3REKD

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekD00
4J8UA 2BYMA 3KSYA 4YS3A 4Z5TB 4H9SC 4JJNC 5B1LC 4KUDD 2HIOC 3MGPD 3REJD 5AY8C 2NQBD 5GSUA 4NE6A 2FJ7D 3WA9C 4J8WB 3W99C 5CPKB 4ZBJC 3AZMD 4G92C 3TU4A 1P3GA 4J8VD 3RELB 3AYWA 3WKJB 1WWIA 3AZGB 3W97D 3AZEB 1KX4A 2YFWA 5BS7C 5B32D 4Z66D 3WTPA 1P34B 4HGAC 2CV5D 5B33A 3LZ1B 4ZUXD 4QLCD 1M1AA 1AOIC 5AV9B 1EQZC 3NQJB 1P3MB 2F8NA 1HQ3D 1U35D 4CSRA 5B2JC 5B1MC 4J8XA 5BNXA 1P3LC 3REIC 4E44A 4DRAA 5F99D 1M18D 1JFIB 3AZND 3AN2C 5GXQB 5AV8A 5GT0A 1TZYA 3B6GB 5B0YD 1P3FD 5FUGA 3X1SA 1S32C 1P3PD 4H9PA 4WU9C 3B6FB 5B31B 4XZQC 5CP6C 4CAYB 3W98D 3REKC 1P3AD 5B0ZA 2AROC 3KXBC 1AOID 4KGCA 3MGQA 5B1MD 4X23A 3AZIA 3V9RA 1P3BB 1ZLAB 3REID 3A6NC 1P3IC 1BH9A 3X1TD 3UT9C 3UTAD 5DNNC 3KUYA 3WAAB 1ID3B 5DNMD 1F66B 5B2IB 3C1CC 5JRGD 4JJNA 3KWQC 1HTAA 5B1LA 4KUDB 1KX3D 5B40A 2HIOA 3MNND 1BFMA 3MGPB 3MGRC 2BYKA 3REJB 3LZ0C 1TAFB 4J8UD 5AY8A 3X1VC 3C1BC 3AZJC 2NQBB 5BO0A 4YS3D 3B0DB 3AZIB 3AZFA 3WA9A 3W99A 4WU8A 5E5AC 4YM6C 3AZMB 5B31G 4J8XC 4J8VB 4G91B 3KUYB 5GSUD 3W97B 2IO5B 3R45B 4UUZA 5BS7A 4H9OB 4Z66B 5B32B 2CV5B 4ZUXB 4R8PC 4QLCB 4H9NB 3TU4D 1P3GD 1EQZA 3AYWD 1HQ3B 1U35B 5B2JA 5B1MA 1KX4D 4WNNB 3WTPD 5B33D 1P3LA 3REIA 3WTPE 5F99B 1M18B 1M1AD 3AZNB 3AN2A 2F8ND 5BT1C 4AWLB 4X23C 4J8XD 5CPJC 3AFAC 1P3FB 4H9RB 1S32A 1P3PB 4WU9A 4XZQA 3AZLA 5CP6A 3W98B 3REKA 1P3AB 5AV8D 5GT0D 2AROA 1TZYD 3B0CW 4R8PD 3KXBA 1AOIB 3LELC 3AZKC 3LJAA 3O62C 3W96A 5AVBC 1P3KC 5B1MB 3X1SD 4LD9C 5B40C 5CPIC 2NZDC 3REIB 5B0ZD 3A6NA 1P3IA 5B32G 3X1TB 3UT9A 1N1JB 4KGCD 3UTAB 3MGQD 2PYOC 5DNNA 5DNMB 3AZHC 3X1UA 3C1CA 4X23D 3MGSC 3AZID 3AZFC 1B6WA 5B24C 4WU8C 5JRGB 3KWQA 4H9QB 5BNVA 1KX3B 5G49A 3MNNB 3KUYD 3MGRA 3LZ0A 2BYMB 4J8UB 1KU5A 5AVCC 3MVDC 3C1BA 3AZJA 1Q9CA 3X1VA 4YS3B 5C3IC 4JJND 5B1LD 5B40D 2HIOD 5E5AA 4YM6A 1KX5C 5AV6C 3UT9B 5AY8D 4EO5B 5GSUB 3AZFD 3AV1C 3WA9D 3W99D 4WU8D 4R8PA 3TU4B 1P3GB 5CHLB 5GT3C 3AYWB 5AV5C 1KX4B 2YFWB 3X1VB 3WTPB 3AZLC 5B33B 3REHC 1M1AB 1EQZD 4Z5TC 3LJAC 3W96C 2F8NB 4CSRB 5B2JD 4J8XB 5CPJA 5BNXB 3AFAA 1P3LD 3AN2D 5AV8B 5GT0B 1TZYB 4R8PB 4J8WC 5CPKC 5JA4A 3X1UC 3LELA 3AZKA 5GT3D 3O62A 3RELC 5AVBA 1P3KA 3X1SB 5FUGB 3WKJC 1S32D 1H3OA 4H9PB 3AZGC 2HUEB 4WU9D 4XUJA 1M19A 4XZQD 4LD9A 3AZLD 5CP6D 2NZDA 3REKD 5CPIA 5B0ZB 1P34C 2AROD 3KXBD 3LZ1C 4KGCB 3LJAD 3MGQB 2PYOA 3W96D 5AV9C 1P3MC 3AZHA 4X23B 3MGSA 3V9RB 2LY8A 3UTBA 5B24A 1BH8A 3A6ND 1BH9B 1P3ID 2RVQC 3NQUA 3UT9D 5DNND 5GXQC 3X1UD 1R4VA 3C1CD 3MVDA 5AVCA 2F8NG 3B6GC 1P3KB 4JJNB 3KWQD 5B1LB 5B31C 3B6FC 5B40B 2HIOB 1KX5A 5AV6A 3MGRD 2BYKB 3LZ0D 3AZJD 5AY8B 3X1VD 3C1BD 5BO0B 3AZFB 3WA9B 3AV1A 1P3BC 3W99B 4WU8B 4ZBJB 1ZLAC 5E5AD 4YM6D 4G92B 5GT3A 5AV5A 3WAAC 4UUZB 1ID3C 1F66C 5B2IC 4HGAB 4M6BA 3REHA 1EQZB 4Z5TA 4KUDC 5B2JB 4XUJC 1M19C 3MGPC 2NQBC 1P3LB 3B0DC 2FJ7C 3AN2B 5BT1D 4J8WA 5CPKA 1P3OC 5CPJD 5GT3B 3UTBC 3AZMC 4J8VC 3RELA 3AFAD 3WKJA 4G91C 1S32B 3AZGA 4WU9B 2IO5C 1F1EA 3W97C 4XZQB 3AZLB 5CP6B 5B32C 4Z66C 3REKB 1P34A 2AROB 3KXBB 2CV5C 3REHB 4NE3A 3LELD 4ZUXC 3LZ1A 4QLCC 3LJAB 3AZKD 3O62D 3W96B 5AV9A 2CWEA 3NQJA 5AVBD 1P3KD 1P3MA 1HQ3C 1U35C 4NFTA 4XUJD 1M19D 1WWSA 4LD9D 2NZDD 5CPID 3A6NB 1P3IB 4Z2MH 5F99C 1M18C 1JFIA 2PYOD 5DNNB 3AZNC 5GXQA 3X1UB 3C1CB 3AZHD 1P3OD 3MGSD 3UTBD 4AWLC 3B6GA 5B0YC 1B67A 5B24D 1P3FC 1P3PC 3AV2C 3KWQB 3B6FA 5B31A 5BNVB 5G49B 3W98C 4CAYA 1P3AC 3MGRB 3LZ0B 3AZJB 3MVDD 5AVCD 3C1BB 2F8NH 4NE5A 1P3BA 1ZLAA 5E5AB 4YM6B 2JSSA 1KX5D 5AV6D 3X1TC 3UTAC 3WAAA 1ID3A 5DNMC 1F66A 5B2IA 3AV1D 3AV2D 5JRGC 2F8NK 5AV5D 5KDMA 4KUDA 1KX3C 3MNNC 3AZEC 3MGPA 3REJA 4J8UC 1TAFA 3VH6T 2NQBA 2YFVA 4WZSB 4Z2MG 4WV4B 3REHD 4YS3C 2FJ7A 1ULYA 4Z5TD 3VH5T 1P3OA 5CPJB 3B0CT 3AZMA 4J8VA 4KHAA 3AFAB 4EO5C 5GSUC 3W97A 3R45A 4H9OA 5B32A 4Z66A 2CV5A 4J8WD 5JA4B 5CPKD 3LELB 4ZUXA 3AZKB 4QLCA 4H9SA 4H9NA 3O62B 3TU4C 5KDMB 3AYWC 3RELD 5AVBB 1P3GC 3WKJD 1HQ3A 1U35A 1H3OB 3AZGD 3VH6A 4XUJB 1M19B 3AZED 1KX4C 4LD9B 4WNNA 2YFVB 3WTPC 5CPIB 1P34D 2NZDB 1A7WA 5B33C 2FJ7B 5F99A 3LZ1D 1M18A 3VH5A 1M1AC 2PYOB 5AV9D 3AZNA 1P3MD 3AZHB 1P3OB 3MGSB 3UTBB 4KHAB 5B0YA 5B24B 1BH8B 1P3FA 4H9RA 1P3PA 3AV2A 2RVQD 3NQUB 3W98A 5GXQD 5AV8C 5GT0C 1TZYC 1P3AA 4E45A 1AOIA 3MVDB 5AVCB 3B6GD 5C3IB 3X1SC 3B0BA 2HUEC 3B6FD 5B31D 4DRBA 1KX5B 5AV6B 5B0ZC 2L5AA 3X1TA 4KGCC 1N1JA 3REJC 3MGQC 3UTAA 5DNMA 3AZIC 3AV1B 5B0YB 1P3BD 3VH6W 1ZLAD 3AV2B 5JRGA 5AV5B 1F66D 4H9QA 1KX3A 3VH5W 3MNNA 3KUYC 3WAAD 1ID3D 3AZEA 5B2ID
