3AV1C

The human nucleosome structure containing the histone variant h3.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1C00
2HIOB 1HQ3A 4DRBA 3UTBC 5G49B 3AYWB 3W97B 4H9QA 5AVCA 3O62B 3AZHD 4WU8A 2FJ7C 4JJND 5JA4A 3AZGB 1KU5A 1P3OC 2F8NK 3WAAB 3AZKC 5AVBA 2BYKB 5E5AB 4R8PC 3X1UA 5CPKA 4G91B 2IO5B 1ID3D 4AWLB 2AROC 5B32D 5CPIC 5DNMB 1S32B 3AZJB 4J8UB 1P3BB 5B32A 5CPJD 5B40B 4G92C 1P3FA 5B1LD 3KUYC 5B1MC 5AV9D 4HGAC 4YM6C 5CPJA 4YS3B 3UTAA 3KWQD 3X1SA 2BYMA 3REJC 3AZHB 4JJNB 4H9OB 3WKJC 3MGSC 4Z2MG 5B33D 5BT1D 4NE3A 3AZFD 3KXBA 1P34C 3LJAC 1P3PD 1ID3B 5GT0C 3LELA 1P3PA 5B24A 4Z66C 5GT3A 5F99C 1TZYC 5B1LB 1M18C 1ZLAA 5AV9B 1P3GD 1AOIC 1P3LD 4QLCC 3KWQB 5B2JD 3AV2A 1P3GA 1H3OB 5JRGD 2YFVA 4CAYA 1P3MC 5B33B 5B0ZD 3MVDD 1KX3C 3B6GA 3AZFB 2NQBA 4XUJD 1P3KC 1JFIB 1EQZD 4X23D 2CWEA 3X1VC 3WA9D 1EQZA 5GXQA 5B1MB 1KX4A 4HGAB 4YM6B 3AZMD 3AN2C 1P3ID 3AV1C 4KUDC 2CV5A 3C1CA 1P3IA 3AZMA 3B6FA 2HUEB 3AFAB 1P3LB 1BH9A 5B2JB 3VH6A 3REID 4KHAB 5JRGB 3MGQA 4KGCD 5B0YC 3REIA 1R4VA 3LZ1C 5B31A 5B0ZB 3MVDB 4J8WD 3TU4C 3W99B 1TAFA 3LZ0D 5BO0B 3UT9A 4M6BA 3AZEA 4KGCA 4UUZB 4XUJB 1EQZB 3LZ0A 5AY8A 4E45A 1Q9CA 1F66C 4X23B 3WA9B 4XZQA 4Z5TC 5DNNA 3AZMB 4H9PA 3REHC 4QLCB 5AV5D 3WTPA 3A6NC 5AV5A 1KX5A 3AZIA 1ULYA 3MNNA 5AV8A 2HIOD 3W96A 4J8WB 1A7WA 2HIOA 2PYOC 4ZUXC 5G49A 3AYWA 3V9RB 3REKC 5B2ID 3O62A 3MGRC 4J8VC 5E5AD 3AZGA 2F8NH 4WU9C 2BYKA 5E5AA 4NFTA 4H9NB 5B0YB 3C1BD 3X1TC 3LZ1B 1M1AC 5C3IC 3TU4B 1B67A 4WNNB 4J8UD 5DNMA 1S32A 3AZJA 5B40D 4J8UA 3NQUB 3MGPD 1P3BA 2NZDC 5B40A 4YS3D 3RELC 5AVCC 4WU8C 5B2IB 1BH8B 4J8XB 3AZNC 1WWIA 4YS3A 3W98C 3AZHA 5AVBC 1U35D 4JJNA 4H9OA 1P3AD 3X1UC 5CPKC 1M19D 3R45B 2RVQD 3C1BB 3B0BA 3UTBD 1ID3A 5CP6C 3AZLB 1P3FC 3MGPB 1P3OD 3UTAC 4ZBJC 3AZKD 4CSRB 3X1SC 5B1LA 5AV9A 5AV6C 4R8PD 3KWQA 1U35B 1H3OA 3KXBC 1P3AB 2AROD 5CPID 1M19B 5B33A 5BT1C 3AZFA 2AROA 3LELC 1JFIA 3UTBB 5B24C 3KUYD 5B1MD 5GT3C 4YM6D 5B1MA 3REJD 4YM6A 3AZNB 1F1EA 1ZLAC 2FJ7B 1P3OB 3W98B 3AFAD 3WKJD 3MGSD 3AZKB 3AV2C 5GSUC 3AFAA 1P34D 1P3LA 4R8PB 3LJAD 5B2JA 4EO5C 3W99D 3B6GC 4KHAA 5JRGA 2NQBC 5GT0D 2AROB 5CPIB 5B0ZA 3MVDA 3W99A 4Z66D 5BO0A 5F99D 4UUZA 4XUJA 5GXQC 1TZYD 4G92B 3KUYB 1KX4C 1M18D 4X23A 1HTAA 1AOID 2CV5C 3C1CC 3WA9A 4QLCD 3WTPE 3B0DC 3B6FC 3REJB 3VH6T 3WKJB 4QLCA 1P3MD 3MGSB 1KX3D 3MGQC 1P34B 3LJAB 1P3KD 5B31C 1KX3A 3AZEC 3UT9C 4KGCC 5GT0B 3X1VD 4J8WA 4Z66B 5AY8C 5F99B 4KUDD 3AN2D 3AV1D 3VH5W 4XZQC 1TZYB 5DNNC 3V9RA 1M18B 1AOIB 5GSUB 3WTPC 3VH5A 5AV5C 1P3MB 5B0YD 1KX5C 3LZ1D 3TU4D 1KX3B 3AZIC 4H9NA 5B0YA 3MNNC 3LZ1A 5KDMA 5AV8C 1P3KB 3W96C 3TU4A 4WNNA 1F66D 2HIOC 3X1VB 4LD9C 4Z5TD 3AYWC 3NQUA 1B6WA 3W97C 4KUDB 3AN2B 3AV1B 4J8XD 3REHD 3O62C 3NQJB 1BH8A 5B2IA 3A6ND 4J8XA 3AZGC 3WAAC 5BS7A 5KDMB 3R45A 4G91C 2IO5C 4AWLC 5DNMC 3C1BA 1S32C 2PYOD 3AZJC 4ZUXD 1HQ3C 3AZLD 4J8UC 1P3BC 3REKD 4Z2MH 1F66B 5B40C 3AZLA 4Z5TB 2L5AA 3B0CW 3MGRD 3MGPA 4J8VD 4YS3C 3REHB 4WU9D 4CSRA 3AZHC 1N1JB 3A6NB 4H9SA 5B31G 4JJNC 3X1TD 1M1AD 4WZSB 1U35A 3X1TA 1BFMA 5CHLB 1P3AA 4NE5A 1M19A 1ID3C 2NZDD 5B32C 2PYOB 4LD9B 4ZUXB 3UTBA 3RELD 2F8NB 5AVCD 2NZDA 4WU8D 3REKB 2FJ7D 3AZND 5CPJC 3W98D 3RELA 5B1LC 2YFWB 5AVBD 3MGRB 5AV9C 3AZNA 2FJ7A 4J8VB 1P3OA 3W98A 3X1UD 5CPKD 3KWQC 3AZKA 4WU9B 5FUGB 4R8PA 3X1TB 1M1AB 5B33C 5C3IB 5BNVB 4H9RB 3AZFC 5CPIA 1HQ3B 5CP6D 2F8NG 1P3PC 1P3FD 4DRAA 2NZDB 4H9QB 5CP6A 3UTAD 3X1SD 3KUYA 3RELB 5AVCB 4WU8B 5JA4B 5AV6D 4NE6A 2HUEC 5AVBB 3REJA 1P3GC 3AFAC 3KXBD 5AV6A 1P3LC 3WKJA 3X1UB 5CPKB 3MGSA 5B2JC 5JRGC 1P34A 3LJAA 3LELD 5B0ZC 3MVDC 3W99C 5B24D 5GT3D 5B32B 5GT0A 4XUJC 5CP6B 1EQZC 4Z66A 1P3FB 5F99A 1ZLAD 4X23C 5CPJB 3WA9C 3UTAB 4ZBJB 1TZYA 3X1SB 3AV2D 1M18A 2BYMB 1P3IC 3AZMC 5GSUD 1AOIA 5AV6B 1WWSA 5GSUA 3B6GD 3KXBB 2NQBD 1P3MA 3REIC 5B32G 3LELB 1P3KA 5GXQD 1P3PB 4J8WC 5B24B 2JSSA 3LZ0C 1KX4D 5GT3B 3X1VA 3C1CD 2CV5D 3VH6W 3B6FD 1ZLAB 4KUDA 3AN2A 3AV1A 3VH5T 3AV2B 1P3GB 3NQJA 3MGQD 2YFVB 4CAYB 3KSYA 5B31D 4EO5B 3AZED 3UT9D 3B6GB 2NQBB 5BNXA 5AY8D 5GXQB 4XZQD 5DNND 1KX4B 1F66A 2CV5B 3C1CB 4Z5TA 1P3IB 3B0DB 3B6FB 3WTPD 5B2IC 4J8XC 3REHA 1KX5D 1BH9B 5BS7C 3AZID 1N1JA 3A6NA 5E5AC 3MGQB 3MNND 3REIB 5BNXB 5AV8D 5B31B 3W96D 1TAFB 3AZEB 3UT9B 4KGCB 3C1BC 4LD9D 3LZ0B 5AY8B 3AYWD 2F8ND 3W97D 2PYOA 4LD9A 4XZQB 4ZUXA 3AZLC 2LY8A 2F8NA 3W97A 5DNNB 3O62D 3MGPC 3REKA 4H9PB 3AZGD 3WAAD 4WV4B 4E44A 2YFWA 3MGRA 3WTPB 4J8VA 3B0CT 4H9SC 3WAAA 5AV5B 1KX5B 4WU9A 5FUGA 3AZIB 1U35C 1P3AC 5DNMD 3MNNB 1S32D 1M19C 5AV8B 3AZJD 1M1AA 3W96B 5BNVA 1HQ3D 2RVQC 4H9RA 1P3BD
