;  5B1M D;  5GT3 D;  3AZJ C;  1B6W A;  1H3O A;  4H9P B;  1P3A C;  3MNN B;  5GT0 D;  3MVD A;  1P3L C;  3REJ B;  2FJ7 D;  1HQ3 C;  3H0L C;  5B32 D;  3UT9 B;  4QLC B;  4ZUX B;  5B31 D;  1U35 A;  4Z66 C;  1P3F B;  3X1V D;  2ZY3 A;  1M1A D;  4YS3 A;  2HUE C;  3H0M C;  4KUD B;  5CPI A;  3O62 A;  3WKJ D;  3AZJ D;  2DQN C;  3X1S C;  2ARO C;  3UTB B;  1P3A D;  5AY8 A;  1F1E A;  1HQ3 D;  3V9R B;  2NZD A;  3AZI B;  1AOI C;  3W96 A;  4Z66 D;  5B24 B;  1P3G C;  2F8N B;  4G92 B;  4H9R B;  3AZF C;  3X1S D;  2ARO D;  5B2I A;  1WWS A;  3AYW A;  3AZG C;  1Q9C A;  5FUG A;  1KX3 B;  5BNV A;  4M6B A;  3MGR B;  3C1B A;  1P3G D;  1EQZ A;  3B6G C;  3KUY A;  5AV6 C;  2BYK A;  2Y2P A;  2ZM5 A;  5CP6 A;  5GSU B;  3W96 B;  1P3M C;  5B33 C;  3AZF D;  3TU4 C;  1F66 A;  3P5J B;  3B0C T;  3A6N C;  3AL0 C;  2NQB A;  3W98 A;  1TZY B;  1BH8 A;  3AZG D;  3AZN B;  3MVD C;  3C1C B;  4E45 A;  1BH9 B;  4Z2M H;  3VH6 A;  3B6G D;  4H9Q A;  5B1M A;  5AV6 D;  1KX5 A;  1U35 C;  1P3K B;  3MGQ B;  1P3M D;  5B0Z A;  5B33 D;  3TU4 D;  5B32 A;  4HGA C;  4YS3 C;  3A6N D;  3VH5 W;  3R45 A;  2PYO B;  3W99 A;  3WAA A;  3O62 C;  5F99 B;  3LZ0 B;  4LD9 B;  3NQJ A;  3MVD D;  4CSR A;  4Z5T B;  3MGS A;  3LJA A;  2NZD C;  1U35 D;  4Z2M G;  3AZK B;  5AV9 A;  1S32 A;  3AZH A;  3AFA B;  1P3L A;  4DQY B;  5B1M B;  5GT3 B;  1A7W A;  4YS3 D;  1P3B A;  4Z66 A;  3O62 D;  5GT0 B;  5B40 A;  2IO5 C;  2FJ7 B;  5B2I C;  2HIO C;  3B6F A;  5G49 A;  5B31 B;  3AYW C;  3LZ1 C;  2JSS A;  5AVC B;  2NZD D;  2ZY5 A;  4NE6 A;  4WNN A;  1ID3 A;  3X1V B;  3C1B C;  3NQU B;  1M1A B;  2Y2K A;  3KUY C;  4G91 B;  3WKJ B;  5BNX A;  3AZJ B;  1AOI A;  5CP6 C;  1P3A B;  1B67 A;  1P3G A;  1F66 C;  1HQ3 B;  5B2I D;  2NQB C;  4H9O A;  3LEL C;  3W98 C;  3AYW D;  2Y2I A;  3LZ1 D;  4Z66 B;  3MGP C;  3A1K A;  5DNM A;  2YFW B;  3IP4 C;  2BYM B;  5AV8 A;  3C1B D;  5G49 B;  3KUY D;  2HUE B;  2Y2N A;  1KX5 C;  3AZG A;  5BT1 C;  5CP6 D;  3X1S B;  2ARO B;  5B0Z C;  3W97 A;  2F2A C;  1F66 D;  