chains in the Genus database with same CATH superfamily
4J8UA 2BYMA 3KSYA 4YS3A 4Z5TB 4H9SC 4JJNC 5B1LC 4KUDD 2DQNC 2HIOC 3MGPD 2JE5A 2ZY3A 3REJD 5AY8C 2NQBD 5GSUA 4NE6A 3H0LC 2FJ7D 3WA9C 4J8WB 3W99C 2ZY2A 5CPKB 4ZBJC 3AZMD 4G92C 3TU4A 1P3GA 4J8VD 3RELB 3AYWA 3WKJB 1WWIA 3EPKA 3AZGB 3W97D 3AZEB 1KX4A 2YFWA 5BS7C 5B32D 4Z66D 3WTPA 1P34B 4HGAC 2CV5D 5B33A 3LZ1B 4ZUXD 4QLCD 1M1AA 1AOIC 5AV9B 1EQZC 3NQJB 1P3MB 2F8NA 1HQ3D 1U35D 4CSRA 5B2JC 5B1MC 4J8XA 5BNXA 1P3LC 3REIC 4E44A 4DRAA 5F99D 1M18D 1JFIB 3AZND 3AN2C 2VQRA 5GXQB 5AV8A 5GT0A 1TZYA 4UPKA 3B6GB 5B0YD 1P3FD 5FUGA 3X1SA 1S32C 1P3PD 4H9PA 4WU9C 3B6FB 5B31B 4XZQC 5CP6C 4CAYB 3W98D 3REKC 1P3AD 5B0ZA 2AROC 3KXBC 1AOID 4KGCA 3MGQA 5B1MD 4X23A 3AZIA 3V9RA 1P3BB 3H0MC 1ZLAB 3REID 3A6NC 1P3IC 1BH9A 3X1TD 3UT9C 3UTAD 5DNNC 3KUYA 3WAAB 1ID3B 5DNMD 1F66B 5B2IB 3C1CC 2W8SA 5JRGD 4JJNA 3KWQC 1HTAA 3EPHA 5B1LA 4KUDB 1KX3D 5B40A 2HIOA 3MNND 1BFMA 2XD1A 3MGPB 3MGRC 2BYKA 3REJB 3LZ0C 1TAFB 4J8UD 5AY8A 3X1VC 3C1BC 3AZJC 2NQBB 5BO0A 4YS3D 3B0DB 3AZIB 3AZFA 3WA9A 3W99A 4WU8A 5E5AC 4YM6C 3AZMB 5B31G 4J8XC 4J8VB 4G91B 3KUYB 5GSUD 3W97B 2IO5B 3R45B 4UUZA 5BS7A 4H9OB 4Z66B 5B32B 2CV5B 2G5HC 4ZUXB 4R8PC 4QLCB 4H9NB 3TU4D 1P3GD 2Y2JA 3AYWD 1EQZA 1HQ3B 1U35B 5B2JA 5B1MA 1KX4D 4WNNB 2Y2HA 3WTPD 5B33D 1P3LA 3REIA 3WTPE 5F99B 1M18B 1M1AD 3FDDA 3AZNB 3AN2A 2F8ND 5BT1C 4AWLB 4X23C 4J8XD 5CPJC 3AFAC 1P3FB 4H9RB 1S32A 1P3PB 2ZY4A 4WU9A 4XZQA 3AZLA 5CP6A 3W98B 3REKA 1P3AB 5AV8D 5GT0D 2AROA 1TZYD 3B0CW 4R8PD 3KXBA 1AOIB 3LELC 3AZKC 3LJAA 3O62C 3W96A 5AVBC 3IP4C 1P3KC 5B1MB 3X1SD 4LD9C 5B40C 5CPIC 2NZDC 3REIB 5B0ZD 3A6NA 1P3IA 5B32G 3X1TB 3UT9A 1N1JB 4KGCD 3UTAB 3MGQD 2PYOC 5DNNA 2RIQA 5DNMB 3AZHC 3X1UA 3C1CA 4X23D 3MGSC 3AZID 3AZFC 1B6WA 5B24C 4WU8C 5JRGB 2F2AC 3KWQA 2Y2KA 4H9QB 5BNVA 1KX3B 5G49A 3MNNB 3KUYD 3MGRA 3LZ0A 2BYMB 4J8UB 1KU5A 5AVCC 3MVDC 3C1BA 3AZJA 1Q9CA 3X1VA 4YS3B 5C3IC 4JJND 5B1LD 5B40D 2HIOD 5E5AA 4YM6A 1KX5C 5AV6C 3UT9B 5AY8D 4EO5B 5GSUB 2BG1A 4DQYB 3AZFD 3AV1C 3WA9D 3W99D 4WU8D 2XD5A 4R8PA 3TU4B 1P3GB 5CHLB 5GT3C 3AYWB 5AV5C 1KX4B 2YFWB 3X1VB 3WTPB 3AZLC 5B33B 3REHC 3EG5B 1M1AB 1EQZD 4Z5TC 3LJAC 3W96C 2F8NB 4CSRB 5B2JD 4J8XB 5CPJA 5BNXB 3AFAA 1P3LD 3AN2D 5AV8B 5GT0B 1TZYB 4R8PB 4J8WC 5CPKC 2JCHA 5JA4A 3X1UC 3LELA 3AZKA 5GT3D 3O62A 3RELC 5AVBA 1P3KA 5FUGB 3X1SB 3WKJC 1S32D 1H3OA 4H9PB 3AZGC 2HUEB 4WU9D 4XUJA 1M19A 4XZQD 4LD9A 3AZLD 5CP6D 2NZDA 3REKD 5CPIA 5B0ZB 1P34C 2AROD 3KXBD 3LZ1C 4KGCB 3LJAD 3MGQB 2PYOA 3W96D 5AV9C 1P3MC 3AZHA 4X23B 3MGSA 3V9RB 2LY8A 3UTBA 5B24A 1BH8A 2DF4C 3A6ND 1BH9B 1P3ID 2RVQC 3NQUA 3UT9D 5DNND 5GXQC 3X1UD 1R4VA 3C1CD 3A1IA 5AVCA 3MVDA 2F8NG 1P3KB 3B6GC 3AL0C 3KFUG 4JJNB 3KWQD 5B1LB 5B31C 3B6FC 5B40B 2HIOB 1KX5A 5AV6A 3MGRD 2BYKB 3LZ0D 3AZJD 5AY8B 3X1VD 3C1BD 5BO0B 1PZRA 2Y2OA 3AZFB 3WA9B 3AV1A 1P3BC 3W99B 4WU8B 4ZBJB 1ZLAC 5E5AD 4YM6D 4G92B 5GT3A 2Y2IA 5AV5A 2Y2GA 2Y2PA 3WAAC 4UUZB 1ID3C 1F66C 5B2IC 4HGAB 4M6BA 3P5JB 3A1KA 3REHA 2G5IC 1EQZB 4Z5TA 4KUDC 5B2JB 4XUJC 1M19C 3MGPC 2NQBC 1P3LB 3B0DC 2FJ7C 3AN2B 5BT1D 4J8WA 5CPKA 1P3OC 5CPJD 5GT3B 3UTBC 3AZMC 4J8VC 3RELA 3AFAD 3WKJA 4G91C 1S32B 3AZGA 4WU9B 2IO5C 1F1EA 3W97C 4XZQB 3AZLB 5CP6B 5B32C 4Z66C 3REKB 1P34A 2AROB 3KXBB 2CV5C 3REHB 4NE3A 3LELD 4ZUXC 3LZ1A 4QLCC 3LJAB 3AZKD 3O62D 3W96B 5AV9A 2CWEA 2Y2LA 3NQJA 5AVBD 1P3KD 1P3MA 1HQ3C 1U35C 4NFTA 2UWXA 4XUJD 1M19D 1WWSA 4LD9D 2NZDD 5CPID 3A6NB 1P3IB 4Z2MH 5F99C 1M18C 1JFIA 2PYOD 5DNNB 2Y2NA 3AZNC 5GXQA 3X1UB 3EPJA 3C1CB 3AZHD 1P3OD 3MGSD 3UTBD 4AWLC 3B6GA 5B0YC 1B67A 5B24D 1P3FC 1P3PC 3AV2C 3KWQB 3B6FA 5B31A 5BNVB 5G49B 3W98C 4CAYA 1P3AC 3MGRB 3LZ0B 3AZJB 3MVDD 5AVCD 3C1BB 3F6TA 2F8NH 4NE5A 1P3BA 1ZLAA 5E5AB 4YM6B 2JSSA 1KX5D 5AV6D 2Y2QA 3X1TC 3UTAC 3WAAA 1ID3A 5DNMC 1F66A 5B2IA 3AV1D 2ZM5A 3AV2D 5JRGC 2F8NK 1Z2CB 5AV5D 5KDMA 4KUDA 1KX3C 3MNNC 2ZY5A 3AZEC 3MGPA 3REJA 4J8UC 1TAFA 3VH6T 2NQBA 2YFVA 3H0RC 4WZSB 4Z2MG 4WV4B 3REHD 4YS3C 2FJ7A 1ULYA 4Z5TD 3VH5T 1P3OA 5CPJB 3B0CT 3AZMA 4J8VA 4KHAA 3AFAB 4EO5C 5GSUC 2FFFB 3W97A 3R45A 4H9OA 5B32A 4Z66A 2J8PA 2CV5A 4J8WD 5JA4B 5CPKD 3LELB 4ZUXA 3AZKB 4QLCA 4H9SA 4H9NA 3O62B 3TU4C 5KDMB 3AYWC 3RELD 5AVBB 1P3GC 3WKJD 1HQ3A 1U35A 1H3OB 3AZGD 3VH6A 4XUJB 1M19B 3AZED 1KX4C 4LD9B 2Y2MA 4WNNA 2YFVB 3WTPC 5CPIB 1P34D 2NZDB 1A7WA 5B33C 2FJ7B 5F99A 3LZ1D 1M18A 3VH5A 1M1AC 2PYOB 5AV9D 3AZNA 1P3MD 1T3UA 3AZHB 1P3OB 3EPLA 3MGSB 3UTBB 4KHAB 5B0YA 5B24B 1BH8B 1P3FA 4H9RA 1P3PA 3AV2A 2RVQD 3NQUB 3W98A 5GXQD 5AV8C 5GT0C 1TZYC 1P3AA 4E45A 1AOIA 3MVDB 5AVCB 3B6GD 5C3IB 3X1SC 3B0BA 2HUEC 3B6FD 5B31D 4DRBA 1KX5B 5AV6B 5B0ZC 2L5AA 3X1TA 4KGCC 1N1JA 3REJC 3MGQC 3UTAA 4WJ3C 5DNMA 1W2EA 3AZIC 3AV1B 5B0YB 1P3BD 3VH6W 1ZLAD 3AV2B 5JRGA 5AV5B 1F66D 4H9QA 1KX3A 3VH5W 3MNNA 3KUYC 3WAAD 1ID3D 3AZEA 5B2ID