chains in the Genus database with same CATH superfamily
2HIOB 1HQ3A 4DRBA 3UTBC 5G49B 3AYWB 3W97B 4H9QA 2BG1A 5AVCA 3O62B 2ZY4A 4WU8A 3AZHD 2FJ7C 4JJND 5JA4A 3AZGB 1KU5A 1P3OC 2F8NK 3WAAB 3AZKC 5AVBA 2BYKB 5E5AB 4R8PC 3X1UA 5CPKA 4G91B 2IO5B 1ID3D 4AWLB 2AROC 5B32D 5CPIC 5DNMB 1S32B 3AZJB 2J8PA 1W2EA 4J8UB 1P3BB 5B32A 2G5IC 5CPJD 5B40B 4G92C 1P3FA 5B1LD 3KUYC 5B1MC 5AV9D 4HGAC 4YM6C 5CPJA 4YS3B 3UTAA 3KWQD 3X1SA 2BYMA 3REJC 3AZHB 4JJNB 4H9OB 3WKJC 3MGSC 4Z2MG 5B33D 2DF4C 4NE3A 5BT1D 3AZFD 3KXBA 1P34C 3LJAC 1P3PD 1ID3B 5GT0C 3LELA 1P3PA 5B24A 4Z66C 5GT3A 5F99C 1TZYC 5B1LB 1M18C 1ZLAA 5AV9B 1P3GD 1AOIC 1P3LD 4QLCC 3KWQB 5B2JD 3AV2A 1P3GA 1H3OB 5JRGD 2YFVA 4CAYA 1P3MC 5B33B 5B0ZD 3MVDD 1KX3C 3B6GA 3AZFB 2NQBA 4XUJD 1P3KC 1JFIB 1EQZD 4X23D 2CWEA 3X1VC 3WA9D 1EQZA 5GXQA 5B1MB 1KX4A 4HGAB 4YM6B 3AZMD 3AN2C 1P3ID 3AV1C 4KUDC 2CV5A 3C1CA 3H0LC 1P3IA 3AZMA 3B6FA 2HUEB 2Y2KA 3AFAB 1P3LB 1BH9A 5B2JB 3VH6A 3REID 4KHAB 5JRGB 3MGQA 4KGCD 5B0YC 3REIA 1R4VA 2XD1A 5B31A 5B0ZB 3LZ1C 3MVDB 4J8WD 3TU4C 3W99B 1TAFA 3LZ0D 5BO0B 3UT9A 4M6BA 3AZEA 4KGCA 4UUZB 4XUJB 1EQZB 2Y2IA 3LZ0A 5AY8A 4E45A 1Q9CA 1F66C 4X23B 2JCHA 3WA9B 4XZQA 2RIQA 2F2AC 4Z5TC 5DNNA 3AZMB 4H9PA 3REHC 4QLCB 5AV5D 3WTPA 3A6NC 5AV5A 1KX5A 2Y2GA 3AZIA 1ULYA 3MNNA 5AV8A 2HIOD 3W96A 4J8WB 1A7WA 3EPKA 2HIOA 2PYOC 4ZUXC 5G49A 3AYWA 3V9RB 3REKC 5B2ID 3O62A 3MGRC 4J8VC 5E5AD 3AZGA 2F8NH 4WU9C 2BYKA 5E5AA 4NFTA 4H9NB 5B0YB 3C1BD 3X1TC 3LZ1B 1M1AC 2Y2NA 5C3IC 3TU4B 1B67A 4WNNB 4J8UD 5DNMA 1S32A 3AZJA 5B40D 4J8UA 3NQUB 3MGPD 1P3BA 2NZDC 5B40A 4YS3D 3RELC 5AVCC 4WU8C 5B2IB 1BH8B 4J8XB 3AZNC 1WWIA 4YS3A 3W98C 3AZHA 5AVBC 1U35D 4JJNA 4H9OA 1P3AD 3X1UC 5CPKC 1M19D 3R45B 2RVQD 3C1BB 3B0BA 3UTBD 1ID3A 2DQNC 5CP6C 3AZLB 1P3FC 3MGPB 1P3OD 3UTAC 4ZBJC 3AZKD 4CSRB 3X1SC 5B1LA 2UWXA 5AV9A 5AV6C 4R8PD 3KWQA 1U35B 1H3OA 3KXBC 1P3AB 2AROD 5CPID 1M19B 5B33A 5BT1C 3AZFA 2AROA 3LELC 1JFIA 3UTBB 5B24C 3KUYD 5B1MD 5GT3C 4YM6D 5B1MA 3F6TA 3REJD 4YM6A 3AZNB 1F1EA 1ZLAC 2FJ7B 1P3OB 3W98B 3AFAD 3WKJD 3H0RC 3MGSD 3AZKB 3AV2C 5GSUC 3AFAA 1P34D 1Z2CB 1P3LA 4R8PB 3LJAD 5B2JA 2JE5A 4EO5C 3W99D 3B6GC 4KHAA 5JRGA 2NQBC 5GT0D 2AROB 5CPIB 5B0ZA 3MVDA 3W99A 4Z66D 5BO0A 5F99D 4UUZA 4XUJA 5GXQC 1TZYD 4G92B 3KUYB 1KX4C 1M18D 2G5HC 4X23A 1HTAA 1AOID 2CV5C 3C1CC 3WA9A 4QLCD 3WTPE 2Y2QA 3B0DC 3B6FC 3REJB 3VH6T 3WKJB 4QLCA 1P3MD 3MGSB 1KX3D 3MGQC 1P34B 3LJAB 1P3KD 5B31C 1KX3A 3AZEC 3UT9C 2Y2OA 4KGCC 5GT0B 3X1VD 2Y2MA 4J8WA 4Z66B 5AY8C 5F99B 4KUDD 3AN2D 3AV1D 3VH5W 4XZQC 2Y2LA 1TZYB 5DNNC 3V9RA 2VQRA 1M18B 1AOIB 3KFUG 5GSUB 3WTPC 3VH5A 5AV5C 1P3MB 5B0YD 1KX5C 3LZ1D 3TU4D 1KX3B 3AZIC 4H9NA 5B0YA 3MNNC 3LZ1A 5KDMA 5AV8C 1P3KB 3W96C 3TU4A 4WNNA 1F66D 2HIOC 3X1VB 4LD9C 4Z5TD 3AYWC 3NQUA 1B6WA 3W97C 4KUDB 3AN2B 3AV1B 4J8XD 3REHD 1PZRA 3O62C 3NQJB 1BH8A 5B2IA 3A6ND 4J8XA 3AZGC 3WAAC 2FFFB 5BS7A 5KDMB 3R45A 4G91C 2IO5C 4AWLC 5DNMC 3C1BA 1S32C 2PYOD 3AZJC 4ZUXD 1HQ3C 3AZLD 3H0MC 4J8UC 1P3BC 3REKD 4Z2MH 1F66B 4WJ3C 5B40C 2ZY3A 3AZLA 4Z5TB 2L5AA 3B0CW 3MGRD 3MGPA 4J8VD 4YS3C 3REHB 4WU9D 4CSRA 3AZHC 1N1JB 3A6NB 4H9SA 5B31G 4JJNC 3X1TD 1M1AD 4WZSB 1U35A 3X1TA 1BFMA 5CHLB 1P3AA 4NE5A 1M19A 1ID3C 2NZDD 5B32C 3EPLA 2PYOB 4LD9B 4ZUXB 3UTBA 3RELD 2F8NB 5AVCD 2NZDA 4WU8D 3REKB 2FJ7D 3AZND 5CPJC 3W98D 3RELA 5B1LC 2YFWB 5AVBD 3MGRB 5AV9C 3AZNA 2FJ7A 4J8VB 1P3OA 3W98A 2W8SA 3X1UD 5CPKD 3KWQC 3AZKA 4WU9B 5FUGB 4R8PA 3X1TB 1M1AB 5B33C 5C3IB 5BNVB 4H9RB 3AZFC 5CPIA 1HQ3B 5CP6D 2F8NG 1P3PC 1P3FD 4DRAA 2NZDB 4H9QB 3AL0C 5CP6A 3UTAD 2Y2PA 3X1SD 3KUYA 3RELB 5AVCB 4WU8B 3EG5B 5JA4B 5AV6D 4NE6A 2HUEC 5AVBB 3REJA 1P3GC 3AFAC 3KXBD 5AV6A 1P3LC 3WKJA 1P3BD 3X1UB 5CPKB 3MGSA 5B2JC 5JRGC 1P34A 3LJAA 3LELD 3EPHA 5B0ZC 3MVDC 3W99C 5B24D 5GT3D 5B32B 5GT0A 4XUJC 5CP6B 1EQZC 4Z66A 1P3FB 5F99A 1ZLAD 4X23C 5CPJB 3WA9C 3UTAB 4ZBJB 1TZYA 3X1SB 3AV2D 1M18A 2BYMB 1P3IC 3AZMC 5GSUD 1AOIA 5AV6B 2ZY5A 1WWSA 5GSUA 3B6GD 3KXBB 2NQBD 1P3MA 3REIC 3FDDA 5B32G 3LELB 1P3KA 5GXQD 1P3PB 3EPJA 4J8WC 5B24B 2JSSA 3LZ0C 1KX4D 5GT3B 3X1VA 3C1CD 2Y2JA 2CV5D 3VH6W 3B6FD 1ZLAB 4KUDA 3AN2A 3AV1A 3VH5T 3AV2B 4UPKA 1P3GB 3NQJA 3MGQD 2YFVB 4CAYB 3KSYA 5B31D 4EO5B 3AZED 3UT9D 3B6GB 2NQBB 2Y2HA 5BNXA 5AY8D 5GXQB 4XZQD 5DNND 1KX4B 1F66A 2CV5B 3C1CB 4Z5TA 1P3IB 3B0DB 3B6FB 3WTPD 5B2IC 4J8XC 3REHA 1KX5D 1BH9B 5BS7C 4DQYB 3AZID 1N1JA 3A6NA 5E5AC 3MGQB 2ZM5A 3MNND 3REIB 5BNXB 5AV8D 5B31B 3W96D 1TAFB 3AZEB 3UT9B 1T3UA 4KGCB 3C1BC 4LD9D 3LZ0B 5AY8B 3AYWD 2F8ND 3W97D 2PYOA 4LD9A 2XD5A 4ZUXA 3A1IA 4XZQB 3AZLC 2LY8A 2F8NA 3W97A 5DNNB 3O62D 3MGPC 3REKA 4H9PB 3AZGD 3WAAD 4WV4B 4E44A 2YFWA 3MGRA 3WTPB 4J8VA 3B0CT 4H9SC 3WAAA 5AV5B 3A1KA 1KX5B 4WU9A 5FUGA 3AZIB 1U35C 3IP4C 3P5JB 1P3AC 5DNMD 3MNNB 1S32D 1M19C 5AV8B 3AZJD 1M1AA 3W96B 5BNVA 1HQ3D 2RVQC 4H9RA 2ZY2A
