3AV1C

The human nucleosome structure containing the histone variant h3.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1C00
5C3IC 3NQJA 5GXQD 3AFAD 3AN2D 4X23A 3UTAA 5BS7C 3TU4A 1AOIA 3W96A 2NZDC 1P3MA 4J8UA 5B2ID 2BYMB 3LZ0C 1M19D 3WKJA 1TZYD 5JRGD 2NQBA 1P3KC 3LELD 3UT9C 5CPID 1M1AA 3AZEA 5AV9C 1BH9A 3VH5T 4X23C 1P34D 3MVDB 1M18D 3KSYA 3A6ND 1AOIC 3W96C 4H9SA 1ULYA 3KUYC 5GT0A 4R8PB 3LJAC 5GSUB 1WWIA 4YM6B 2HIOB 4LD9B 5B1MC 5CPKD 1P3OA 4Z66B 4WU9B 4UUZB 5F99B 1R4VA 3REHA 3REIB 5BNXB 1S32D 4EO5C 5B33D 5B24B 5CP6D 5AY8B 3REJD 1Q9CA 1P3PA 3MGRC 3MGPD 3X1SB 3X1TB 1TAFB 1EQZB 1F1EA 3B6GD 3B0CW 4Z5TB 2HUEB 1KU5A 4J8WB 4ZUXB 5KDMB 5B0ZB 4LD9A 5DNMB 3O62B 1P3BB 2YFVB 3MVDC 5BNVA 3X1VD 5CPJB 3KXBB 2FJ7D 3MGQD 1JFIB 3REIA 5B2JB 4R8PC 5B40B 1P3AD 5GSUC 4YM6C 4KUDD 2HIOC 1KX4D 1U35A 1ID3B 4Z66C 5AY8A 4WU9C 4G91B 5AVCB 5F99C 1BFMA 3X1TA 1TAFA 4WU8A 3REKA 3AZFD 3B0DB 3W97D 3REIC 1KX3A 3X1UA 2AROD 3AV1D 5B24C 5FUGA 3UTBB 4YS3A 5KDMA 4JJNB 3X1TC 1N1JB 3AZLB 3AZND 3X1SC 5DNNB 3W99B 3AZHB 5AV8B 1EQZC 2RVQD 4Z5TC 2HUEC 3AYWD 5B32G 5B1LB 1P3LB 4J8WC 4ZUXC 3AZMB 5B0ZC 5DNMC 3O62C 1P3BC 1HQ3D 5AVCA 5B32B 1ZLAD 3V9RA 5CPJC 3KXBC 3MNND 2PYOB 2NZDD 1F66B 5B2JC 5B40C 4QLCD 1ID3C 1P3IB 3C1BA 4G91C 4X23D 3UTAD 3AZIB 3TU4D 3AZHA 4WNNA 3LZ1A 1AOID 5GT3B 3B0DC 5AV8A 2CV5B 4KGCB 3W96D 1P3MD 4J8UD 3VH5W 3WKJD 4XZQB 3WTPB 2NQBD 3WAAB 4HGAB 3UTBC 1P3LA 3RELD 3AV2B 1M1AD 4WZSB 3AZED 4JJNC 4J8VB 4Z2MG 3AZLC 5BS7A 5B31C 5DNNC 3W99C 5AV5B 3AZHC 1P3GB 4J8XB 5B32A 3LZ0A 4H9OB 1P3KA 4H9QB 5GT0D 4XUJB 5E5AB 3UT9A 5B1LC 1P3LC 3KWQB 5AV9A 3AZMC 2YFWA 1P3OD 1BH8A 1H3OA 1KX5B 5B0YB 5B32C 3REHD 3AZJB 4Z2MH 3KUYA 3LJAA 3W98B 4KGCA 2PYOC 1F66C 5G49A 3AZKB 5B1MA 1P3PD 1P3IC 3AFAB 3AV2A 4J8VA 3AZIC 5GT3C 2CV5C 4KGCC 1B6WA 5B2IB 5AVBC 1M19B 1P3FB 1TZYB 4XZQC 5AV6B 3WTPC 4H9QA 5BO0B 3LELB 3WAAC 4HGAC 4CSRB 3MGRA 