chains in the Genus database with same CATH topology
4J8UA 2BYMA 3KSYA 4YS3A 4Z5TB 4H9SC 4JJNC 5B1LC 4KUDD 2DQNC 2HIOC 3MGPD 2JE5A 2ZY3A 3REJD 5AY8C 2NQBD 5GSUA 4NE6A 3H0LC 2FJ7D 3WA9C 4J8WB 3W99C 2ZY2A 5CPKB 4ZBJC 3AZMD 4G92C 3TU4A 1P3GA 4J8VD 3RELB 3AYWA 3WKJB 1WWIA 3EPKA 3AZGB 3W97D 3AZEB 1KX4A 2YFWA 5BS7C 5B32D 4Z66D 3WTPA 1P34B 4HGAC 2CV5D 5B33A 3LZ1B 4ZUXD 4QLCD 1M1AA 1AOIC 5AV9B 1EQZC 3NQJB 1P3MB 2F8NA 1HQ3D 1U35D 4CSRA 5B2JC 5B1MC 4J8XA 5BNXA 1P3LC 3REIC 4E44A 4DRAA 5F99D 1M18D 1JFIB 3AZND 3AN2C 2VQRA 5GXQB 5AV8A 5GT0A 1TZYA 4UPKA 3B6GB 5B0YD 1P3FD 5FUGA 3X1SA 1S32C 1P3PD 4H9PA 4WU9C 3B6FB 5B31B 4XZQC 5CP6C 4CAYB 3W98D 3REKC 1P3AD 5B0ZA 2AROC 3KXBC 1AOID 4KGCA 3MGQA 5B1MD 4X23A 3AZIA 3V9RA 1P3BB 3H0MC 1ZLAB 3REID 3A6NC 1P3IC 1BH9A 3X1TD 3UT9C 3UTAD 5DNNC 3KUYA 3WAAB 1ID3B 5DNMD 1F66B 5B2IB 3C1CC 2W8SA 5JRGD 4JJNA 3KWQC 1HTAA 3EPHA 5B1LA 4KUDB 1KX3D 5B40A 2HIOA 3MNND 1BFMA 2XD1A 3MGPB 3MGRC 2BYKA 3REJB 3LZ0C 1TAFB 4J8UD 5AY8A 3X1VC 3C1BC 3AZJC 2NQBB 5BO0A 4YS3D 3B0DB 3AZIB 3AZFA 3WA9A 3W99A 4WU8A 5E5AC 4YM6C 3AZMB 5B31G 4J8XC 4J8VB 4G91B 3KUYB 5GSUD 3W97B 2IO5B 3R45B 4UUZA 5BS7A 4H9OB 4Z66B 5B32B 2CV5B 2G5HC 4ZUXB 4R8PC 4QLCB 4H9NB 3TU4D 1P3GD 2Y2JA 3AYWD 1EQZA 1HQ3B 1U35B 5B2JA 5B1MA 1KX4D 4WNNB 2Y2HA 3WTPD 5B33D 1P3LA 3REIA 3WTPE 5F99B 1M18B 1M1AD 3FDDA 3AZNB 3AN2A 2F8ND 5BT1C 4AWLB 4X23C 4J8XD 5CPJC 3AFAC 1P3FB 4H9RB 1S32A 1P3PB 2ZY4A 4WU9A 4XZQA 3AZLA 5CP6A 3W98B 3REKA 1P3AB 5AV8D 5GT0D 2AROA 1TZYD 3B0CW 4R8PD 3KXBA 1AOIB 3LELC 3AZKC 3LJAA 3O62C 3W96A 5AVBC 3IP4C 1P3KC 5B1MB 3X1SD 4LD9C 5B40C 5CPIC 2NZDC 3REIB 5B0ZD 3A6NA 1P3IA 5B32G 3X1TB 3UT9A 1N1JB 4KGCD 3UTAB 3MGQD 2PYOC 5DNNA 2RIQA 5DNMB 3AZHC 3X1UA 3C1CA 4X23D 3MGSC 3AZID 3AZFC 1B6WA 5B24C 4WU8C 5JRGB 2F2AC 3KWQA 2Y2KA 4H9QB 5BNVA 1KX3B 5G49A 3MNNB 3KUYD 3MGRA 3LZ0A 2BYMB 4J8UB 1KU5A 5AVCC 3MVDC 3C1BA 3AZJA 1Q9CA 3X1VA 4YS3B 5C3IC 4JJND 5B1LD 5B40D 2HIOD 5E5AA 4YM6A 1KX5C 5AV6C 3UT9B 5AY8D 4EO5B 5GSUB 2BG1A 4DQYB 3AZFD 3AV1C 3WA9D 3W99D 4WU8D 2XD5A 4R8PA 3TU4B 1P3GB 5CHLB 5GT3C 3AYWB 5AV5C 1KX4B 2YFWB 3X1VB 3WTPB 3AZLC 5B33B 3REHC 3EG5B 1M1AB 1EQZD 4Z5TC 3LJAC 3W96C 2F8NB 4CSRB 5B2JD 4J8XB 5CPJA 5BNXB 3AFAA 1P3LD 3AN2D 5AV8B 5GT0B 1TZYB 4R8PB 4J8WC 5CPKC 2JCHA 5JA4A 3X1UC 3LELA 3AZKA 5GT3D 3O62A 3RELC 5AVBA 1P3KA 5FUGB 3X1SB 3WKJC 1S32D 1H3OA 4H9PB 3AZGC 2HUEB 4WU9D 4XUJA 1M19A 4XZQD 4LD9A 3AZLD 5CP6D 2NZDA 3REKD 5CPIA 5B0ZB 1P34C 2AROD 3KXBD 3LZ1C 4KGCB 3LJAD 3MGQB 2PYOA 3W96D 5AV9C 1P3MC 3AZHA 4X23B 3MGSA 3V9RB 2LY8A 3UTBA 5B24A 1BH8A 2DF4C 3A6ND 1BH9B 1P3ID 2RVQC 3NQUA 3UT9D 5DNND 5GXQC 3X1UD 1R4VA 3C1CD 3A1IA 5AVCA 3MVDA 2F8NG 1P3KB 3B6GC 3AL0C 3KFUG 4JJNB 3KWQD 5B1LB 5B31C 3B6FC 5B40B 2HIOB 1KX5A 5AV6A 3MGRD 2BYKB 3LZ0D 3AZJD 5AY8B 3X1VD 3C1BD 5BO0B 1PZRA 2Y2OA 3AZFB 3WA9B 3AV1A 1P3BC 3W99B 4WU8B 4ZBJB 1ZLAC 5E5AD 4YM6D 4G92B 5GT3A 2Y2IA 5AV5A 2Y2GA 2Y2PA 3WAAC 4UUZB 1ID3C 1F66C 5B2IC 4HGAB 4M6BA 3P5JB 3A1KA 3REHA 2G5IC 1EQZB 4Z5TA 4KUDC 5B2JB 4XUJC 1M19C 3MGPC 2NQBC 1P3LB 3B0DC 2FJ7C 3AN2B 5BT1D 4J8WA 5CPKA 1P3OC 5CPJD 5GT3B 3UTBC 3AZMC 4J8VC 3RELA 3AFAD 3WKJA 4G91C 1S32B 3AZGA 4WU9B 2IO5C 1F1EA 3W97C 4XZQB 3AZLB 5CP6B 5B32C 4Z66C 3REKB 1P34A 2AROB 3KXBB 2CV5C 3REHB 4NE3A 3LELD 4ZUXC 3LZ1A 4QLCC 3LJAB 3AZKD 3O62D 3W96B 5AV9A 2CWEA 2Y2LA 3NQJA 5AVBD 1P3KD 1P3MA 1HQ3C 1U35C 4NFTA 2UWXA 4XUJD 1M19D 1WWSA 4LD9D 2NZDD 5CPID 3A6NB 1P3IB 4Z2MH 5F99C 1M18C 1JFIA 2PYOD 5DNNB 2Y2NA 3AZNC 5GXQA 3X1UB 3EPJA 3C1CB 3AZHD 1P3OD 3MGSD 3UTBD 4AWLC 3B6GA 5B0YC 1B67A 5B24D 1P3FC 1P3PC 3AV2C 3KWQB 3B6FA 5B31A 5BNVB 5G49B 3W98C 4CAYA 1P3AC 3MGRB 3LZ0B 3AZJB 3MVDD 5AVCD 3C1BB 3F6TA 2F8NH 4NE5A 1P3BA 1ZLAA 5E5AB 4YM6B 2JSSA 1KX5D 5AV6D 2Y2QA 3X1TC 3UTAC 3WAAA 1ID3A 5DNMC 1F66A 5B2IA 3AV1D 2ZM5A 3AV2D 5JRGC 2F8NK 1Z2CB 5AV5D 5KDMA 4KUDA 1KX3C 3MNNC 2ZY5A 3AZEC 3MGPA 3REJA 4J8UC 1TAFA 