chains in the Genus database with same CATH topology
2HIOB 1HQ3A 4DRBA 3UTBC 5G49B 3AYWB 3W97B 4H9QA 2BG1A 5AVCA 3O62B 2ZY4A 4WU8A 3AZHD 2FJ7C 4JJND 5JA4A 3AZGB 1KU5A 1P3OC 2F8NK 3WAAB 3AZKC 5AVBA 2BYKB 5E5AB 4R8PC 3X1UA 5CPKA 4G91B 2IO5B 1ID3D 4AWLB 2AROC 5B32D 5CPIC 5DNMB 1S32B 3AZJB 2J8PA 1W2EA 4J8UB 1P3BB 5B32A 2G5IC 5CPJD 5B40B 4G92C 1P3FA 5B1LD 3KUYC 5B1MC 5AV9D 4HGAC 4YM6C 5CPJA 4YS3B 3UTAA 3KWQD 3X1SA 2BYMA 3REJC 3AZHB 4JJNB 4H9OB 3WKJC 3MGSC 4Z2MG 5B33D 2DF4C 4NE3A 5BT1D 3AZFD 3KXBA 1P34C 3LJAC 1P3PD 1ID3B 5GT0C 3LELA 1P3PA 5B24A 4Z66C 5GT3A 5F99C 1TZYC 5B1LB 1M18C 1ZLAA 5AV9B 1P3GD 1AOIC 1P3LD 4QLCC 3KWQB 5B2JD 3AV2A 1P3GA 1H3OB 5JRGD 2YFVA 4CAYA 1P3MC 5B33B 5B0ZD 3MVDD 1KX3C 3B6GA 3AZFB 2NQBA 4XUJD 1P3KC 1JFIB 1EQZD 4X23D 2CWEA 3X1VC 3WA9D 1EQZA 5GXQA 5B1MB 1KX4A 4HGAB 4YM6B 3AZMD 3AN2C 1P3ID 3AV1C 4KUDC 2CV5A 3C1CA 3H0LC 1P3IA 3AZMA 3B6FA 2HUEB 2Y2KA 3AFAB 1P3LB 1BH9A 5B2JB 3VH6A 3REID 4KHAB 5JRGB 3MGQA 4KGCD 5B0YC 3REIA 1R4VA 2XD1A 5B31A 5B0ZB 3LZ1C 3MVDB 4J8WD 3TU4C 3W99B 1TAFA 3LZ0D 5BO0B 3UT9A 4M6BA 3AZEA 4KGCA 4UUZB 4XUJB 1EQZB 2Y2IA 3LZ0A 5AY8A 4E45A 1Q9CA 1F66C 4X23B 2JCHA 3WA9B 4XZQA 2RIQA 2F2AC 4Z5TC 5DNNA 3AZMB 4H9PA 3REHC 4QLCB 5AV5D 3WTPA 3A6NC 5AV5A 1KX5A 2Y2GA 3AZIA 1ULYA 3MNNA 5AV8A 2HIOD 3W96A 4J8WB 1A7WA 3EPKA 2HIOA 2PYOC 4ZUXC 5G49A 3AYWA 3V9RB 3REKC 5B2ID 3O62A 3MGRC 4J8VC 5E5AD 3AZGA 2F8NH 4WU9C 2BYKA 5E5AA 4NFTA 4H9NB 5B0YB 3C1BD 3X1TC 3LZ1B 1M1AC 2Y2NA 5C3IC 3TU4B 1B67A 4WNNB 4J8UD 5DNMA 1S32A 3AZJA 5B40D 4J8UA 3NQUB 3MGPD 1P3BA 2NZDC 5B40A 4YS3D 3RELC 5AVCC 4WU8C 5B2IB 1BH8B 4J8XB 3AZNC 1WWIA 4YS3A 3W98C 3AZHA 5AVBC 1U35D 4JJNA 4H9OA 1P3AD 3X1UC 5CPKC 1M19D 3R45B 2RVQD 3C1BB 3B0BA 3UTBD 1ID3A 2DQNC 5CP6C 3AZLB 1P3FC 3MGPB 1P3OD 3UTAC 4ZBJC 3AZKD 4CSRB 3X1SC 5B1LA 2UWXA 5AV9A 5AV6C 4R8PD 3KWQA 1U35B 1H3OA 3KXBC 1P3AB 2AROD 5CPID 1M19B 5B33A 5BT1C 3AZFA 2AROA 3LELC 1JFIA 3UTBB 5B24C 3KUYD 5B1MD 5GT3C 4YM6D 5B1MA 3F6TA 3REJD 4YM6A 3AZNB 1F1EA 1ZLAC 2FJ7B 1P3OB 3W98B 3AFAD 3WKJD 3H0RC 3MGSD 3AZKB 3AV2C 5GSUC 3AFAA 1P34D 1Z2CB 1P3LA 4R8PB 3LJAD 5B2JA 2JE5A 4EO5C 3W99D 3B6GC 4KHAA 5JRGA 2NQBC 5GT0D 2AROB 5CPIB 5B0ZA 3MVDA 3W99A 4Z66D 5BO0A 5F99D 4UUZA 4XUJA 5GXQC 1TZYD 4G92B 3KUYB 1KX4C 1M18D 2G5HC 4X23A 1HTAA 1AOID 2CV5C 3C1CC 3WA9A 4QLCD 3WTPE 2Y2QA 3B0DC 3B6FC 3REJB 3VH6T 3WKJB 4QLCA 1P3MD 3MGSB 1KX3D 3MGQC 1P34B 3LJAB 1P3KD 5B31C 1KX3A 3AZEC 3UT9C 2Y2OA 4KGCC 5GT0B 3X1VD 2Y2MA 4J8WA 4Z66B 5AY8C 5F99B 4KUDD 3AN2D 3AV1D 3VH5W 4XZQC 2Y2LA 1TZYB 5DNNC 3V9RA 2VQRA 1M18B 1AOIB 3KFUG 5GSUB 3WTPC 3VH5A 5AV5C 1P3MB 5B0YD 1KX5C 3LZ1D 3TU4D 1KX3B 3AZIC 4H9NA 5B0YA 3MNNC 3LZ1A 5KDMA 5AV8C 1P3KB 3W96C 3TU4A 4WNNA 1F66D 2HIOC 3X1VB 4LD9C 4Z5TD 3AYWC 3NQUA 1B6WA 3W97C 4KUDB 3AN2B 3AV1B 4J8XD 3REHD 1PZRA 3O62C 3NQJB 1BH8A 5B2IA 3A6ND 4J8XA 3AZGC 3WAAC 2FFFB 5BS7A 5KDMB 3R45A 4G91C 2IO5C 4AWLC 5DNMC 3C1BA 1S32C 2PYOD 3AZJC 4ZUXD 1HQ3C 3AZLD 3H0MC 4J8UC 1P3BC 3REKD 4Z2MH 1F66B 4WJ3C 5B40C 2ZY3A 3AZLA 4Z5TB 2L5AA 3B0CW 3MGRD 3MGPA 4J8VD 4YS3C 3REHB 4WU9D 4CSRA 3AZHC 1N1JB 3A6NB 4H9SA 5B31G 4JJNC 3X1TD 1M1AD 4WZSB 1U35A 3X1TA 1BFMA 5CHLB 1P3AA 4NE5A 1M19A 1ID3C 2NZDD 5B32C 3EPLA 2PYOB 4LD9B 4ZUXB 3UTBA 3RELD 2F8NB 5AVCD 2NZDA 4WU8D 3REKB 2FJ7D 3AZND 5CPJC 3W98D 3RELA 5B1LC 2YFWB 5AVBD 3MGRB 5AV9C 3AZNA 2FJ7A 4J8VB 1P3OA 3W98A 2W8SA 3X1UD 5CPKD 3KWQC 3AZKA 4WU9B 5FUGB 4R8PA 3X1TB 1M1AB 5B33C 5C3IB 5BNVB 4H9RB 3AZFC 5CPIA 1HQ3B 5CP6D 2F8NG 1P3PC 1P3FD 4DRAA 2NZDB 4H9QB 3AL0C 5CP6A 3UTAD 2Y2PA 3X1SD 3KUYA 3RELB 5AVCB 4WU8B 3EG5B 5JA4B 5AV6D 4NE6A 2HUEC 5AVBB 3REJA 1P3GC 3AFAC 3KXBD 5AV6A 1P3LC 3WKJA 1P3BD 3X1UB 5CPKB 3MGSA 5B2JC 5JRGC 1P34A 3LJAA 3LELD 3EPHA 5B0ZC 3MVDC 3W99C 5B24D 5GT3D 5B32B 5GT0A 4XUJC 5CP6B 1EQZC 4Z66A 1P3FB 5F99A 1ZLAD 4X23C 5CPJB 3WA9C 3UTAB 4ZBJB 1TZYA 3X1SB 