5CPIB 3AV2C 4LD9D 4J8VC 1P34B 1M18B 5AV5C 3A6NB 3VH6W 1P3GC 4J8XC 2BYKB 2BYMA 3AZJA 4XUJC 5E5AC 3KWQC 3C1CD 5CPKB 1U35D 3MVDA 5AY8D 1KX5C 5B0YC 4WU8D 3REKD 3AZJC 1S32B 4R8PA 2F8NG 3W98C 5GSUA 4YM6A 1KX3D 2HIOA 3X1UD 5B33B 3AZKC 1P3FA 5CP6B 4Z66A 5AV6A 4YS3D 4WU9A 4UUZA 5F99A 4CSRA 3MGPB 5GXQC 3AFAC 3AN2C 2F8NB 1M18A 4H9RB 3B6GB 5BNXA 5B2IC 4NFTA 1M19C 5B24A 1P3FC 1TZYC 5AV6C 3LELC 5JA4B 3X1SA 5CPIC 2F8NH 1P34C 1M18C 1EQZA 3A6NC 5AVCD 5B31G 3X1VB 4Z5TA 3AZGB 4H9NB 2FJ7B 1B67A 3WA9B 4J8WA 4ZUXA 4KUDB 5B0ZA 5B31B 4AWLB 5B33A 5DNMA 3O62A 5CPKC 1P3BA 2YFVA 3C1BD 4G92B 5BT1D 2F8NA 3R45B 3LZ1D 3KXBA 4H9RA 3AZFB 5AV8D 5CPJA 1JFIA 3W97B 5B2JA 1S32C 5B40A 2AROB 3AV1B 5B33C 1ID3A 5CP6C 3REJC 3MGPC 3AZNB 5B32D 3B6GC 3X1VA 3AZGA 3LZ0D 4H9NA 3MGSB 3AYWB 3WA9A 1P3KD 3UTBA 3UT9D 4WV4B 4JJNA 5AV9D 1N1JA 3AZLA 5B31A 5DNNA 3W99A 1HQ3B 3B0BA 3WTPE 4H9PB 1ZLAB 5AVBB 3X1VC 3AZGC 5CHLB 3MNNB 3KUYD 2FJ7C 3WA9C 3LJAD 4KGCD 5B1LA 4KUDC 5B1MD 3AZMA 4AWLC 3NQUB 4G92C 4J8VD 3UTAB 3TU4B 3AZFC 2PYOA 1P3MB 4J8UB 1F66A 3W97C 4DRBA 3B6FB 2AROC 3WKJB 3MGSA 3AV1C 2NQBB 3MGRD 1P3IA 3RELB 1M1AB 3AZEB 3AZNC 1BH9B 3AZIA 5GT3A 2CV5A 2RVQC 2L5AA 5AVBA 3AZJD 4XZQA 3MGSC 3WTPA 3AYWC 5GT0B 3WAAA 5GXQB 3AN2B 1P3OB 5AV5A 3NQUA 3MVDD 1P3GA 4J8XA 1HQ3C 1ZLAC 3REHB 2LY8A 5JRGB 4H9OA 3MNNC 4XUJA 5E5AA 4R8PD 5GSUD 4YM6D 3KWQA 2HIOD 4QLCC 1P3FD 3B6FA 4Z66D 5AV6D 4WU9D 1P3PB 5F99D 3RELA 5B0YA 1KX5A 3UTAC 3TU4C 3REID 3W98A 1P3MC 4J8UC 3AZKA 3B6FC 5B24D 3WKJC 2NQBC 5GXQA 3X1TD 3X1SD 3AFAA 3RELC 3AZEC 3AN2A 1M1AC 1EQZD 5BNVB 4Z5TD 5B2IA 4H9SC 1M19A 1TZYA 5JRGA 3REJB 4J8WD 4ZUXD 5BO0A 5GT0C 3LELA 5CPIA 5B0ZD 3C1CB 5DNMD 3O62D 1U35B 1P3BD 1P34A 1P3OC 4M6BA 3A6NA 2F8ND 2BYKA 2IO5B 4WU8B 5CPJD 3REHC 3KXBD 3REKB 5JRGC 5B2JD 3VH6A 5B40D 1KX3B 3X1UB 4E45A 5CPKA 1ID3D 5FUGB 4YS3B 1P3PC 3MGQB 1S32A 2CWEA 1P3AB 3AZGD 1KX4B 4NE5A 