3VH6T 2NQBA 2YFVA 3H0RC 4WZSB 4Z2MG 4WV4B 3REHD 4YS3C 2FJ7A 1ULYA 4Z5TD 3VH5T 1P3OA 5CPJB 3B0CT 3AZMA 4J8VA 4KHAA 3AFAB 4EO5C 5GSUC 2FFFB 3W97A 3R45A 4H9OA 5B32A 4Z66A 2J8PA 2CV5A 4J8WD 5JA4B 5CPKD 3LELB 4ZUXA 3AZKB 4QLCA 4H9SA 4H9NA 3O62B 3TU4C 5KDMB 3AYWC 3RELD 5AVBB 1P3GC 3WKJD 1HQ3A 1U35A 1H3OB 3AZGD 3VH6A 4XUJB 1M19B 3AZED 1KX4C 4LD9B 2Y2MA 4WNNA 2YFVB 3WTPC 5CPIB 1P34D 2NZDB 1A7WA 5B33C 2FJ7B 5F99A 3LZ1D 1M18A 3VH5A 1M1AC 2PYOB 5AV9D 3AZNA 1P3MD 1T3UA 3AZHB 1P3OB 3EPLA 3MGSB 3UTBB 4KHAB 5B0YA 5B24B 1BH8B 1P3FA 4H9RA 1P3PA 3AV2A 2RVQD 3NQUB 3W98A 5GXQD 5AV8C 5GT0C 1TZYC 1P3AA 4E45A 1AOIA 3MVDB 5AVCB 3B6GD 5C3IB 3X1SC 3B0BA 2HUEC 3B6FD 5B31D 4DRBA 1KX5B 5AV6B 5B0ZC 2L5AA 3X1TA 4KGCC 1N1JA 3REJC 3MGQC 3UTAA 4WJ3C 5DNMA 1W2EA 3AZIC 3AV1B 5B0YB 1P3BD 3VH6W 1ZLAD 3AV2B 5JRGA 5AV5B 1F66D 4H9QA 1KX3A 3VH5W 3MNNA 3KUYC 3WAAD 1ID3D 3AZEA 5B2ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U A;  2BYM A;  3KSY A;  4YS3 A;  4Z5T B;  4H9S C;  4JJN C;  5B1L C;  4KUD D;  2HIO C;  3MGP D;  3REJ D;  5AY8 C;  2NQB D;  5GSU A;  4NE6 A;  2FJ7 D;  3WA9 C;  4J8W B;  3W99 C;  5CPK B;  4ZBJ C;  3AZM D;  4G92 C;  3TU4 A;  1P3G A;  4J8V D;  3REL B;  3AYW A;  3WKJ B;  1WWI A;  3AZG B;  3W97 D;  3AZE B;  1KX4 A;  2YFW A;  5BS7 C;  5B32 D;  4Z66 D;  3WTP A;  1P34 B;  4HGA C;  2CV5 D;  5B33 A;  3LZ1 B;  4ZUX D;  4QLC D;  1M1A A;  1AOI C;  5AV9 B;  1EQZ C;  3NQJ B;  1P3M B;  2F8N A;  1HQ3 D;  1U35 D;  4CSR A;  5B2J C;  5B1M C;  4J8X A;  5BNX A;  1P3L C;  3REI C;  4E44 A;  4DRA A;  5F99 D;  1M18 D;  1JFI B;  3AZN D;  3AN2 C;  5GXQ B;  5AV8 A;  5GT0 A;  1TZY A;  3B6G B;  5B0Y D;  1P3F D;  5FUG A;  3X1S A;  1S32 C;  1P3P D;  4H9P A;  4WU9 C;  3B6F B;  5B31 B;  4XZQ C;  5CP6 C;  4CAY B;  3W98 D;  3REK C;  1P3A D;  5B0Z A;  2ARO C;  3KXB C;  1AOI D;  4KGC A;  3MGQ A;  5B1M D;  4X23 A;  3AZI A;  3V9R A;  1P3B B;  1ZLA B;  3REI D;  3A6N C;  1P3I C;  1BH9 A;  3X1T D;  3UT9 C;  3UTA D;  5DNN C;  3KUY A;  3WAA B;  1ID3 B;  5DNM D;  1F66 B;  5B2I B;  3C1C C;  5JRG D;  4JJN A;  3KWQ C;  1HTA A;  5B1L A;  4KUD B;  1KX3 D;  5B40 A;  2HIO A;  3MNN D;  1BFM A;  3MGP B;  3MGR C;  2BYK A;  3REJ B;  3LZ0 C;  1TAF B;  4J8U D;  5AY8 A;  3X1V C;  3C1B C;  3AZJ C;  2NQB B;  5BO0 A;  4YS3 D;  3B0D B;  3AZI B;  3AZF A;  3WA9 A;  3W99 A;  4WU8 A;  5E5A C;  4YM6 C;  3AZM B;  5B31 G;  4J8X C;  4J8V B;  4G91 B;  3KUY B;  5GSU D;  3W97 B;  2IO5 B;  3R45 B;  4UUZ A;  5BS7 A;  4H9O B;  4Z66 B;  5B32 B;  2CV5 B;  4ZUX B;  4R8P C;  4QLC B;  4H9N B;  3TU4 D;  1P3G D;  1EQZ A;  3AYW D;  1HQ3 B;  1U35 B;  5B2J A;  5B1M A;  1KX4 D;  4WNN B;  3WTP D;  5B33 D;  1P3L A;  3REI A;  3WTP E;  5F99 B;  1M18 B;  1M1A D;  3AZN B;  3AN2 A;  2F8N D;  5BT1 C;  4AWL B;  4X23 C;  4J8X D;  5CPJ C;  3AFA C;  1P3F B;  4H9R B;  1S32 A;  1P3P B;  4WU9 A;  4XZQ A;  3AZL A;  5CP6 A;  3W98 B;  3REK A;  1P3A B;  5AV8 D;  5GT0 D;  2ARO A;  1TZY D;  3B0C W;  4R8P D;  3KXB A;  1AOI B;  3LEL C;  3AZK C;  3LJA A;  3O62 C;  3W96 A;  5AVB C;  1P3K C;  5B1M B;  3X1S D;  4LD9 C;  5B40 C;  5CPI C;  2NZD C;  3REI B;  5B0Z D;  3A6N A;  1P3I A;  5B32 G;  3X1T B;  3UT9 A;  1N1J B;  4KGC D;  3UTA B;  3MGQ D;  2PYO C;  5DNN A;  5DNM B;  3AZH C;  3X1U A;  3C1C A;  4X23 D;  3MGS C;  3AZI D;  3AZF C;  1B6W A;  5B24 C;  4WU8 C;  5JRG B;  3KWQ A;  4H9Q B;  5BNV A;  1KX3 B;  5G49 A;  3MNN B;  3KUY D;  3MGR A;  3LZ0 A;  2BYM B;  4J8U B;  1KU5 A;  5AVC C;  3MVD C;  3C1B A;  3AZJ A;  1Q9C A;  3X1V A;  4YS3 B;  5C3I C;  4JJN D;  5B1L D;  5B40 D;  2HIO D;  5E5A A;  4YM6 A;  1KX5 C;  5AV6 C;  3UT9 B;  5AY8 D;  4EO5 B;  5GSU B;  3AZF D;  3AV1 C;  3WA9 D;  3W99 D;  4WU8 D;  4R8P A;  3TU4 B;  1P3G B;  5CHL B;  5GT3 C;  3AYW B;  5AV5 C;  1KX4 B;  2YFW B;  3X1V B;  3WTP B;  3AZL C;  5B33 B;  3REH C;  1M1A B;  1EQZ D;  4Z5T C;  3LJA C;  3W96 C;  2F8N B;  4CSR B;  5B2J D;  4J8X B;  5CPJ A;  5BNX B;  3AFA A;  1P3L D;  3AN2 D;  5AV8 B;  5GT0 B;  1TZY B;  4R8P B;  4J8W C;  5CPK C;  5JA4 A;  3X1U C;  3LEL A;  3AZK A;  5GT3 D;  3O62 A;  3REL C;  5AVB A;  1P3K A;  3X1S B;  5FUG B;  3WKJ C;  1S32 D;  1H3O A;  4H9P B;  3AZG C;  2HUE B;  4WU9 D;  4XUJ A;  1M19 A;  4XZQ D;  4LD9 A;  3AZL D;  5CP6 D;  2NZD A;  3REK D;  5CPI A;  5B0Z B;  1P34 C;  2ARO D;  3KXB D;  3LZ1 C;  4KGC B;  3LJA D;  3MGQ B;  2PYO A;  3W96 