5AV6 A;  2NQB D;  3W98 D;  3WAA C;  3W99 C;  3EPL A;  4J8V C;  4EO5 C;  1P3M A;  3MGP D;  5BO0 B;  3MGS C;  3REK D;  3LJA C;  2F8N H;  4WU8 B;  5KDM B;  3AZM C;  1KX5 D;  4NE3 A;  5AV9 C;  1S32 C;  5BT1 D;  3AZH C;  3AZF B;  2LY8 A;  3VH5 A;  4YM6 A;  5B0Z D;  2F8N K;  3REI B;  1P3B C;  3W99 D;  3WAA D;  2XD5 A;  5B40 C;  3B6G B;  3MGS D;  4R8P A;  3B6F C;  1TAF A;  5JA4 A;  3LJA D;  1ID3 C;  3AZM D;  5CPJ A;  4KHA A;  2RVQ C;  5AV9 D;  5B33 B;  3AZH D;  1S32 D;  3TU4 B;  1P3P A;  2F8N G;  1P3L D;  3EPJ A;  3A6N B;  3REL A;  3REK C;  5GXQ A;  5BS7 A;  1P3B D;  1H3O B;  3FDD A;  5JRG A;  4H9N A;  3MVD B;  5B40 D;  2G5I C;  4XZQ A;  2YFV A;  5B0Y A;  3B6F D;  1U35 B;  5AVB A;  1N1J A;  1ID3 D;  5E5A A;  5DNM C;  2RVQ D;  2HIO A;  5AV8 C;  5B2J C;  1TAF B;  4HGA B;  4YS3 B;  3VH6 T;  3WA9 C;  3LZ1 A;  3B0B A; 
#chains in the Genus database with same CATH homology
 5CPI B;  3O62 B;  2FFF B;  1AOI D;  4KHA B;  3W97 C;  5AV5 A;  5AY8 B;  1P3O A;  1M19 A;  2NZD B;  1BFM A;  1M18 A;  4H9N B;  4XUJ A;  4WU9 A;  5DNM D;  5AV8 D;  3LEL A;  2Y2O A;  4AWL C;  2CV5 A;  1N1J B;  3MGP A;  3KFU G;  4YM6 C;  2IO5 B;  3X1T A;  5B2I B;  3W97 D;  3AV1 A;  2W8S A;  5DNN A;  3LZ1 B;  3AYW B;  1HTA A;  3REH C;  5FUG B;  5BNV B;  4CAY A;  3C1B B;  1EQZ B;  1KX4 A;  4R8P C;  3KUY B;  4J8X A;  2BYK B;  2Y2H A;  5C3I C;  5CP6 B;  5CPJ C;  1P3P C;  4J8V A;  4YM6 D;  1F66 B;  2BG1 A;  3REL C;  2JCH A;  5GXQ C;  3W98 B;  2NQB B;  5BS7 C;  3AZM A;  1BH8 B;  5JRG C;  3MGP B;  5B32 G;  2Y2G A;  4XZQ C;  3REH D;  5B31 G;  4H9Q B;  5B0Y C;  4DRB A;  4R8P D;  1KX5 B;  2J8P A;  5AVB C;  3AV2 C;  1P34 A;  5E5A C;  5CPJ D;  3KXB A;  1P3P D;  5B0Z B;  5B32 B;  3REL D;  3UTA C;  5CPK A;  3R45 B;  5GXQ D;  3AN2 A;  3W99 B;  3WAA B;  5CHL B;  3WTP A;  3A1I A;  4EO5 B;  5JRG D;  1ZLA A;  3NQJ B;  4CSR B;  5AV5 C;  4XZQ D;  3MGS B;  2JE5 A;  1P3O C;  3LJA B;  5B0Y D;  3REK A;  1M19 C;  1M18 C;  4KGC A;  3X1U A;  5AV9 B;  5AVB D;  