3WA9D 5CP6A 1A7WA 3UTBD 3REJA 3VH6T 3MGPA 4JJND 3AZLD 5B31D 5DNND 3W99D 3C1CA 3AZHD 4LD9C 2F8NK 1WWSA 3B6GA 4NE6A 3V9RB 5B1LD 1P3LD 5JA4A 3B0CT 3AZMD 3C1CC 1U35C 3C1BB 5AY8C 2IO5C 4WNNB 3LZ1B 3MGQA 3REKC 4WU8C 2FJ7A 4KHAB 2PYOD 1F66D 4ZBJB 4KUDA 1P3AA 1KX3C 3X1UC 1KX4A 4E44A 3MGSD 4YS3C 5C3IB 1P3ID 4DRAA 3AZID 3R45A 3AZFA 3MGQC 5GT3D 2CV5D 2NZDB 3W97A 5AVBD 1P3AC 3LZ0B 4QLCB 2AROA 1KX4C 3AV1A 4CAYB 4XZQD 3WTPD 1P3KB 3UT9B 3WAAD 3NQJB 3AV2D 5AV9B 3AZNA 4X23B 2YFWB 5AV5D 1BH8B 1H3OB 1P3GD 1AOIB 4J8XD 5AVCC 1HTAA 3W96B 3KUYB 3AYWA 3LJAB 4KHAA 4XUJD 5E5AD 5G49B 3KWQD 5B1MB 3B6FD 1HQ3A 3C1BC 1KX5D 5B0YD 4H9PA 5BT1C 1ZLAA 3LZ1C 3MNNA 5AV8C 4NE3A 3W98D 2NZDA 4ZBJC 4EO5B 2JSSA 3AZKD 4QLCA 3VH5A 4CAYA 3MGRB
chains in the Genus database with same CATH superfamily
5C3IC 3NQJA 5GXQD 3AFAD 3AN2D 4X23A 3UTAA 5BS7C 3TU4A 1AOIA 3W96A 2NZDC 1P3MA 4J8UA 2G5HC 5B2ID 2BYMB 3LZ0C 1M19D 3WKJA 1TZYD 5JRGD 2NQBA 1P3KC 3LELD 3UT9C 5CPID 1M1AA 3AZEA 5AV9C 1BH9A 3VH5T 4X23C 1P34D 3MVDB 1M18D 3KFUG 3KSYA 3A6ND 1AOIC 2ZY2A 3W96C 4H9SA 1ULYA 3KUYC 5GT0A 4R8PB 3LJAC 5GSUB 1WWIA 4YM6B 2ZY4A 2HIOB 4LD9B 5B1MC 5CPKD 1P3OA 4Z66B 4WU9B 4UUZB 5F99B 1R4VA 3EPKA 3REHA 3REIB 5BNXB 1S32D 4EO5C 5B33D 5B24B 5CP6D 5AY8B 3REJD 1Q9CA 1P3PA 3MGRC 3MGPD 2DQNC 3X1SB 3X1TB 1TAFB 1EQZB 1F1EA 3B6GD 3B0CW 4Z5TB 2HUEB 1KU5A 4J8WB 4ZUXB 5KDMB 5B0ZB 4LD9A 5DNMB 3O62B 1P3BB 2YFVB 2DF4C 3MVDC 5BNVA 3X1VD 3EPHA 5CPJB 3KXBB 2FJ7D 3MGQD 1JFIB 3REIA 5B2JB 4R8PC 5B40B 1P3AD 5GSUC 4YM6C 4KUDD 2HIOC 1KX4D 1U35A 1ID3B 4Z66C 5AY8A 4WU9C 4G91B 5AVCB 5F99C 1BFMA 3X1TA 1TAFA 2Y2PA 4WU8A 3REKA 3AZFD 3B0DB 3W97D 3REIC 3FDDA 1KX3A 3X1UA 2AROD 3AV1D 5B24C 5FUGA 3UTBB 4YS3A 5KDMA 4JJNB 3X1TC 1N1JB 3AZLB 3AZND 3X1SC 5DNNB 3W99B 3AZHB 5AV8B 1EQZC 2RVQD 4Z5TC 2HUEC 3AYWD 5B32G 5B1LB 1P3LB 4J8WC 4ZUXC 3AZMB 5B0ZC 5DNMC 3O62C 1P3BC 1HQ3D 5AVCA 