3AV2D 1M18A 2BYMB 1P3IC 3AZMC 5GSUD 1AOIA 5AV6B 2ZY5A 1WWSA 5GSUA 3B6GD 3KXBB 2NQBD 1P3MA 3REIC 3FDDA 5B32G 3LELB 1P3KA 5GXQD 1P3PB 3EPJA 4J8WC 5B24B 2JSSA 3LZ0C 1KX4D 5GT3B 3X1VA 3C1CD 2Y2JA 2CV5D 3VH6W 3B6FD 1ZLAB 4KUDA 3AN2A 3AV1A 3VH5T 3AV2B 4UPKA 1P3GB 3NQJA 3MGQD 2YFVB 4CAYB 3KSYA 5B31D 4EO5B 3AZED 3UT9D 3B6GB 2NQBB 2Y2HA 5BNXA 5AY8D 5GXQB 4XZQD 5DNND 1KX4B 1F66A 2CV5B 3C1CB 4Z5TA 1P3IB 3B0DB 3B6FB 3WTPD 5B2IC 4J8XC 3REHA 1KX5D 1BH9B 5BS7C 4DQYB 3AZID 1N1JA 3A6NA 5E5AC 3MGQB 2ZM5A 3MNND 3REIB 5BNXB 5AV8D 5B31B 3W96D 1TAFB 3AZEB 3UT9B 1T3UA 4KGCB 3C1BC 4LD9D 3LZ0B 5AY8B 3AYWD 2F8ND 3W97D 2PYOA 4LD9A 2XD5A 4ZUXA 3A1IA 4XZQB 3AZLC 2LY8A 2F8NA 3W97A 5DNNB 3O62D 3MGPC 3REKA 4H9PB 3AZGD 3WAAD 4WV4B 4E44A 2YFWA 3MGRA 3WTPB 4J8VA 3B0CT 4H9SC 3WAAA 5AV5B 3A1KA 1KX5B 4WU9A 5FUGA 3AZIB 1U35C 3IP4C 3P5JB 1P3AC 5DNMD 3MNNB 1S32D 1M19C 5AV8B 3AZJD 1M1AA 3W96B 5BNVA 1HQ3D 2RVQC 4H9RA 2ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO B;  1HQ3 A;  4DRB A;  3UTB C;  5G49 B;  3AYW B;  3W97 B;  4H9Q A;  5AVC A;  3O62 B;  3AZH D;  4WU8 A;  2FJ7 C;  4JJN D;  5JA4 A;  3AZG B;  1KU5 A;  1P3O C;  2F8N K;  3WAA B;  3AZK C;  5AVB A;  2BYK B;  5E5A B;  4R8P C;  3X1U A;  5CPK A;  4G91 B;  2IO5 B;  1ID3 D;  4AWL B;  2ARO C;  5B32 D;  5CPI C;  5DNM B;  1S32 B;  3AZJ B;  4J8U B;  1P3B B;  5B32 A;  5CPJ D;  5B40 B;  4G92 C;  1P3F A;  5B1L D;  3KUY C;  5B1M C;  5AV9 D;  4HGA C;  4YM6 C;  5CPJ A;  4YS3 B;  3UTA A;  3KWQ D;  3X1S A;  2BYM A;  3REJ C;  3AZH B;  4JJN B;  4H9O B;  3WKJ C;  3MGS C;  4Z2M G;  5B33 D;  5BT1 D;  4NE3 A;  3AZF D;  3KXB A;  1P34 C;  3LJA C;  1P3P D;  1ID3 B;  5GT0 C;  3LEL A;  1P3P A;  5B24 A;  4Z66 C;  5GT3 A;  5F99 C;  1TZY C;  5B1L B;  1M18 C;  1ZLA A;  5AV9 B;  1P3G D;  1AOI C;  1P3L D;  4QLC C;  3KWQ B;  5B2J D;  3AV2 A;  1P3G A;  1H3O B;  5JRG D;  2YFV A;  4CAY A;  1P3M C;  5B33 B;  5B0Z D;  3MVD D;  1KX3 C;  3B6G A;  3AZF B;  2NQB A;  4XUJ D;  1P3K C;  1JFI B;  1EQZ D;  4X23 D;  2CWE A;  3X1V C;  3WA9 D;  1EQZ A;  5GXQ A;  5B1M B;  1KX4 A;  4HGA B;  4YM6 B;  3AZM D;  3AN2 C;  1P3I D;  3AV1 C;  4KUD C;  2CV5 A;  3C1C A;  1P3I A;  3AZM A;  3B6F A;  2HUE B;  3AFA B;  1P3L B;  1BH9 A;  5B2J B;  3VH6 A;  3REI D;  4KHA B;  5JRG B;  3MGQ A;  4KGC D;  5B0Y C;  3REI A;  1R4V A;  3LZ1 C;  5B31 A;  5B0Z B;  3MVD B;  4J8W D;  3TU4 C;  3W99 B;  1TAF A;  3LZ0 D;  5BO0 B;  3UT9 A;  4M6B A;  3AZE A;  4KGC A;  4UUZ B;  4XUJ B;  1EQZ B;  3LZ0 A;  5AY8 A;  4E45 A;  1Q9C A;  1F66 C;  4X23 B;  3WA9 B;  4XZQ A;  4Z5T C;  5DNN A;  3AZM B;  4H9P A;  3REH C;  4QLC B;  5AV5 D;  3WTP A;  3A6N C;  5AV5 A;  1KX5 A;  3AZI A;  1ULY A;  3MNN A;  5AV8 A;  2HIO D;  3W96 A;  4J8W B;  1A7W A;  2HIO A;  2PYO C;  4ZUX C;  5G49 A;  3AYW A;  3V9R B;  3REK C;  5B2I D;  3O62 A;  3MGR C;  4J8V C;  5E5A D;  3AZG A;  2F8N H;  4WU9 C;  2BYK A;  5E5A A;  4NFT A;  4H9N B;  5B0Y B;  3C1B D;  3X1T C;  3LZ1 B;  1M1A C;  5C3I C;  3TU4 B;  1B67 A;  4WNN B;  4J8U D;  5DNM A;  1S32 A;  3AZJ A;  5B40 D;  4J8U A;  3NQU B;  3MGP D;  1P3B A;  2NZD C;  5B40 A;  4YS3 D;  3REL C;  5AVC C;  4WU8 C;  5B2I B;  1BH8 B;  4J8X B;  3AZN C;  1WWI A;  4YS3 A;  3W98 C;  3AZH A;  5AVB C;  1U35 D;  4JJN A;  4H9O A;  1P3A D;  3X1U C;  5CPK C;  1M19 D;  3R45 B;  2RVQ D;  3C1B B;  3B0B A;  3UTB D;  1ID3 A;  5CP6 C;  3AZL B;  1P3F C;  3MGP B;  1P3O D;  3UTA C;  4ZBJ C;  3AZK D;  4CSR B;  3X1S C;  5B1L A;  5AV9 A;  5AV6 C;  4R8P D;  3KWQ A;  1U35 B;  1H3O A;  3KXB C;  1P3A B;  2ARO D;  5CPI D;  1M19 B;  5B33 A;  5BT1 C;  3AZF A;  2ARO A;  3LEL C;  1JFI A;  3UTB B;  5B24 C;  3KUY D;  5B1M D;  5GT3 C;  4YM6 D;  5B1M A;  3REJ D;  4YM6 A;  3AZN B;  1F1E A;  1ZLA C;  2FJ7 B;  1P3O B;  3W98 B;  3AFA D;  3WKJ D;  3MGS D;  3AZK B;  3AV2 C;  5GSU C;  3AFA A;  1P34 D;  1P3L A;  4R8P B;  3LJA D;  5B2J A;  4EO5 C;  3W99 D;  3B6G C;  4KHA A;  5JRG A;  2NQB C;  5GT0 D;  2ARO B;  5CPI B;  5B0Z A;  3MVD A;  3W99 A;  4Z66 D;  5BO0 A;  5F99 D;  4UUZ A;  4XUJ A;  5GXQ C;  1TZY D;  4G92 B;  3KUY B;  1KX4 C;  1M18 D;  4X23 A;  1HTA A;  1AOI D;  2CV5 C;  3C1C C;  3WA9 A;  4QLC D;  3WTP E;  3B0D C;  3B6F C;  3REJ B;  3VH6 T;  3WKJ B;  4QLC A;  1P3M D;  3MGS B;  1KX3 D;  3MGQ C;  1P34 B;  3LJA B;  1P3K D;  5B31 C;  1KX3 A;  3AZE C;  3UT9 C;  4KGC C;  5GT0 B;  3X1V D;  4J8W A;  4Z66 B;  