D;  5AV9 C;  1P3M C;  3AZH A;  4X23 B;  3MGS A;  3V9R B;  2LY8 A;  3UTB A;  5B24 A;  1BH8 A;  3A6N D;  1BH9 B;  1P3I D;  2RVQ C;  3NQU A;  3UT9 D;  5DNN D;  5GXQ C;  3X1U D;  1R4V A;  3C1C D;  3MVD A;  5AVC A;  2F8N G;  3B6G C;  1P3K B;  4JJN B;  3KWQ D;  5B1L B;  5B31 C;  3B6F C;  5B40 B;  2HIO B;  1KX5 A;  5AV6 A;  3MGR D;  2BYK B;  3LZ0 D;  3AZJ D;  5AY8 B;  3X1V D;  3C1B D;  5BO0 B;  3AZF B;  3WA9 B;  3AV1 A;  1P3B C;  3W99 B;  4WU8 B;  4ZBJ B;  1ZLA C;  5E5A D;  4YM6 D;  4G92 B;  5GT3 A;  5AV5 A;  3WAA C;  4UUZ B;  1ID3 C;  1F66 C;  5B2I C;  4HGA B;  4M6B A;  3REH A;  1EQZ B;  4Z5T A;  4KUD C;  5B2J B;  4XUJ C;  1M19 C;  3MGP C;  2NQB C;  1P3L B;  3B0D C;  2FJ7 C;  3AN2 B;  5BT1 D;  4J8W A;  5CPK A;  1P3O C;  5CPJ D;  5GT3 B;  3UTB C;  3AZM C;  4J8V C;  3REL A;  3AFA D;  3WKJ A;  4G91 C;  1S32 B;  3AZG A;  4WU9 B;  2IO5 C;  1F1E A;  3W97 C;  4XZQ B;  3AZL B;  5CP6 B;  5B32 C;  4Z66 C;  3REK B;  1P34 A;  2ARO B;  3KXB B;  2CV5 C;  3REH B;  4NE3 A;  3LEL D;  4ZUX C;  3LZ1 A;  4QLC C;  3LJA B;  3AZK D;  3O62 D;  3W96 B;  5AV9 A;  2CWE A;  3NQJ A;  5AVB D;  1P3K D;  1P3M A;  1HQ3 C;  1U35 C;  4NFT A;  4XUJ D;  1M19 D;  1WWS A;  4LD9 D;  2NZD D;  5CPI D;  3A6N B;  1P3I B;  4Z2M H;  5F99 C;  1M18 C;  1JFI A;  2PYO D;  5DNN B;  3AZN C;  5GXQ A;  3X1U B;  3C1C B;  3AZH D;  1P3O D;  3MGS D;  3UTB D;  4AWL C;  3B6G A;  5B0Y C;  1B67 A;  5B24 D;  1P3F C;  1P3P C;  3AV2 C;  3KWQ B;  3B6F A;  5B31 A;  5BNV B;  5G49 B;  3W98 C;  4CAY A;  1P3A C;  3MGR B;  3LZ0 B;  3AZJ B;  3MVD D;  5AVC D;  3C1B B;  2F8N H;  4NE5 A;  1P3B A;  1ZLA A;  5E5A B;  4YM6 B;  2JSS A;  1KX5 D;  5AV6 D;  3X1T C;  3UTA C;  3WAA A;  1ID3 A;  5DNM C;  1F66 A;  5B2I A;  3AV1 D;  3AV2 D;  5JRG C;  2F8N K;  5AV5 D;  5KDM A;  4KUD A;  1KX3 C;  3MNN C;  3AZE C;  3MGP A;  3REJ A;  4J8U C;  1TAF A;  3VH6 T;  2NQB A;  2YFV A;  4WZS B;  4Z2M G;  4WV4 B;  3REH D;  4YS3 C;  2FJ7 A;  1ULY A;  4Z5T D;  3VH5 T;  1P3O A;  5CPJ B;  3B0C T;  3AZM A;  4J8V A;  4KHA A;  3AFA B;  4EO5 C;  5GSU C;  3W97 A;  3R45 A;  4H9O A;  5B32 A;  4Z66 A;  2CV5 A;  4J8W D;  5JA4 B;  5CPK D;  3LEL B;  4ZUX A;  3AZK B;  4QLC A;  4H9S A;  4H9N A;  3O62 B;  3TU4 C;  5KDM B;  3AYW C;  3REL D;  5AVB B;  1P3G C;  3WKJ D;  1HQ3 A;  1U35 A;  1H3O B;  3AZG D;  3VH6 A;  4XUJ B;  1M19 B;  3AZE D;  1KX4 C;  4LD9 B;  4WNN A;  2YFV B;  3WTP C;  5CPI B;  1P34 D;  2NZD B;  1A7W A;  5B33 C;  2FJ7 B;  5F99 A;  3LZ1 D;  1M18 A;  3VH5 A;  1M1A C;  2PYO B;  5AV9 D;  3AZN A;  1P3M D;  3AZH B;  1P3O B;  3MGS B;  3UTB B;  4KHA B;  5B0Y A;  5B24 B;  1BH8 B;  1P3F A;  4H9R A;  1P3P A;  3AV2 A;  2RVQ D;  3NQU B;  3W98 A;  5GXQ D;  5AV8 C;  5GT0 C;  1TZY C;  1P3A A;  4E45 A;  1AOI A;  3MVD B;  5AVC B;  3B6G D;  5C3I B;  3X1S C;  3B0B A;  2HUE C;  3B6F D;  5B31 D;  4DRB A;  1KX5 B;  5AV6 B;  5B0Z C;  2L5A A;  3X1T A;  4KGC C;  1N1J A;  3REJ C;  3MGQ C;  3UTA A;  5DNM A;  3AZI C;  3AV1 B;  5B0Y B;  1P3B D;  3VH6 W;  1ZLA D;  3AV2 B;  5JRG A;  5AV5 B;  1F66 D;  4H9Q A;  1KX3 A;  3VH5 W;  3MNN A;  3KUY C;  3WAA D;  1ID3 D;  3AZE A;  5B2I D; 
#chains in the Genus database with same CATH topology
 4J8U A;  2BYM A;  3KSY A;  4YS3 A;  4Z5T B;  4H9S C;  4JJN C;  5B1L C;  4KUD D;  2DQN C;  2HIO C;  3MGP D;  2JE5 A;  2ZY3 A;  3REJ D;  5AY8 C;  2NQB D;  5GSU A;  4NE6 A;  3H0L C;  2FJ7 D;  3WA9 C;  4J8W B;  3W99 C;  2ZY2 A;  5CPK B;  4ZBJ C;  3AZM D;  4G92 C;  3TU4 A;  1P3G A;  4J8V D;  3REL B;  3AYW A;  3WKJ B;  1WWI A;  3EPK A;  3AZG B;  3W97 D;  3AZE B;  1KX4 A;  2YFW A;  5BS7 C;  5B32 D;  4Z66 D;  3WTP A;  1P34 B;  4HGA C;  2CV5 D;  5B33 A;  3LZ1 B;  4ZUX D;  4QLC D;  1M1A A;  1AOI C;  5AV9 B;  1EQZ C;  3NQJ B;  1P3M B;  2F8N A;  1HQ3 D;  1U35 D;  4CSR A;  5B2J C;  5B1M C;  4J8X A;  5BNX A;  1P3L C;  3REI C;  4E44 A;  4DRA A;  5F99 D;  1M18 D;  1JFI B;  3AZN D;  3AN2 C;  2VQR A;  5GXQ B;  5AV8 A;  5GT0 A;  1TZY A;  4UPK A;  3B6G B;  5B0Y D;  1P3F D;  5FUG A;  3X1S A;  1S32 C;  1P3P D;  4H9P A;  4WU9 C;  3B6F B;  5B31 B;  4XZQ C;  5CP6 C;  4CAY B;  3W98 D;  3REK C;  1P3A D;  5B0Z A;  2ARO C;  3KXB C;  1AOI D;  4KGC A;  3MGQ A;  5B1M D;  4X23 A;  3AZI A;  3V9R A;  1P3B B;  3H0M C;  1ZLA B;  3REI D;  3A6N C;  1P3I C;  1BH9 A;  3X1T D;  3UT9 C;  3UTA D;  5DNN C;  3KUY A;  3WAA B;  1ID3 B;  5DNM D;  