5B32B 1ZLAD 3V9RA 5CPJC 3KXBC 3MNND 2PYOB 2NZDD 1F66B 5B2JC 5B40C 4QLCD 1ID3C 1P3IB 3C1BA 4G91C 4X23D 3UTAD 3AZIB 3TU4D 3AZHA 4WNNA 3LZ1A 2Y2IA 1AOID 5GT3B 3B0DC 5AV8A 2CV5B 4KGCB 3W96D 1P3MD 4J8UD 3VH5W 2Y2HA 3WKJD 4XZQB 3WTPB 2NQBD 3WAAB 4HGAB 3UTBC 4UPKA 3RELD 3AV2B 1P3LA 1M1AD 4WZSB 3AZED 4JJNC 4J8VB 4Z2MG 3AZLC 5BS7A 5B31C 5DNNC 3W99C 5AV5B 3AZHC 1P3GB 4J8XB 3F6TA 5B32A 3LZ0A 4H9OB 1P3KA 4H9QB 5GT0D 4XUJB 5E5AB 3UT9A 5B1LC 1P3LC 3KWQB 5AV9A 2XD1A 3AZMC 2YFWA 1P3OD 1BH8A 1H3OA 1KX5B 5B0YB 2FFFB 2Y2MA 5B32C 3AL0C 3REHD 2J8PA 3AZJB 4Z2MH 2W8SA 3KUYA 3LJAA 3W98B 2Y2NA 2PYOC 4KGCA 1F66C 5G49A 3AZKB 5B1MA 1P3PD 1P3IC 3AFAB 3AV2A 4J8VA 3AZIC 5GT3C 2CV5C 4KGCC 1B6WA 5B2IB 5AVBC 1M19B 1P3FB 1TZYB 4XZQC 5AV6B 3WTPC 4H9QA 5BO0B 3LELB 3WAAC 4HGAC 4CSRB 3MGRA 5CPIB 3AV2C 4LD9D 4J8VC 1P34B 1M18B 5AV5C 3A6NB 3VH6W 1P3GC 2ZM5A 4J8XC 2BYKB 2BYMA 3AZJA 4XUJC 5E5AC 3KWQC 1W2EA 3C1CD 5CPKB 1U35D 3MVDA 2F2AC 5AY8D 1KX5C 5B0YC 2Y2KA 4WU8D 3REKD 3AZJC 1S32B 4R8PA 2F8NG 3W98C 5GSUA 4YM6A 1KX3D 2HIOA 3X1UD 5B33B 3AZKC 1P3FA 5CP6B 4YS3D 5AV6A 4Z66A 4WU9A 4UUZA 5F99A 4CSRA 3MGPB 5GXQC 3AFAC 2Y2OA 3AN2C 2F8NB 1M18A 4H9RB 3B6GB 5BNXA 5B2IC 4NFTA 1M19C 5B24A 1P3FC 1TZYC 5AV6C 3LELC 3A1KA 5JA4B 3X1SA 5CPIC 2F8NH 1P34C 1M18C 1EQZA 3A6NC 5AVCD 5B31G 3X1VB 4Z5TA 3AZGB 4H9NB 2FJ7B 1B67A 3WA9B 4J8WA 4ZUXA 4KUDB 2BG1A 2Y2QA 5B31B 5B0ZA 4AWLB 5B33A 5DNMA 3O62A 5CPKC 1P3BA 2YFVA 4WJ3C 3C1BD 2JE5A 4G92B 5BT1D 2F8NA 3R45B 3LZ1D 3KXBA 4H9RA 3AZFB 5AV8D 5CPJA 1JFIA 3W97B 5B2JA 1S32C 5B40A 2AROB 3AV1B 5B33C 1ID3A 5CP6C 3REJC 3MGPC 3AZNB 2Y2GA 2ZY3A 1PZRA 5B32D 3B6GC 3X1VA 3AZGA 3LZ0D 2VQRA 4H9NA 2Y2LA 3MGSB 3AYWB 3H0MC 3WA9A 1P3KD 3UTBA 3UT9D 4WV4B 3H0RC 5AV9D 4JJNA 1N1JA 3AZLA 5B31A 5DNNA 4DQYB 3W99A 1HQ3B 2Y2JA 3B0BA 3WTPE 4H9PB 1ZLAB 5AVBB 3X1VC 3AZGC 5CHLB 3MNNB 3KUYD 2FJ7C 3WA9C 3LJAD 4KGCD 5B1LA 4KUDC 