5AY8 C;  5F99 B;  4KUD D;  3AN2 D;  3AV1 D;  3VH5 W;  4XZQ C;  1TZY B;  5DNN C;  3V9R A;  1M18 B;  1AOI B;  5GSU B;  3WTP C;  3VH5 A;  5AV5 C;  1P3M B;  5B0Y D;  1KX5 C;  3LZ1 D;  3TU4 D;  1KX3 B;  3AZI C;  4H9N A;  5B0Y A;  3MNN C;  3LZ1 A;  5KDM A;  5AV8 C;  1P3K B;  3W96 C;  3TU4 A;  4WNN A;  1F66 D;  2HIO C;  3X1V B;  4LD9 C;  4Z5T D;  3AYW C;  3NQU A;  1B6W A;  3W97 C;  4KUD B;  3AN2 B;  3AV1 B;  4J8X D;  3REH D;  3O62 C;  3NQJ B;  1BH8 A;  5B2I A;  3A6N D;  4J8X A;  3AZG C;  3WAA C;  5BS7 A;  5KDM B;  3R45 A;  4G91 C;  2IO5 C;  4AWL C;  5DNM C;  3C1B A;  1S32 C;  2PYO D;  3AZJ C;  4ZUX D;  1HQ3 C;  3AZL D;  4J8U C;  1P3B C;  3REK D;  4Z2M H;  1F66 B;  5B40 C;  3AZL A;  4Z5T B;  2L5A A;  3B0C W;  3MGR D;  3MGP A;  4J8V D;  4YS3 C;  3REH B;  4WU9 D;  4CSR A;  3AZH C;  1N1J B;  3A6N B;  4H9S A;  5B31 G;  4JJN C;  3X1T D;  1M1A D;  4WZS B;  1U35 A;  3X1T A;  1BFM A;  5CHL B;  1P3A A;  4NE5 A;  1M19 A;  1ID3 C;  2NZD D;  5B32 C;  2PYO B;  4LD9 B;  4ZUX B;  3UTB A;  3REL D;  2F8N B;  5AVC D;  2NZD A;  4WU8 D;  3REK B;  2FJ7 D;  3AZN D;  5CPJ C;  3W98 D;  3REL A;  5B1L C;  2YFW B;  5AVB D;  3MGR B;  5AV9 C;  3AZN A;  2FJ7 A;  4J8V B;  1P3O A;  3W98 A;  3X1U D;  5CPK D;  3KWQ C;  3AZK A;  4WU9 B;  5FUG B;  4R8P A;  3X1T B;  1M1A B;  5B33 C;  5C3I B;  5BNV B;  4H9R B;  3AZF C;  5CPI A;  1HQ3 B;  5CP6 D;  2F8N G;  1P3P C;  1P3F D;  4DRA A;  2NZD B;  4H9Q B;  5CP6 A;  3UTA D;  3X1S D;  3KUY A;  3REL B;  5AVC B;  4WU8 B;  5JA4 B;  5AV6 D;  4NE6 A;  2HUE C;  5AVB B;  3REJ A;  1P3G C;  3AFA C;  3KXB D;  5AV6 A;  1P3L C;  3WKJ A;  3X1U B;  5CPK B;  3MGS A;  5B2J C;  5JRG C;  1P34 A;  3LJA A;  3LEL D;  5B0Z C;  3MVD C;  3W99 C;  5B24 D;  5GT3 D;  5B32 B;  5GT0 A;  4XUJ C;  5CP6 B;  1EQZ C;  4Z66 A;  1P3F B;  5F99 A;  1ZLA D;  4X23 C;  5CPJ B;  3WA9 C;  3UTA B;  4ZBJ B;  1TZY A;  3X1S B;  3AV2 D;  1M18 A;  2BYM B;  1P3I C;  3AZM C;  5GSU D;  1AOI A;  5AV6 B;  1WWS A;  5GSU A;  3B6G D;  3KXB B;  2NQB D;  1P3M A;  3REI C;  5B32 G;  3LEL B;  1P3K A;  5GXQ D;  1P3P B;  4J8W C;  5B24 B;  2JSS A;  3LZ0 C;  1KX4 D;  5GT3 B;  3X1V A;  3C1C D;  2CV5 D;  3VH6 W;  3B6F D;  1ZLA B;  4KUD A;  3AN2 A;  3AV1 A;  3VH5 T;  3AV2 B;  1P3G B;  3NQJ A;  3MGQ D;  2YFV B;  4CAY B;  3KSY A;  5B31 D;  4EO5 B;  3AZE D;  3UT9 D;  3B6G B;  2NQB B;  5BNX A;  5AY8 D;  5GXQ B;  4XZQ D;  5DNN D;  1KX4 B;  1F66 A;  2CV5 B;  3C1C B;  4Z5T A;  1P3I B;  3B0D B;  3B6F B;  3WTP D;  5B2I C;  4J8X C;  3REH A;  1KX5 D;  1BH9 B;  5BS7 C;  3AZI D;  1N1J A;  3A6N A;  5E5A C;  3MGQ B;  3MNN D;  3REI B;  5BNX B;  5AV8 D;  5B31 B;  3W96 D;  1TAF B;  3AZE B;  3UT9 B;  4KGC B;  3C1B C;  4LD9 D;  3LZ0 B;  5AY8 B;  3AYW D;  2F8N D;  3W97 D;  2PYO A;  4LD9 A;  4XZQ B;  4ZUX A;  3AZL C;  2LY8 A;  2F8N A;  3W97 A;  5DNN B;  3O62 D;  3MGP C;  3REK A;  4H9P B;  3AZG D;  3WAA D;  4WV4 B;  4E44 A;  2YFW A;  3MGR A;  3WTP B;  4J8V A;  3B0C T;  4H9S C;  3WAA A;  5AV5 B;  1KX5 B;  4WU9 A;  5FUG A;  3AZI B;  1U35 C;  1P3A C;  5DNM D;  3MNN B;  1S32 D;  1M19 C;  5AV8 B;  3AZJ D;  1M1A A;  3W96 B;  5BNV A;  1HQ3 D;  2RVQ C;  4H9R A;  1P3B D; 
#chains in the Genus database with same CATH topology
 2HIO B;  1HQ3 A;  4DRB A;  3UTB C;  5G49 B;  3AYW B;  3W97 B;  4H9Q A;  2BG1 A;  5AVC A;  3O62 B;  2ZY4 A;  4WU8 A;  3AZH D;  2FJ7 C;  4JJN D;  5JA4 A;  3AZG B;  1KU5 A;  1P3O C;  2F8N K;  3WAA B;  3AZK C;  5AVB A;  2BYK B;  5E5A B;  4R8P C;  3X1U A;  5CPK A;  4G91 B;  2IO5 B;  1ID3 D;  4AWL B;  2ARO C;  5B32 D;  5CPI C;  5DNM B;  1S32 B;  3AZJ B;  2J8P A;  1W2E A;  4J8U B;  1P3B B;  5B32 A;  2G5I C;  5CPJ D;  5B40 B;  4G92 C;  1P3F A;  5B1L D;  3KUY C;  5B1M C;  5AV9 D;  4HGA C;  4YM6 C;  5CPJ A;  4YS3 B;  3UTA A;  3KWQ D;  3X1S A;  2BYM A;  3REJ C;  3AZH B;  4JJN B;  4H9O B;  3WKJ C;  3MGS C;  4Z2M G;  5B33 D;  2DF4 C;  4NE3 A;  5BT1 D;  3AZF D;  3KXB A;  1P34 C;  3LJA C;  1P3P D;  1ID3 B;  5GT0 C;  3LEL A;  1P3P A;  5B24 A;  4Z66 C;  5GT3 A;  5F99 C;  1TZY C;  5B1L B;  1M18 C;  1ZLA A;  5AV9 B;  1P3G D;  1AOI C;  1P3L D;  4QLC C;  3KWQ B;  5B2J D;  3AV2 A;  1P3G A;  1H3O B;  5JRG D;  2YFV A;  4CAY A;  1P3M C;  5B33 B;  5B0Z D;  3MVD D;  1KX3 C;  3B6G A;  3AZF B;  2NQB A;  4XUJ D;  1P3K C;  1JFI B;  1EQZ D;  4X23 D;  2CWE A;  3X1V C;  3WA9 D;  1EQZ A;  5GXQ A;  5B1M B;  