4WZS B;  3AZH B;  3AV2 D;  4XUJ C;  5E5A D;  4DRA A;  4WU9 C;  1S32 B;  2DF4 C;  1P3L B;  4UPK A;  1KU5 A;  2HIO D;  1P3I A;  3UTA D;  1P3B B;  3AZN C;  2CV5 C;  5B40 B;  3X1T C;  3KWQ A;  3VH5 T;  3AV1 C;  5AV5 D;  5B2J A;  4J8U A;  3B6F B;  1P3O D;  5DNN C;  3WA9 A;  1M19 D;  4WNN B;  4J8W C;  1ID3 B;  1M18 D;  3KSY A;  4WU9 D;  4XUJ D;  5B1L A;  3AZE A;  1KX4 C;  1R4V A;  3AZL A;  4J8X C;  3REK B;  3LEL D;  5BNX B;  1AOI B;  2CV5 D;  1P3G B;  4X23 A;  3X1T D;  3AV1 D;  4H9O B;  5DNN D;  4H9P A;  3MNN A;  4J8W D;  5DNM B;  3REJ A;  3UTA A;  4QLC A;  5AV8 B;  4ZUX A;  4ZBJ C;  1KX4 D;  4J8X D;  3AZG B;  1P3F A;  1P34 C;  3KXB C;  3REH A;  4J8V D;  2ZY2 A;  1W2E A;  3W97 B;  3EG5 B;  5CPK C;  5AVC C;  5AV6 B;  4KUD A;  4UUZ A;  3AN2 C;  3WTP C;  3UTB A;  1P3M B;  1ZLA C;  4G91 C;  3V9R A;  3WKJ C;  3AZI A;  3B0D C;  4AWL B;  4KGC C;  5B24 A;  3X1U C;  1P34 D;  3KXB D;  4YM6 B;  2F8N A;  4H9S A;  3B0C W;  5CPK D;  5AVC D;  1P3I C;  4H9R A;  1JFI A;  3AN2 D;  3AV2 A;  3WTP D;  3REH B;  1ZLA D;  3KWQ C;  3EPK A;  4J8U C;  4R8P B;  5JA4 B;  4UUZ B;  5C3I B;  5CPJ B;  4KGC D;  3X1U D;  1P3P B;  2UWX A;  3MGR A;  1KX3 A;  5B1L C;  3AZE C;  2Y2M A;  3REL B;  2VQR A;  3EPH A;  3AZL C;  5GXQ B;  1P3I D;  4JJN C;  5GSU A;  5JRG B;  4XZQ B;  4X23 C;  3KWQ D;  2YFV B;  5B0Y B;  5B2J D;  4J8U D;  1TZY A;  4WU8 C;  3WA9 D;  1JFI B;  3AZN A;  3MNN C;  5AVB B;  3AV2 B;  3C1C A;  5E5A B;  3REJ C;  1BH9 A;  3UT9 C;  4QLC C;  2HIO B;  4NE5 A;  5B1L D;  3REI C;  4ZUX C;  3AZE D;  1P3K A;  3UTA B;  3AZL D;  1P3F C;  4J8W A;  3MGQ A;  4JJN D;  3WTP E;  5AV5 B;  4X23 D;  3F6T A;  1P3O B;  4KUD C;  4WU8 D;  1M19 B;  2PYO A;  3LZ0 A;  5F99 A;  4LD9 A;  1M18 B;  3UTB C;  3MNN D;  4WU9 B;  2G5H C;  4XUJ B;  4Z5T A;  3REJ D;  1PZR A;  3UT9 D;  4QLC D;  3REI D;  4ZUX D;  1Z2C B;  3AZI C;  3LEL B;  3AZK A;  2CV5 B;  5B24 C;  3AFA A;  1P3F D;  3X1T B;  5GT3 A;  4G92 C;  3AV1 B;  4H9S C;  5DNN B;  4KUD D;  1ULY A;  