1F66 B;  5B2I B;  3C1C C;  2W8S A;  5JRG D;  4JJN A;  3KWQ C;  1HTA A;  3EPH A;  5B1L A;  4KUD B;  1KX3 D;  5B40 A;  2HIO A;  3MNN D;  1BFM A;  2XD1 A;  3MGP B;  3MGR C;  2BYK A;  3REJ B;  3LZ0 C;  1TAF B;  4J8U D;  5AY8 A;  3X1V C;  3C1B C;  3AZJ C;  2NQB B;  5BO0 A;  4YS3 D;  3B0D B;  3AZI B;  3AZF A;  3WA9 A;  3W99 A;  4WU8 A;  5E5A C;  4YM6 C;  3AZM B;  5B31 G;  4J8X C;  4J8V B;  4G91 B;  3KUY B;  5GSU D;  3W97 B;  2IO5 B;  3R45 B;  4UUZ A;  5BS7 A;  4H9O B;  4Z66 B;  5B32 B;  2CV5 B;  2G5H C;  4ZUX B;  4R8P C;  4QLC B;  4H9N B;  3TU4 D;  1P3G D;  2Y2J A;  3AYW D;  1EQZ A;  1HQ3 B;  1U35 B;  5B2J A;  5B1M A;  1KX4 D;  4WNN B;  2Y2H A;  3WTP D;  5B33 D;  1P3L A;  3REI A;  3WTP E;  5F99 B;  1M18 B;  1M1A D;  3FDD A;  3AZN B;  3AN2 A;  2F8N D;  5BT1 C;  4AWL B;  4X23 C;  4J8X D;  5CPJ C;  3AFA C;  1P3F B;  4H9R B;  1S32 A;  1P3P B;  2ZY4 A;  4WU9 A;  4XZQ A;  3AZL A;  5CP6 A;  3W98 B;  3REK A;  1P3A B;  5AV8 D;  5GT0 D;  2ARO A;  1TZY D;  3B0C W;  4R8P D;  3KXB A;  1AOI B;  3LEL C;  3AZK C;  3LJA A;  3O62 C;  3W96 A;  5AVB C;  3IP4 C;  1P3K C;  5B1M B;  3X1S D;  4LD9 C;  5B40 C;  5CPI C;  2NZD C;  3REI B;  5B0Z D;  3A6N A;  1P3I A;  5B32 G;  3X1T B;  3UT9 A;  1N1J B;  4KGC D;  3UTA B;  3MGQ D;  2PYO C;  5DNN A;  2RIQ A;  5DNM B;  3AZH C;  3X1U A;  3C1C A;  4X23 D;  3MGS C;  3AZI D;  3AZF C;  1B6W A;  5B24 C;  4WU8 C;  5JRG B;  2F2A C;  3KWQ A;  2Y2K A;  4H9Q B;  5BNV A;  1KX3 B;  5G49 A;  3MNN B;  3KUY D;  3MGR A;  3LZ0 A;  2BYM B;  4J8U B;  1KU5 A;  5AVC C;  3MVD C;  3C1B A;  3AZJ A;  1Q9C A;  3X1V A;  4YS3 B;  5C3I C;  4JJN D;  5B1L D;  5B40 D;  2HIO D;  5E5A A;  4YM6 A;  1KX5 C;  5AV6 C;  3UT9 B;  5AY8 D;  4EO5 B;  5GSU B;  2BG1 A;  4DQY B;  3AZF D;  3AV1 C;  3WA9 D;  3W99 D;  4WU8 D;  2XD5 A;  4R8P A;  3TU4 B;  1P3G B;  5CHL B;  5GT3 C;  3AYW B;  5AV5 C;  1KX4 B;  2YFW B;  3X1V B;  3WTP B;  3AZL C;  5B33 B;  3REH C;  3EG5 B;  1M1A B;  1EQZ D;  4Z5T C;  3LJA C;  3W96 C;  2F8N B;  4CSR B;  5B2J D;  4J8X B;  5CPJ A;  5BNX B;  3AFA A;  1P3L D;  3AN2 D;  5AV8 B;  5GT0 B;  1TZY B;  4R8P B;  4J8W C;  5CPK C;  2JCH A;  5JA4 A;  3X1U C;  3LEL A;  3AZK A;  5GT3 D;  3O62 A;  3REL C;  5AVB A;  1P3K A;  5FUG B;  3X1S B;  3WKJ C;  1S32 D;  1H3O A;  4H9P B;  3AZG C;  2HUE B;  4WU9 D;  4XUJ A;  1M19 A;  4XZQ D;  4LD9 A;  3AZL D;  5CP6 D;  2NZD A;  3REK D;  5CPI A;  5B0Z B;  1P34 C;  2ARO D;  3KXB D;  3LZ1 C;  4KGC B;  3LJA D;  3MGQ B;  2PYO A;  3W96 D;  5AV9 C;  1P3M C;  3AZH A;  4X23 B;  3MGS A;  3V9R B;  2LY8 A;  3UTB A;  5B24 A;  1BH8 A;  2DF4 C;  3A6N D;  1BH9 B;  1P3I D;  2RVQ C;  3NQU A;  3UT9 D;  5DNN D;  5GXQ C;  3X1U D;  1R4V A;  3C1C D;  3A1I A;  5AVC A;  3MVD A;  2F8N G;  1P3K B;  3B6G C;  3AL0 C;  3KFU G;  4JJN B;  3KWQ D;  5B1L B;  5B31 C;  3B6F C;  5B40 B;  2HIO B;  1KX5 A;  5AV6 A;  3MGR D;  2BYK B;  3LZ0 D;  3AZJ D;  5AY8 B;  3X1V D;  3C1B D;  5BO0 B;  1PZR A;  2Y2O A;  3AZF B;  3WA9 B;  3AV1 A;  1P3B C;  3W99 B;  4WU8 B;  4ZBJ B;  1ZLA C;  5E5A D;  4YM6 D;  4G92 B;  5GT3 A;  2Y2I A;  5AV5 A;  2Y2G A;  2Y2P A;  3WAA C;  4UUZ B;  1ID3 C;  1F66 C;  5B2I C;  4HGA B;  4M6B A;  3P5J B;  3A1K A;  3REH A;  2G5I C;  1EQZ B;  4Z5T A;  4KUD C;  5B2J B;  4XUJ C;  1M19 C;  3MGP C;  2NQB C;  1P3L B;  3B0D C;  2FJ7 C;  3AN2 B;  5BT1 D;  4J8W A;  5CPK A;  1P3O C;  5CPJ D;  5GT3 B;  3UTB C;  3AZM C;  4J8V C;  3REL A;  3AFA D;  3WKJ A;  4G91 C;  1S32 B;  3AZG A;  4WU9 B;  2IO5 C;  1F1E A;  3W97 C;  4XZQ B;  3AZL B;  5CP6 B;  5B32 C;  4Z66 C;  3REK B;  1P34 A;  2ARO B;  3KXB B;  2CV5 C;  3REH B;  4NE3 A;  3LEL D;  4ZUX C;  3LZ1 A;  4QLC C;  3LJA B;  3AZK D;  3O62 D;  3W96 B;  5AV9 A;  2CWE A;  2Y2L A;  3NQJ A;  5AVB D;  1P3K D;  1P3M A;  1HQ3 C;  1U35 C;  4NFT A;  2UWX A;  4XUJ D;  1M19 D;  1WWS A;  4LD9 D;  2NZD D;  5CPI D;  3A6N B;  1P3I B;  4Z2M H;  5F99 C;  1M18 C;  1JFI A;  2PYO D;  5DNN B;  2Y2N A;  3AZN C;  5GXQ A;  3X1U B;  3EPJ A;  3C1C B;  3AZH D;  1P3O D;  3MGS D;  3UTB D;  4AWL C;  3B6G A;  5B0Y C;  1B67 A;  5B24 D;  1P3F C;  1P3P C;  3AV2 C;  3KWQ B;  3B6F A;  5B31 A;  5BNV B;  5G49 B;  3W98 C;  4CAY A;  1P3A C;  3MGR B;  3LZ0 B;  3AZJ B;  3MVD D;  5AVC D;  3C1B B;  3F6T A;  2F8N H;  4NE5 A;  1P3B A;  1ZLA A;  5E5A B;  4YM6 B;  2JSS A;  1KX5 D;  5AV6 D;  2Y2Q A;  3X1T C;  3UTA C;  3WAA