1KX4 A;  4HGA B;  4YM6 B;  3AZM D;  3AN2 C;  1P3I D;  3AV1 C;  4KUD C;  2CV5 A;  3C1C A;  3H0L C;  1P3I A;  3AZM A;  3B6F A;  2HUE B;  2Y2K A;  3AFA B;  1P3L B;  1BH9 A;  5B2J B;  3VH6 A;  3REI D;  4KHA B;  5JRG B;  3MGQ A;  4KGC D;  5B0Y C;  3REI A;  1R4V A;  2XD1 A;  5B31 A;  5B0Z B;  3LZ1 C;  3MVD B;  4J8W D;  3TU4 C;  3W99 B;  1TAF A;  3LZ0 D;  5BO0 B;  3UT9 A;  4M6B A;  3AZE A;  4KGC A;  4UUZ B;  4XUJ B;  1EQZ B;  2Y2I A;  3LZ0 A;  5AY8 A;  4E45 A;  1Q9C A;  1F66 C;  4X23 B;  2JCH A;  3WA9 B;  4XZQ A;  2RIQ A;  2F2A C;  4Z5T C;  5DNN A;  3AZM B;  4H9P A;  3REH C;  4QLC B;  5AV5 D;  3WTP A;  3A6N C;  5AV5 A;  1KX5 A;  2Y2G A;  3AZI A;  1ULY A;  3MNN A;  5AV8 A;  2HIO D;  3W96 A;  4J8W B;  1A7W A;  3EPK A;  2HIO A;  2PYO C;  4ZUX C;  5G49 A;  3AYW A;  3V9R B;  3REK C;  5B2I D;  3O62 A;  3MGR C;  4J8V C;  5E5A D;  3AZG A;  2F8N H;  4WU9 C;  2BYK A;  5E5A A;  4NFT A;  4H9N B;  5B0Y B;  3C1B D;  3X1T C;  3LZ1 B;  1M1A C;  2Y2N A;  5C3I C;  3TU4 B;  1B67 A;  4WNN B;  4J8U D;  5DNM A;  1S32 A;  3AZJ A;  5B40 D;  4J8U A;  3NQU B;  3MGP D;  1P3B A;  2NZD C;  5B40 A;  4YS3 D;  3REL C;  5AVC C;  4WU8 C;  5B2I B;  1BH8 B;  4J8X B;  3AZN C;  1WWI A;  4YS3 A;  3W98 C;  3AZH A;  5AVB C;  1U35 D;  4JJN A;  4H9O A;  1P3A D;  3X1U C;  5CPK C;  1M19 D;  3R45 B;  2RVQ D;  3C1B B;  3B0B A;  3UTB D;  1ID3 A;  2DQN C;  5CP6 C;  3AZL B;  1P3F C;  3MGP B;  1P3O D;  3UTA C;  4ZBJ C;  3AZK D;  4CSR B;  3X1S C;  5B1L A;  2UWX A;  5AV9 A;  5AV6 C;  4R8P D;  3KWQ A;  1U35 B;  1H3O A;  3KXB C;  1P3A B;  2ARO D;  5CPI D;  1M19 B;  5B33 A;  5BT1 C;  3AZF A;  2ARO A;  3LEL C;  1JFI A;  3UTB B;  5B24 C;  3KUY D;  5B1M D;  5GT3 C;  4YM6 D;  5B1M A;  3F6T A;  3REJ D;  4YM6 A;  3AZN B;  1F1E A;  1ZLA C;  2FJ7 B;  1P3O B;  3W98 B;  3AFA D;  3WKJ D;  3H0R C;  3MGS D;  3AZK B;  3AV2 C;  5GSU C;  3AFA A;  1P34 D;  1Z2C B;  1P3L A;  4R8P B;  3LJA D;  5B2J A;  2JE5 A;  4EO5 C;  3W99 D;  3B6G C;  4KHA A;  5JRG A;  2NQB C;  5GT0 D;  2ARO B;  5CPI B;  5B0Z A;  3MVD A;  3W99 A;  4Z66 D;  5BO0 A;  5F99 D;  4UUZ A;  4XUJ A;  5GXQ C;  1TZY D;  4G92 B;  3KUY B;  1KX4 C;  1M18 D;  2G5H C;  4X23 A;  1HTA A;  1AOI D;  2CV5 C;  3C1C C;  3WA9 A;  4QLC D;  3WTP E;  2Y2Q A;  3B0D C;  3B6F C;  3REJ B;  3VH6 T;  3WKJ B;  4QLC A;  1P3M D;  3MGS B;  1KX3 D;  3MGQ C;  1P34 B;  3LJA B;  1P3K D;  5B31 C;  1KX3 A;  3AZE C;  3UT9 C;  2Y2O A;  4KGC C;  5GT0 B;  3X1V D;  2Y2M A;  4J8W A;  4Z66 B;  5AY8 C;  5F99 B;  4KUD D;  3AN2 D;  3AV1 D;  3VH5 W;  4XZQ C;  2Y2L A;  1TZY B;  5DNN C;  3V9R A;  2VQR A;  1M18 B;  1AOI B;  3KFU G;  5GSU B;  3WTP C;  3VH5 A;  5AV5 C;  1P3M B;  5B0Y D;  1KX5 C;  3LZ1 D;  3TU4 D;  1KX3 B;  3AZI C;  4H9N A;  5B0Y A;  3MNN C;  3LZ1 A;  5KDM A;  5AV8 C;  1P3K B;  3W96 C;  3TU4 A;  4WNN A;  1F66 D;  2HIO C;  3X1V B;  4LD9 C;  4Z5T D;  3AYW C;  3NQU A;  1B6W A;  3W97 C;  4KUD B;  3AN2 B;  3AV1 B;  4J8X D;  3REH D;  1PZR A;  3O62 C;  3NQJ B;  1BH8 A;  5B2I A;  3A6N D;  4J8X A;  3AZG C;  3WAA C;  2FFF B;  5BS7 A;  5KDM B;  3R45 A;  4G91 C;  2IO5 C;  4AWL C;  5DNM C;  3C1B A;  1S32 C;  2PYO D;  3AZJ C;  4ZUX D;  1HQ3 C;  3AZL D;  3H0M C;  4J8U C;  1P3B C;  3REK D;  4Z2M H;  1F66 B;  4WJ3 C;  5B40 C;  2ZY3 A;  3AZL A;  4Z5T B;  2L5A A;  3B0C W;  3MGR D;  3MGP A;  4J8V D;  4YS3 C;  3REH B;  4WU9 D;  4CSR A;  3AZH C;  1N1J B;  3A6N B;  4H9S A;  5B31 G;  4JJN C;  3X1T D;  1M1A D;  4WZS B;  1U35 A;  3X1T A;  1BFM A;  5CHL B;  1P3A A;  4NE5 A;  1M19 A;  1ID3 C;  2NZD D;  5B32 C;  3EPL A;  2PYO B;  4LD9 B;  4ZUX B;  3UTB A;  3REL D;  2F8N B;  5AVC D;  2NZD A;  4WU8 D;  3REK B;  2FJ7 D;  3AZN D;  5CPJ C;  3W98 D;  3REL A;  5B1L C;  2YFW B;  5AVB D;  3MGR B;  5AV9 C;  3AZN A;  2FJ7 A;  4J8V B;  1P3O A;  3W98 A;  2W8S A;  3X1U D;  5CPK D;  3KWQ C;  3AZK A;  4WU9 B;  5FUG B;  4R8P A;  3X1T B;  1M1A B;  5B33 C;  5C3I B;  5BNV B;  4H9R B;  3AZF C;  5CPI A;  1HQ3 B;  5CP6 D;  2F8N G;  1P3P C;  1P3F D;  4DRA A;  2NZD B;  4H9Q B;  3AL0 C;  5CP6 A;  3UTA D;  2Y2P A;  3X1S D;  3KUY A;  3REL B;  5AVC B;  4WU8 B;  3EG5 B;  5JA4 B;  5AV6 D;  4NE6 A;  2HUE C;  5AVB B;  3REJ A;  1P3G C;  3AFA C;  3KXB D;  5AV6 A;  1P3L C;  3WKJ A;  1P3B D;  3X1U B;  5CPK B;  3MGS A;  5B2J C;  5JRG C;  1P34 A;  3LJA A;  3LEL D;  3EPH A;  5B0Z C;  3MVD C;  3W99 C;  5B24 D;  5GT3 