5GT0 A;  4J8W B;  3UTB D;  2FJ7 A;  2Y2Q A;  4CAY B;  3H0R C;  5B31 A;  1KX4 B;  4WJ3 C;  5AVC A;  4WV4 B;  4J8X B;  5CPI C;  2CWE A;  3AZI D;  2XD1 A;  5B24 D;  4J8V B;  3MGR C;  3X1V A;  3NQU A;  1WWI A;  5AY8 C;  1M1A A;  1KX3 C;  2F8N D;  4E44 A;  3WKJ A;  3AZJ A;  2L5A A;  2Y2L A;  5GSU C;  3W96 C;  3AZM B;  1P3A A;  2ZY4 A;  1HQ3 A;  4ZBJ B;  1TZY C;  5CPI D;  4NFT A;  1P34 B;  3C1C C;  3KXB B;  1KX3 D;  3MGR D;  2YFW A;  5AY8 D;  2BYM A;  2Y2J A;  5CPK B;  1P3K C;  3AN2 B;  3X1S A;  3WTP B;  2ARO A;  5GSU D;  3MGQ C;  3W96 D;  1EQZ C;  1ZLA B;  2RIQ A;  2PYO C;  1TZY D;  3LZ0 C;  5F99 C;  3B0D B;  4JJN A;  4LD9 C;  4KGC B;  3AZN D;  3X1U B;  5BO0 A;  3C1C D;  4Z5T C;  4WU8 A;  5KDM A;  1P3K D;  1P3I B;  3AZK C;  3AZF A;  3AFA C;  3MGQ D;  1EQZ D;  3UT9 A;  3KWQ B;  3REI A;  5B1M C;  5GT3 C;  5B2J B;  4J8U B;  3WA9 B;  2PYO D;  3LZ0 D;  5F99 D;  5GT0 C;  4LD9 D;  2FJ7 C;  5B32 C;  3B6G A;  4Z5T D;  5B1L B;  3AZE B;  5B31 C;  3AZL B;  3VH6 W;  4JJN B;  1T3U A;  3AZK D;  5B33 A;  3AFA D;  3X1V C;  3TU4 A;  1M1A C;  4X23 B;  3A6N A;  5B1M D;  5GT3 D;  3AZJ C;  1B6W A;  1H3O A;  4H9P B;  1P3A C;  3MNN B;  5GT0 D;  3MVD A;  1P3L C;  3REJ B;  2FJ7 D;  1HQ3 C;  3H0L C;  5B32 D;  3UT9 B;  4QLC B;  4ZUX B;  5B31 D;  1U35 A;  4Z66 C;  1P3F B;  3X1V D;  2ZY3 A;  1M1A D;  4YS3 A;  2HUE C;  3H0M C;  4KUD B;  5CPI A;  3O62 A;  3WKJ D;  3AZJ D;  2DQN C;  3X1S C;  2ARO C;  3UTB B;  1P3A D;  5AY8 A;  1F1E A;  1HQ3 D;  3V9R B;  2NZD A;  3AZI B;  1AOI C;  3W96 A;  4Z66 D;  5B24 B;  1P3G C;  2F8N B;  4G92 B;  4H9R B;  3AZF C;  3X1S D;  2ARO D;  5B2I A;  1WWS A;  3AYW A;  3AZG C;  1Q9C A;  5FUG A;  1KX3 B;  5BNV A;  4M6B A;  3MGR B;  3C1B A;  1P3G D;  1EQZ A;  3B6G C;  3KUY A;  5AV6 C;  2BYK A;  2Y2P A;  2ZM5 A;  5CP6 A;  5GSU B;  3W96 B;  1P3M C;  5B33 C;  3AZF D;  3TU4 C;  1F66 A;  3P5J B;  3B0C T;  3A6N C;  3AL0 C;  2NQB A;  3W98 A;  1TZY B;  1BH8 A;  3AZG D;  3AZN B;  3MVD C;  3C1C B;  4E45 A;  1BH9 