5B1MD 3AZMA 4AWLC 3NQUB 4G92C 4J8VD 3UTAB 3TU4B 3AZFC 2PYOA 1P3MB 4J8UB 1F66A 3W97C 4DRBA 3B6FB 2AROC 3WKJB 3MGSA 3AV1C 2NQBB 3P5JB 3MGRD 3RELB 1P3IA 1M1AB 3AZEB 3AZNC 1BH9B 3AZIA 5GT3A 2CV5A 2RVQC 3IP4C 3EPLA 2L5AA 5AVBA 3AZJD 4XZQA 3MGSC 3WTPA 3AYWC 5GT0B 3WAAA 5GXQB 3AN2B 3EPJA 1P3OB 5AV5A 3NQUA 3MVDD 1P3GA 4J8XA 1HQ3C 1ZLAC 3REHB 2LY8A 5JRGB 4H9OA 3MNNC 3EG5B 2RIQA 4XUJA 5E5AA 4R8PD 5GSUD 4YM6D 3KWQA 2HIOD 4QLCC 1P3FD 3B6FA 4Z66D 5AV6D 4WU9D 1P3PB 5F99D 3RELA 5B0YA 1KX5A 3UTAC 3TU4C 2ZY5A 3REID 3W98A 1P3MC 4J8UC 3AZKA 3B6FC 5B24D 3WKJC 2NQBC 2G5IC 3X1TD 3X1SD 5GXQA 3AFAA 3RELC 3AZEC 3AN2A 2XD5A 1M1AC 1EQZD 5BNVB 2UWXA 4Z5TD 5B2IA 4H9SC 1M19A 1TZYA 5JRGA 3REJB 4J8WD 4ZUXD 5BO0A 5GT0C 3LELA 5CPIA 5B0ZD 3C1CB 5DNMD 3O62D 1U35B 1P3BD 1P34A 1P3OC 4M6BA 3A6NA 2F8ND 2BYKA 2IO5B 4WU8B 5CPJD 3A1IA 3KXBD 3REHC 3REKB 5JRGC 5B2JD 3VH6A 5B40D 1KX3B 3X1UB 4E45A 5CPKA 1ID3D 5FUGB 4YS3B 1P3PC 3MGQB 1S32A 2CWEA 1P3AB 3AZGD 1KX4B 4NE5A 3WA9D 5CP6A 1A7WA 3UTBD 3REJA 3VH6T 3MGPA 4JJND 3AZLD 5B31D 5DNND 3W99D 3C1CA 3AZHD 4LD9C 2F8NK 1WWSA 3B6GA 4NE6A 3V9RB 5B1LD 1P3LD 5JA4A 3B0CT 3AZMD 3C1CC 1U35C 3C1BB 5AY8C 1Z2CB 2IO5C 4WNNB 3LZ1B 3MGQA 3REKC 4WU8C 2FJ7A 4KHAB 2PYOD 1F66D 4ZBJB 4KUDA 1P3AA 1KX3C 3X1UC 1KX4A 4E44A 3MGSD 5C3IB 4YS3C 1P3ID 4DRAA 3AZID 3R45A 3AZFA 3MGQC 5GT3D 2CV5D 2NZDB 3W97A 5AVBD 1P3AC 3LZ0B 4QLCB 2AROA 1KX4C 3AV1A 4CAYB 4XZQD 3WTPD 1P3KB 3UT9B 3WAAD 3H0LC 3NQJB 1T3UA 3AV2D 5AV9B 3AZNA 4X23B 2YFWB 5AV5D 1BH8B 1H3OB 1P3GD 1AOIB 4J8XD 5AVCC 1HTAA 3W96B 3KUYB 3AYWA 3LJAB 4KHAA 4XUJD 5E5AD 5G49B 3KWQD 5B1MB 3B6FD 1HQ3A 3C1BC 1KX5D 5B0YD 4H9PA 5BT1C 1ZLAA 3LZ1C 3MNNA 5AV8C 4NE3A 3W98D 2NZDA 2JCHA 4ZBJC 4EO5B 2JSSA 3AZKD 4QLCA 3VH5A 4CAYA 3MGRB
chains in the Genus database with same CATH topology