D;  5B32 B;  5GT0 A;  4XUJ C;  5CP6 B;  1EQZ C;  4Z66 A;  1P3F B;  5F99 A;  1ZLA D;  4X23 C;  5CPJ B;  3WA9 C;  3UTA B;  4ZBJ B;  1TZY A;  3X1S B;  3AV2 D;  1M18 A;  2BYM B;  1P3I C;  3AZM C;  5GSU D;  1AOI A;  5AV6 B;  2ZY5 A;  1WWS A;  5GSU A;  3B6G D;  3KXB B;  2NQB D;  1P3M A;  3REI C;  3FDD A;  5B32 G;  3LEL B;  1P3K A;  5GXQ D;  1P3P B;  3EPJ A;  4J8W C;  5B24 B;  2JSS A;  3LZ0 C;  1KX4 D;  5GT3 B;  3X1V A;  3C1C D;  2Y2J A;  2CV5 D;  3VH6 W;  3B6F D;  1ZLA B;  4KUD A;  3AN2 A;  3AV1 A;  3VH5 T;  3AV2 B;  4UPK A;  1P3G B;  3NQJ A;  3MGQ D;  2YFV B;  4CAY B;  3KSY A;  5B31 D;  4EO5 B;  3AZE D;  3UT9 D;  3B6G B;  2NQB B;  2Y2H A;  5BNX A;  5AY8 D;  5GXQ B;  4XZQ D;  5DNN D;  1KX4 B;  1F66 A;  2CV5 B;  3C1C B;  4Z5T A;  1P3I B;  3B0D B;  3B6F B;  3WTP D;  5B2I C;  4J8X C;  3REH A;  1KX5 D;  1BH9 B;  5BS7 C;  4DQY B;  3AZI D;  1N1J A;  3A6N A;  5E5A C;  3MGQ B;  2ZM5 A;  3MNN D;  3REI B;  5BNX B;  5AV8 D;  5B31 B;  3W96 D;  1TAF B;  3AZE B;  3UT9 B;  1T3U A;  4KGC B;  3C1B C;  4LD9 D;  3LZ0 B;  5AY8 B;  3AYW D;  2F8N D;  3W97 D;  2PYO A;  4LD9 A;  2XD5 A;  4ZUX A;  3A1I A;  4XZQ B;  3AZL C;  2LY8 A;  2F8N A;  3W97 A;  5DNN B;  3O62 D;  3MGP C;  3REK A;  4H9P B;  3AZG D;  3WAA D;  4WV4 B;  4E44 A;  2YFW A;  3MGR A;  3WTP B;  4J8V A;  3B0C T;  4H9S C;  3WAA A;  5AV5 B;  3A1K A;  1KX5 B;  4WU9 A;  5FUG A;  3AZI B;  1U35 C;  3IP4 C;  3P5J B;  1P3A C;  5DNM D;  3MNN B;  1S32 D;  1M19 C;  5AV8 B;  3AZJ D;  1M1A A;  3W96 B;  5BNV A;  1HQ3 D;  2RVQ C;  4H9R A;  2ZY2 A; 
#chains in the Genus database with same CATH homology
 2HIO B;  1HQ3 A;  4DRB A;  3UTB C;  5G49 B;  3AYW B;  3W97 B;  4H9Q A;  2BG1 A;  5AVC A;  3O62 B;  2ZY4 A;  4WU8 A;  3AZH D;  2FJ7 C;  4JJN D;  5JA4 A;  3AZG B;  1KU5 A;  1P3O C;  2F8N K;  3WAA B;  3AZK C;  5AVB A;  2BYK B;  5E5A B;  4R8P C;  3X1U A;  5CPK A;  4G91 B;  2IO5 B;  1ID3 D;  4AWL B;  2ARO C;  5B32 D;  5CPI C;  5DNM B;  1S32 B;  3AZJ B;  2J8P A;  1W2E A;  4J8U B;  1P3B B;  5B32 A;  2G5I C;  5CPJ D;  5B40 B;  4G92 C;  1P3F A;  5B1L D;  3KUY C;  5B1M C;  5AV9 D;  4HGA C;  4YM6 C;  5CPJ A;  4YS3 B;  3UTA A;  3KWQ D;  3X1S A;  2BYM A;  3REJ C;  3AZH B;  4JJN B;  4H9O B;  3WKJ C;  3MGS C;  4Z2M G;  5B33 D;  2DF4 C;  4NE3 A;  5BT1 D;  3AZF D;  3KXB A;  1P34 C;  3LJA C;  1P3P D;  1ID3 B;  5GT0 C;  3LEL A;  1P3P A;  5B24 A;  4Z66 C;  5GT3 A;  5F99 C;  1TZY C;  5B1L B;  1M18 C;  1ZLA A;  5AV9 B;  1P3G D;  1AOI C;  1P3L D;  4QLC C;  3KWQ B;  5B2J D;  3AV2 A;  1P3G A;  1H3O B;  5JRG D;  2YFV A;  4CAY A;  1P3M C;  5B33 B;  5B0Z D;  3MVD D;  1KX3 C;  3B6G A;  3AZF B;  2NQB A;  4XUJ D;  1P3K C;  1JFI B;  1EQZ D;  4X23 D;  2CWE A;  3X1V C;  3WA9 D;  1EQZ A;  5GXQ A;  5B1M B;  1KX4 A;  4HGA B;  4YM6 B;  3AZM D;  3AN2 C;  1P3I D;  3AV1 C;  4KUD C;  2CV5 A;  3C1C A;  3H0L C;  1P3I A;  3AZM A;  3B6F A;  2HUE B;  2Y2K A;  3AFA B;  1P3L B;  1BH9 A;  5B2J B;  3VH6 A;  3REI D;  4KHA B;  5JRG B;  3MGQ A;  4KGC D;  5B0Y C;  3REI A;  1R4V A;  2XD1 A;  5B31 A;  5B0Z B;  3LZ1 C;  3MVD B;  4J8W D;  3TU4 C;  3W99 B;  1TAF A;  3LZ0 D;  5BO0 B;  3UT9 A;  4M6B A;  3AZE A;  4KGC A;  4UUZ B;  4XUJ B;  1EQZ B;  2Y2I A;  3LZ0 A;  5AY8 A;  4E45 A;  1Q9C A;  1F66 C;  4X23 B;  2JCH A;  3WA9 B;  4XZQ A;  2RIQ A;  2F2A C;  4Z5T C;  5DNN A;  3AZM B;  4H9P A;  3REH C;  4QLC B;  5AV5 D;  3WTP A;  3A6N C;  5AV5 A;  1KX5 A;  2Y2G A;  3AZI A;  1ULY A;  3MNN A;  5AV8 A;  2HIO D;  3W96 A;  4J8W B;  1A7W A;  3EPK A;  2HIO A;  2PYO C;  4ZUX C;  5G49 A;  3AYW A;  3V9R B;  3REK C;  5B2I D;  3O62 A;  3MGR C;  4J8V C;  5E5A D;  3AZG A;  2F8N H;  4WU9 C;  2BYK A;  5E5A A;  4NFT A;  4H9N B;  5B0Y B;  3C1B D;  3X1T C;  3LZ1 B;  1M1A C;  2Y2N A;  5C3I C;  3TU4 B;  1B67 A;  4WNN B;  4J8U D;  5DNM A;  1S32 A;  3AZJ A;  5B40 D;  4J8U A;  3NQU B;  3MGP D;  1P3B A;  2NZD C;  5B40 A;  4YS3 D;  3REL C;  5AVC C;  4WU8 C;  5B2I B;  1BH8 B;  4J8X B;  3AZN C;  1WWI A;  4YS3 A;  3W98 C;  3AZH A;  5AVB C;  1U35 D;  4JJN A;  4H9O A;  1P3A D;  3X1U C;  5CPK C;  1M19 D;  3R45 B;  2RVQ D;  3C1B B;  3B0B A;  3UTB D;  1ID3 A;  2DQN C;  5CP6 C;  3AZL B;  1P3F C;  3MGP B;  1P3O D;  3UTA C;  4ZBJ C;  3AZK D;  4CSR B;  3X1S C;  5B1L A;  2UWX A;  5AV9 A;  5AV6 C;  4R8P D;  3KWQ A;  1U35 B;  1H3O A;  3KXB C;  1P3A B;  2ARO D;  5CPI D;  1M19 B;  5B33 A;  