B;  4Z2M H;  3VH6 A;  3B6G D;  4H9Q A;  5B1M A;  5AV6 D;  1KX5 A;  1U35 C;  1P3K B;  3MGQ B;  1P3M D;  5B0Z A;  5B33 D;  3TU4 D;  5B32 A;  4HGA C;  4YS3 C;  3A6N D;  3VH5 W;  3R45 A;  2PYO B;  3W99 A;  3WAA A;  3O62 C;  5F99 B;  3LZ0 B;  4LD9 B;  3NQJ A;  3MVD D;  4CSR A;  4Z5T B;  3MGS A;  3LJA A;  2NZD C;  1U35 D;  4Z2M G;  3AZK B;  5AV9 A;  1S32 A;  3AZH A;  3AFA B;  1P3L A;  4DQY B;  5B1M B;  5GT3 B;  1A7W A;  4YS3 D;  1P3B A;  4Z66 A;  3O62 D;  5GT0 B;  5B40 A;  2IO5 C;  2FJ7 B;  5B2I C;  2HIO C;  3B6F A;  5G49 A;  5B31 B;  3AYW C;  3LZ1 C;  2JSS A;  5AVC B;  2NZD D;  2ZY5 A;  4NE6 A;  4WNN A;  1ID3 A;  3X1V B;  3C1B C;  3NQU B;  1M1A B;  2Y2K A;  3KUY C;  4G91 B;  3WKJ B;  5BNX A;  3AZJ B;  1AOI A;  5CP6 C;  1P3A B;  1B67 A;  1P3G A;  1F66 C;  1HQ3 B;  5B2I D;  2NQB C;  4H9O A;  3LEL C;  3W98 C;  3AYW D;  2Y2I A;  3LZ1 D;  4Z66 B;  3MGP C;  3A1K A;  5DNM A;  2YFW B;  3IP4 C;  2BYM B;  5AV8 A;  3C1B D;  5G49 B;  3KUY D;  2HUE B;  2Y2N A;  1KX5 C;  3AZG A;  5BT1 C;  5CP6 D;  3X1S B;  2ARO B;  5B0Z C;  3W97 A;  2F2A C;  1F66 D;  5AV6 A;  2NQB D;  3W98 D;  3WAA C;  3W99 C;  3EPL A;  4J8V C;  4EO5 C;  1P3M A;  3MGP D;  5BO0 B;  3MGS C;  3REK D;  3LJA C;  2F8N H;  4WU8 B;  5KDM B;  3AZM C;  1KX5 D;  4NE3 A;  5AV9 C;  1S32 C;  5BT1 D;  3AZH C;  3AZF B;  2LY8 A;  3VH5 A;  4YM6 A;  5B0Z D;  2F8N K;  3REI B;  1P3B C;  3W99 D;  3WAA D;  2XD5 A;  5B40 C;  3B6G B;  3MGS D;  4R8P A;  3B6F C;  1TAF A;  5JA4 A;  3LJA D;  1ID3 C;  3AZM D;  5CPJ A;  4KHA A;  2RVQ C;  5AV9 D;  5B33 B;  3AZH D;  1S32 D;  3TU4 B;  1P3P A;  2F8N G;  1P3L D;  3EPJ A;  3A6N B;  3REL A;  3REK C;  5GXQ A;  5BS7 A;  1P3B D;  1H3O B;  3FDD A;  5JRG A;  4H9N A;  3MVD B;  5B40 D;  2G5I C;  4XZQ A;  2YFV A;  5B0Y A;  3B6F D;  1U35 B;  5AVB A;  1N1J A;  1ID3 D;  5E5A A;  5DNM C;  2RVQ D;  2HIO A;  5AV8 C;  5B2J C;  1TAF B;  4HGA B;  4YS3 B;  3VH6 T;  3WA9 C;  3LZ1 A;  3B0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...