A;  1ID3 A;  5DNM C;  1F66 A;  5B2I A;  3AV1 D;  2ZM5 A;  3AV2 D;  5JRG C;  2F8N K;  1Z2C B;  5AV5 D;  5KDM A;  4KUD A;  1KX3 C;  3MNN C;  2ZY5 A;  3AZE C;  3MGP A;  3REJ A;  4J8U C;  1TAF A;  3VH6 T;  2NQB A;  2YFV A;  3H0R C;  4WZS B;  4Z2M G;  4WV4 B;  3REH D;  4YS3 C;  2FJ7 A;  1ULY A;  4Z5T D;  3VH5 T;  1P3O A;  5CPJ B;  3B0C T;  3AZM A;  4J8V A;  4KHA A;  3AFA B;  4EO5 C;  5GSU C;  2FFF B;  3W97 A;  3R45 A;  4H9O A;  5B32 A;  4Z66 A;  2J8P A;  2CV5 A;  4J8W D;  5JA4 B;  5CPK D;  3LEL B;  4ZUX A;  3AZK B;  4QLC A;  4H9S A;  4H9N A;  3O62 B;  3TU4 C;  5KDM B;  3AYW C;  3REL D;  5AVB B;  1P3G C;  3WKJ D;  1HQ3 A;  1U35 A;  1H3O B;  3AZG D;  3VH6 A;  4XUJ B;  1M19 B;  3AZE D;  1KX4 C;  4LD9 B;  2Y2M A;  4WNN A;  2YFV B;  3WTP C;  5CPI B;  1P34 D;  2NZD B;  1A7W A;  5B33 C;  2FJ7 B;  5F99 A;  3LZ1 D;  1M18 A;  3VH5 A;  1M1A C;  2PYO B;  5AV9 D;  3AZN A;  1P3M D;  1T3U A;  3AZH B;  1P3O B;  3EPL A;  3MGS B;  3UTB B;  4KHA B;  5B0Y A;  5B24 B;  1BH8 B;  1P3F A;  4H9R A;  1P3P A;  3AV2 A;  2RVQ D;  3NQU B;  3W98 A;  5GXQ D;  5AV8 C;  5GT0 C;  1TZY C;  1P3A A;  4E45 A;  1AOI A;  3MVD B;  5AVC B;  3B6G D;  5C3I B;  3X1S C;  3B0B A;  2HUE C;  3B6F D;  5B31 D;  4DRB A;  1KX5 B;  5AV6 B;  5B0Z C;  2L5A A;  3X1T A;  4KGC C;  1N1J A;  3REJ C;  3MGQ C;  3UTA A;  4WJ3 C;  5DNM A;  1W2E A;  3AZI C;  3AV1 B;  5B0Y B;  1P3B D;  3VH6 W;  1ZLA D;  3AV2 B;  5JRG A;  5AV5 B;  1F66 D;  4H9Q A;  1KX3 A;  3VH5 W;  3MNN A;  3KUY C;  3WAA D;  1ID3 D;  3AZE A;  5B2I D; 
#chains in the Genus database with same CATH homology
 4J8U A;  2BYM A;  3KSY A;  4YS3 A;  4Z5T B;  4H9S C;  4JJN C;  5B1L C;  4KUD D;  2DQN C;  2HIO C;  3MGP D;  2JE5 A;  2ZY3 A;  3REJ D;  5AY8 C;  2NQB D;  5GSU A;  4NE6 A;  3H0L C;  2FJ7 D;  3WA9 C;  4J8W B;  3W99 C;  2ZY2 A;  5CPK B;  4ZBJ C;  3AZM D;  4G92 C;  3TU4 A;  1P3G A;  4J8V D;  3REL B;  3AYW A;  3WKJ B;  1WWI A;  3EPK A;  3AZG B;  3W97 D;  3AZE B;  1KX4 A;  2YFW A;  5BS7 C;  5B32 D;  4Z66 D;  3WTP A;  1P34 B;  4HGA C;  2CV5 D;  5B33 A;  3LZ1 B;  4ZUX D;  4QLC D;  1M1A A;  1AOI C;  5AV9 B;  1EQZ C;  3NQJ B;  1P3M B;  2F8N A;  1HQ3 D;  1U35 D;  4CSR A;  5B2J C;  5B1M C;  4J8X A;  5BNX A;  1P3L C;  3REI C;  4E44 A;  4DRA A;  5F99 D;  1M18 D;  1JFI B;  3AZN D;  3AN2 C;  2VQR A;  5GXQ B;  5AV8 A;  5GT0 A;  1TZY A;  4UPK A;  3B6G B;  5B0Y D;  1P3F D;  5FUG A;  3X1S A;  1S32 C;  1P3P D;  4H9P A;  4WU9 C;  3B6F B;  5B31 B;  4XZQ C;  5CP6 C;  4CAY B;  3W98 D;  3REK C;  1P3A D;  5B0Z A;  2ARO C;  3KXB C;  1AOI D;  4KGC A;  3MGQ A;  5B1M D;  4X23 A;  3AZI A;  3V9R A;  1P3B B;  3H0M C;  1ZLA B;  3REI D;  3A6N C;  1P3I C;  1BH9 A;  3X1T D;  3UT9 C;  3UTA D;  5DNN C;  3KUY A;  3WAA B;  1ID3 B;  5DNM D;  1F66 B;  5B2I B;  3C1C C;  2W8S A;  5JRG D;  4JJN A;  3KWQ C;  1HTA A;  3EPH A;  5B1L A;  4KUD B;  1KX3 D;  5B40 A;  2HIO A;  3MNN D;  1BFM A;  2XD1 A;  3MGP B;  3MGR C;  2BYK A;  3REJ B;  3LZ0 C;  1TAF B;  4J8U D;  5AY8 A;  3X1V C;  3C1B C;  3AZJ C;  2NQB B;  5BO0 A;  4YS3 D;  3B0D B;  3AZI B;  3AZF A;  3WA9 A;  3W99 A;  4WU8 A;  5E5A C;  4YM6 C;  3AZM B;  5B31 G;  4J8X C;  4J8V B;  4G91 B;  3KUY B;  5GSU D;  3W97 B;  2IO5 B;  3R45 B;  4UUZ A;  5BS7 A;  4H9O B;  4Z66 B;  5B32 B;  2CV5 B;  2G5H C;  4ZUX B;  4R8P C;  4QLC B;  4H9N B;  3TU4 D;  1P3G D;  2Y2J A;  3AYW D;  1EQZ A;  1HQ3 B;  1U35 B;  5B2J A;  5B1M A;  1KX4 D;  4WNN B;  2Y2H A;  3WTP D;  5B33 D;  1P3L A;  3REI A;  3WTP E;  5F99 B;  1M18 B;  1M1A D;  3FDD A;  3AZN B;  3AN2 A;  2F8N D;  5BT1 C;  4AWL B;  4X23 C;  4J8X D;  5CPJ C;  3AFA C;  1P3F B;  4H9R B;  1S32 A;  1P3P B;  2ZY4 A;  4WU9 A;  4XZQ A;  3AZL A;  5CP6 A;  3W98 B;  3REK A;  1P3A B;  5AV8 D;  5GT0 D;  2ARO A;  1TZY D;  3B0C W;  4R8P D;  3KXB A;  1AOI B;  3LEL C;  3AZK C;  3LJA A;  3O62 C;  3W96 A;  5AVB C;  3IP4 C;  1P3K C;  5B1M B;  3X1S D;  4LD9 C;  5B40 C;  5CPI C;  2NZD C;  3REI B;  5B0Z D;  3A6N A;  1P3I A;  5B32 G;  3X1T B;  3UT9 A;  1N1J B;  4KGC D;  3UTA B;  3MGQ D;  2PYO C;  5DNN A;  2RIQ A;  5DNM B;  3AZH C;  3X1U A;  3C1C A;  4X23 D;  3MGS C;  3AZI D;  3AZF C;  1B6W A;  5B24 C;  4WU8 C;  5JRG B;  2F2A C;  3KWQ A;  2Y2K A;  4H9Q B;  5BNV A;  1KX3 B;  5G49 A;  3MNN B;  3KUY D;  3MGR A;  3LZ0 A;  2BYM B;  4J8U B;  1KU5 A;  5AVC C;  3MVD C;  3C1B A;  3AZJ A;  1Q9C A;  