5BT1 C;  3AZF A;  2ARO A;  3LEL C;  1JFI A;  3UTB B;  5B24 C;  3KUY D;  5B1M D;  5GT3 C;  4YM6 D;  5B1M A;  3F6T A;  3REJ D;  4YM6 A;  3AZN B;  1F1E A;  1ZLA C;  2FJ7 B;  1P3O B;  3W98 B;  3AFA D;  3WKJ D;  3H0R C;  3MGS D;  3AZK B;  3AV2 C;  5GSU C;  3AFA A;  1P34 D;  1Z2C B;  1P3L A;  4R8P B;  3LJA D;  5B2J A;  2JE5 A;  4EO5 C;  3W99 D;  3B6G C;  4KHA A;  5JRG A;  2NQB C;  5GT0 D;  2ARO B;  5CPI B;  5B0Z A;  3MVD A;  3W99 A;  4Z66 D;  5BO0 A;  5F99 D;  4UUZ A;  4XUJ A;  5GXQ C;  1TZY D;  4G92 B;  3KUY B;  1KX4 C;  1M18 D;  2G5H C;  4X23 A;  1HTA A;  1AOI D;  2CV5 C;  3C1C C;  3WA9 A;  4QLC D;  3WTP E;  2Y2Q A;  3B0D C;  3B6F C;  3REJ B;  3VH6 T;  3WKJ B;  4QLC A;  1P3M D;  3MGS B;  1KX3 D;  3MGQ C;  1P34 B;  3LJA B;  1P3K D;  5B31 C;  1KX3 A;  3AZE C;  3UT9 C;  2Y2O A;  4KGC C;  5GT0 B;  3X1V D;  2Y2M A;  4J8W A;  4Z66 B;  5AY8 C;  5F99 B;  4KUD D;  3AN2 D;  3AV1 D;  3VH5 W;  4XZQ C;  2Y2L A;  1TZY B;  5DNN C;  3V9R A;  2VQR A;  1M18 B;  1AOI B;  3KFU G;  5GSU B;  3WTP C;  3VH5 A;  5AV5 C;  1P3M B;  5B0Y D;  1KX5 C;  3LZ1 D;  3TU4 D;  1KX3 B;  3AZI C;  4H9N A;  5B0Y A;  3MNN C;  3LZ1 A;  5KDM A;  5AV8 C;  1P3K B;  3W96 C;  3TU4 A;  4WNN A;  1F66 D;  2HIO C;  3X1V B;  4LD9 C;  4Z5T D;  3AYW C;  3NQU A;  1B6W A;  3W97 C;  4KUD B;  3AN2 B;  3AV1 B;  4J8X D;  3REH D;  1PZR A;  3O62 C;  3NQJ B;  1BH8 A;  5B2I A;  3A6N D;  4J8X A;  3AZG C;  3WAA C;  2FFF B;  5BS7 A;  5KDM B;  3R45 A;  4G91 C;  2IO5 C;  4AWL C;  5DNM C;  3C1B A;  1S32 C;  2PYO D;  3AZJ C;  4ZUX D;  1HQ3 C;  3AZL D;  3H0M C;  4J8U C;  1P3B C;  3REK D;  4Z2M H;  1F66 B;  4WJ3 C;  5B40 C;  2ZY3 A;  3AZL A;  4Z5T B;  2L5A A;  3B0C W;  3MGR D;  3MGP A;  4J8V D;  4YS3 C;  3REH B;  4WU9 D;  4CSR A;  3AZH C;  1N1J B;  3A6N B;  4H9S A;  5B31 G;  4JJN C;  3X1T D;  1M1A D;  4WZS B;  1U35 A;  3X1T A;  1BFM A;  5CHL B;  1P3A A;  4NE5 A;  1M19 A;  1ID3 C;  2NZD D;  5B32 C;  3EPL A;  2PYO B;  4LD9 B;  4ZUX B;  3UTB A;  3REL D;  2F8N B;  5AVC D;  2NZD A;  4WU8 D;  3REK B;  2FJ7 D;  3AZN D;  5CPJ C;  3W98 D;  3REL A;  5B1L C;  2YFW B;  5AVB D;  3MGR B;  5AV9 C;  3AZN A;  2FJ7 A;  4J8V B;  1P3O A;  3W98 A;  2W8S A;  3X1U D;  5CPK D;  3KWQ C;  3AZK A;  4WU9 B;  5FUG B;  4R8P A;  3X1T B;  1M1A B;  5B33 C;  5C3I B;  5BNV B;  4H9R B;  3AZF C;  5CPI A;  1HQ3 B;  5CP6 D;  2F8N G;  1P3P C;  1P3F D;  4DRA A;  2NZD B;  4H9Q B;  3AL0 C;  5CP6 A;  3UTA D;  2Y2P A;  3X1S D;  3KUY A;  3REL B;  5AVC B;  4WU8 B;  3EG5 B;  5JA4 B;  5AV6 D;  4NE6 A;  2HUE C;  5AVB B;  3REJ A;  1P3G C;  3AFA C;  3KXB D;  5AV6 A;  1P3L C;  3WKJ A;  1P3B D;  3X1U B;  5CPK B;  3MGS A;  5B2J C;  5JRG C;  1P34 A;  3LJA A;  3LEL D;  3EPH A;  5B0Z C;  3MVD C;  3W99 C;  5B24 D;  5GT3 D;  5B32 B;  5GT0 A;  4XUJ C;  5CP6 B;  1EQZ C;  4Z66 A;  1P3F B;  5F99 A;  1ZLA D;  4X23 C;  5CPJ B;  3WA9 C;  3UTA B;  4ZBJ B;  1TZY A;  3X1S B;  3AV2 D;  1M18 A;  2BYM B;  1P3I C;  3AZM C;  5GSU D;  1AOI A;  5AV6 B;  2ZY5 A;  1WWS A;  5GSU A;  3B6G D;  3KXB B;  2NQB D;  1P3M A;  3REI C;  3FDD A;  5B32 G;  3LEL B;  1P3K A;  5GXQ D;  1P3P B;  3EPJ A;  4J8W C;  5B24 B;  2JSS A;  3LZ0 C;  1KX4 D;  5GT3 B;  3X1V A;  3C1C D;  2Y2J A;  2CV5 D;  3VH6 W;  3B6F D;  1ZLA B;  4KUD A;  3AN2 A;  3AV1 A;  3VH5 T;  3AV2 B;  4UPK A;  1P3G B;  3NQJ A;  3MGQ D;  2YFV B;  4CAY B;  3KSY A;  5B31 D;  4EO5 B;  3AZE D;  3UT9 D;  3B6G B;  2NQB B;  2Y2H A;  5BNX A;  5AY8 D;  5GXQ B;  4XZQ D;  5DNN D;  1KX4 B;  1F66 A;  2CV5 B;  3C1C B;  4Z5T A;  1P3I B;  3B0D B;  3B6F B;  3WTP D;  5B2I C;  4J8X C;  3REH A;  1KX5 D;  1BH9 B;  5BS7 C;  4DQY B;  3AZI D;  1N1J A;  3A6N A;  5E5A C;  3MGQ B;  2ZM5 A;  3MNN D;  3REI B;  5BNX B;  5AV8 D;  5B31 B;  3W96 D;  1TAF B;  3AZE B;  3UT9 B;  1T3U A;  4KGC B;  3C1B C;  4LD9 D;  3LZ0 B;  5AY8 B;  3AYW D;  2F8N D;  3W97 D;  2PYO A;  4LD9 A;  2XD5 A;  4ZUX A;  3A1I A;  4XZQ B;  3AZL C;  2LY8 A;  2F8N A;  3W97 A;  5DNN B;  3O62 D;  3MGP C;  3REK A;  4H9P B;  3AZG D;  3WAA D;  4WV4 B;  4E44 A;  2YFW A;  3MGR A;  3WTP B;  4J8V A;  3B0C T;  4H9S C;  3WAA A;  5AV5 B;  3A1K A;  1KX5 B;  4WU9 A;  5FUG A;  3AZI B;  1U35 C;  3IP4 C;  3P5J B;  1P3A C;  5DNM D;  3MNN B;  1S32 D;  1M19 C;  5AV8 B;  3AZJ D;  1M1A A;  3W96 B;  5BNV A;  1HQ3 D;  2RVQ C;  4H9R A;  2ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...