5C3IC 3NQJA 5GXQD 3AFAD 3AN2D 4X23A 3UTAA 5BS7C 3TU4A 1AOIA 3W96A 2NZDC 1P3MA 4J8UA 2G5HC 5B2ID 2BYMB 3LZ0C 1M19D 3WKJA 1TZYD 5JRGD 2NQBA 1P3KC 3LELD 3UT9C 5CPID 1M1AA 3AZEA 5AV9C 1BH9A 3VH5T 4X23C 1P34D 3MVDB 1M18D 3KFUG 3KSYA 3A6ND 1AOIC 2ZY2A 3W96C 4H9SA 1ULYA 3KUYC 5GT0A 4R8PB 3LJAC 5GSUB 1WWIA 4YM6B 2ZY4A 2HIOB 4LD9B 5B1MC 5CPKD 1P3OA 4Z66B 4WU9B 4UUZB 5F99B 1R4VA 3EPKA 3REHA 3REIB 5BNXB 1S32D 4EO5C 5B33D 5B24B 5CP6D 5AY8B 3REJD 1Q9CA 1P3PA 3MGRC 3MGPD 2DQNC 3X1SB 3X1TB 1TAFB 1EQZB 1F1EA 3B6GD 3B0CW 4Z5TB 2HUEB 1KU5A 4J8WB 4ZUXB 5KDMB 5B0ZB 4LD9A 5DNMB 3O62B 1P3BB 2YFVB 2DF4C 3MVDC 5BNVA 3X1VD 3EPHA 5CPJB 3KXBB 2FJ7D 3MGQD 1JFIB 3REIA 5B2JB 4R8PC 5B40B 1P3AD 5GSUC 4YM6C 4KUDD 2HIOC 1KX4D 1U35A 1ID3B 4Z66C 5AY8A 4WU9C 4G91B 5AVCB 5F99C 1BFMA 3X1TA 1TAFA 2Y2PA 4WU8A 3REKA 3AZFD 3B0DB 3W97D 3REIC 3FDDA 1KX3A 3X1UA 2AROD 3AV1D 5B24C 5FUGA 3UTBB 4YS3A 5KDMA 4JJNB 3X1TC 1N1JB 3AZLB 3AZND 3X1SC 5DNNB 3W99B 3AZHB 5AV8B 1EQZC 2RVQD 4Z5TC 2HUEC 3AYWD 5B32G 5B1LB 1P3LB 4J8WC 4ZUXC 3AZMB 5B0ZC 5DNMC 3O62C 1P3BC 1HQ3D 5AVCA 5B32B 1ZLAD 3V9RA 5CPJC 3KXBC 3MNND 2PYOB 2NZDD 1F66B 5B2JC 5B40C 4QLCD 1ID3C 1P3IB 3C1BA 4G91C 4X23D 3UTAD 3AZIB 3TU4D 3AZHA 4WNNA 3LZ1A 2Y2IA 1AOID 5GT3B 3B0DC 5AV8A 2CV5B 4KGCB 3W96D 1P3MD 4J8UD 3VH5W 2Y2HA 3WKJD 4XZQB 3WTPB 2NQBD 3WAAB 4HGAB 3UTBC 4UPKA 3RELD 3AV2B 1P3LA 1M1AD 4WZSB 3AZED 4JJNC 4J8VB 4Z2MG 3AZLC 5BS7A 5B31C 5DNNC 3W99C 5AV5B 3AZHC 1P3GB 4J8XB 3F6TA 5B32A 3LZ0A 4H9OB 1P3KA 4H9QB 5GT0D 4XUJB 5E5AB 3UT9A 5B1LC 1P3LC 3KWQB 5AV9A 2XD1A 3AZMC 2YFWA 1P3OD 1BH8A 1H3OA 1KX5B 5B0YB 2FFFB 2Y2MA 5B32C 3AL0C 3REHD 2J8PA 3AZJB 4Z2MH 2W8SA 3KUYA 3LJAA 3W98B 2Y2NA 2PYOC 4KGCA 1F66C 5G49A 3AZKB 5B1MA 1P3PD 1P3IC 3AFAB 3AV2A 4J8VA 3AZIC 5GT3C 2CV5C 4KGCC 1B6WA 5B2IB 5AVBC 1M19B 1P3FB 1TZYB 4XZQC 5AV6B 3WTPC 4H9QA 5BO0B 3LELB 3WAAC 4HGAC 4CSRB 3MGRA 5CPIB 3AV2C 4LD9D 4J8VC 1P34B 1M18B 5AV5C 3A6NB 3VH6W 1P3GC 2ZM5A 4J8XC 2BYKB 