3X1V A;  4YS3 B;  5C3I C;  4JJN D;  5B1L D;  5B40 D;  2HIO D;  5E5A A;  4YM6 A;  1KX5 C;  5AV6 C;  3UT9 B;  5AY8 D;  4EO5 B;  5GSU B;  2BG1 A;  4DQY B;  3AZF D;  3AV1 C;  3WA9 D;  3W99 D;  4WU8 D;  2XD5 A;  4R8P A;  3TU4 B;  1P3G B;  5CHL B;  5GT3 C;  3AYW B;  5AV5 C;  1KX4 B;  2YFW B;  3X1V B;  3WTP B;  3AZL C;  5B33 B;  3REH C;  3EG5 B;  1M1A B;  1EQZ D;  4Z5T C;  3LJA C;  3W96 C;  2F8N B;  4CSR B;  5B2J D;  4J8X B;  5CPJ A;  5BNX B;  3AFA A;  1P3L D;  3AN2 D;  5AV8 B;  5GT0 B;  1TZY B;  4R8P B;  4J8W C;  5CPK C;  2JCH A;  5JA4 A;  3X1U C;  3LEL A;  3AZK A;  5GT3 D;  3O62 A;  3REL C;  5AVB A;  1P3K A;  5FUG B;  3X1S B;  3WKJ C;  1S32 D;  1H3O A;  4H9P B;  3AZG C;  2HUE B;  4WU9 D;  4XUJ A;  1M19 A;  4XZQ D;  4LD9 A;  3AZL D;  5CP6 D;  2NZD A;  3REK D;  5CPI A;  5B0Z B;  1P34 C;  2ARO D;  3KXB D;  3LZ1 C;  4KGC B;  3LJA D;  3MGQ B;  2PYO A;  3W96 D;  5AV9 C;  1P3M C;  3AZH A;  4X23 B;  3MGS A;  3V9R B;  2LY8 A;  3UTB A;  5B24 A;  1BH8 A;  2DF4 C;  3A6N D;  1BH9 B;  1P3I D;  2RVQ C;  3NQU A;  3UT9 D;  5DNN D;  5GXQ C;  3X1U D;  1R4V A;  3C1C D;  3A1I A;  5AVC A;  3MVD A;  2F8N G;  1P3K B;  3B6G C;  3AL0 C;  3KFU G;  4JJN B;  3KWQ D;  5B1L B;  5B31 C;  3B6F C;  5B40 B;  2HIO B;  1KX5 A;  5AV6 A;  3MGR D;  2BYK B;  3LZ0 D;  3AZJ D;  5AY8 B;  3X1V D;  3C1B D;  5BO0 B;  1PZR A;  2Y2O A;  3AZF B;  3WA9 B;  3AV1 A;  1P3B C;  3W99 B;  4WU8 B;  4ZBJ B;  1ZLA C;  5E5A D;  4YM6 D;  4G92 B;  5GT3 A;  2Y2I A;  5AV5 A;  2Y2G A;  2Y2P A;  3WAA C;  4UUZ B;  1ID3 C;  1F66 C;  5B2I C;  4HGA B;  4M6B A;  3P5J B;  3A1K A;  3REH A;  2G5I C;  1EQZ B;  4Z5T A;  4KUD C;  5B2J B;  4XUJ C;  1M19 C;  3MGP C;  2NQB C;  1P3L B;  3B0D C;  2FJ7 C;  3AN2 B;  5BT1 D;  4J8W A;  5CPK A;  1P3O C;  5CPJ D;  5GT3 B;  3UTB C;  3AZM C;  4J8V C;  3REL A;  3AFA D;  3WKJ A;  4G91 C;  1S32 B;  3AZG A;  4WU9 B;  2IO5 C;  1F1E A;  3W97 C;  4XZQ B;  3AZL B;  5CP6 B;  5B32 C;  4Z66 C;  3REK B;  1P34 A;  2ARO B;  3KXB B;  2CV5 C;  3REH B;  4NE3 A;  3LEL D;  4ZUX C;  3LZ1 A;  4QLC C;  3LJA B;  3AZK D;  3O62 D;  3W96 B;  5AV9 A;  2CWE A;  2Y2L A;  3NQJ A;  5AVB D;  1P3K D;  1P3M A;  1HQ3 C;  1U35 C;  4NFT A;  2UWX A;  4XUJ D;  1M19 D;  1WWS A;  4LD9 D;  2NZD D;  5CPI D;  3A6N B;  1P3I B;  4Z2M H;  5F99 C;  1M18 C;  1JFI A;  2PYO D;  5DNN B;  2Y2N A;  3AZN C;  5GXQ A;  3X1U B;  3EPJ A;  3C1C B;  3AZH D;  1P3O D;  3MGS D;  3UTB D;  4AWL C;  3B6G A;  5B0Y C;  1B67 A;  5B24 D;  1P3F C;  1P3P C;  3AV2 C;  3KWQ B;  3B6F A;  5B31 A;  5BNV B;  5G49 B;  3W98 C;  4CAY A;  1P3A C;  3MGR B;  3LZ0 B;  3AZJ B;  3MVD D;  5AVC D;  3C1B B;  3F6T A;  2F8N H;  4NE5 A;  1P3B A;  1ZLA A;  5E5A B;  4YM6 B;  2JSS A;  1KX5 D;  5AV6 D;  2Y2Q A;  3X1T C;  3UTA C;  3WAA A;  1ID3 A;  5DNM C;  1F66 A;  5B2I A;  3AV1 D;  2ZM5 A;  3AV2 D;  5JRG C;  2F8N K;  1Z2C B;  5AV5 D;  5KDM A;  4KUD A;  1KX3 C;  3MNN C;  2ZY5 A;  3AZE C;  3MGP A;  3REJ A;  4J8U C;  1TAF A;  3VH6 T;  2NQB A;  2YFV A;  3H0R C;  4WZS B;  4Z2M G;  4WV4 B;  3REH D;  4YS3 C;  2FJ7 A;  1ULY A;  4Z5T D;  3VH5 T;  1P3O A;  5CPJ B;  3B0C T;  3AZM A;  4J8V A;  4KHA A;  3AFA B;  4EO5 C;  5GSU C;  2FFF B;  3W97 A;  3R45 A;  4H9O A;  5B32 A;  4Z66 A;  2J8P A;  2CV5 A;  4J8W D;  5JA4 B;  5CPK D;  3LEL B;  4ZUX A;  3AZK B;  4QLC A;  4H9S A;  4H9N A;  3O62 B;  3TU4 C;  5KDM B;  3AYW C;  3REL D;  5AVB B;  1P3G C;  3WKJ D;  1HQ3 A;  1U35 A;  1H3O B;  3AZG D;  3VH6 A;  4XUJ B;  1M19 B;  3AZE D;  1KX4 C;  4LD9 B;  2Y2M A;  4WNN A;  2YFV B;  3WTP C;  5CPI B;  1P34 D;  2NZD B;  1A7W A;  5B33 C;  2FJ7 B;  5F99 A;  3LZ1 D;  1M18 A;  3VH5 A;  1M1A C;  2PYO B;  5AV9 D;  3AZN A;  1P3M D;  1T3U A;  3AZH B;  1P3O B;  3EPL A;  3MGS B;  3UTB B;  4KHA B;  5B0Y A;  5B24 B;  1BH8 B;  1P3F A;  4H9R A;  1P3P A;  3AV2 A;  2RVQ D;  3NQU B;  3W98 A;  5GXQ D;  5AV8 C;  5GT0 C;  1TZY C;  1P3A A;  4E45 A;  1AOI A;  3MVD B;  5AVC B;  3B6G D;  5C3I B;  3X1S C;  3B0B A;  2HUE C;  3B6F D;  5B31 D;  4DRB A;  1KX5 B;  5AV6 B;  5B0Z C;  2L5A A;  3X1T A;  4KGC C;  1N1J A;  3REJ C;  3MGQ C;  3UTA A;  4WJ3 C;  5DNM A;  1W2E A;  3AZI C;  3AV1 B;  5B0Y B;  1P3B D;  3VH6 W;  1ZLA D;  3AV2 B;  5JRG A;  5AV5 B;  1F66 D;  4H9Q A;  1KX3 A;  3VH5 W;  3MNN A;  3KUY C;  3WAA D;  1ID3 D;  3AZE A;  5B2I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...