2BYMA 3AZJA 4XUJC 5E5AC 3KWQC 1W2EA 3C1CD 5CPKB 1U35D 3MVDA 2F2AC 5AY8D 1KX5C 5B0YC 2Y2KA 4WU8D 3REKD 3AZJC 1S32B 4R8PA 2F8NG 3W98C 5GSUA 4YM6A 1KX3D 2HIOA 3X1UD 5B33B 3AZKC 1P3FA 5CP6B 4YS3D 5AV6A 4Z66A 4WU9A 4UUZA 5F99A 4CSRA 3MGPB 5GXQC 3AFAC 2Y2OA 3AN2C 2F8NB 1M18A 4H9RB 3B6GB 5BNXA 5B2IC 4NFTA 1M19C 5B24A 1P3FC 1TZYC 5AV6C 3LELC 3A1KA 5JA4B 3X1SA 5CPIC 2F8NH 1P34C 1M18C 1EQZA 3A6NC 5AVCD 5B31G 3X1VB 4Z5TA 3AZGB 4H9NB 2FJ7B 1B67A 3WA9B 4J8WA 4ZUXA 4KUDB 2BG1A 2Y2QA 5B31B 5B0ZA 4AWLB 5B33A 5DNMA 3O62A 5CPKC 1P3BA 2YFVA 4WJ3C 3C1BD 2JE5A 4G92B 5BT1D 2F8NA 3R45B 3LZ1D 3KXBA 4H9RA 3AZFB 5AV8D 5CPJA 1JFIA 3W97B 5B2JA 1S32C 5B40A 2AROB 3AV1B 5B33C 1ID3A 5CP6C 3REJC 3MGPC 3AZNB 2Y2GA 2ZY3A 1PZRA 5B32D 3B6GC 3X1VA 3AZGA 3LZ0D 2VQRA 4H9NA 2Y2LA 3MGSB 3AYWB 3H0MC 3WA9A 1P3KD 3UTBA 3UT9D 4WV4B 3H0RC 5AV9D 4JJNA 1N1JA 3AZLA 5B31A 5DNNA 4DQYB 3W99A 1HQ3B 2Y2JA 3B0BA 3WTPE 4H9PB 1ZLAB 5AVBB 3X1VC 3AZGC 5CHLB 3MNNB 3KUYD 2FJ7C 3WA9C 3LJAD 4KGCD 5B1LA 4KUDC 5B1MD 3AZMA 4AWLC 3NQUB 4G92C 4J8VD 3UTAB 3TU4B 3AZFC 2PYOA 1P3MB 4J8UB 1F66A 3W97C 4DRBA 3B6FB 2AROC 3WKJB 3MGSA 3AV1C 2NQBB 3P5JB 3MGRD 3RELB 1P3IA 1M1AB 3AZEB 3AZNC 1BH9B 3AZIA 5GT3A 2CV5A 2RVQC 3IP4C 3EPLA 2L5AA 5AVBA 3AZJD 4XZQA 3MGSC 3WTPA 3AYWC 5GT0B 3WAAA 5GXQB 3AN2B 3EPJA 1P3OB 5AV5A 3NQUA 3MVDD 1P3GA 4J8XA 1HQ3C 1ZLAC 3REHB 2LY8A 5JRGB 4H9OA 3MNNC 3EG5B 2RIQA 4XUJA 5E5AA 4R8PD 5GSUD 4YM6D 3KWQA 2HIOD 4QLCC 1P3FD 3B6FA 4Z66D 5AV6D 4WU9D 1P3PB 5F99D 3RELA 5B0YA 1KX5A 3UTAC 3TU4C 2ZY5A 3REID 3W98A 1P3MC 4J8UC 3AZKA 3B6FC 5B24D 3WKJC 2NQBC 2G5IC 3X1TD 3X1SD 5GXQA 3AFAA 3RELC 3AZEC 3AN2A 2XD5A 1M1AC 1EQZD 5BNVB 2UWXA 4Z5TD 5B2IA 4H9SC 1M19A 1TZYA 5JRGA 3REJB 4J8WD 4ZUXD 5BO0A 5GT0C 3LELA 5CPIA 5B0ZD 3C1CB 5DNMD 3O62D 1U35B 1P3BD 1P34A 1P3OC 4M6BA 3A6NA 2F8ND 2BYKA 2IO5B 4WU8B 5CPJD 3A1IA 3KXBD 3REHC 3REKB 5JRGC 5B2JD 3VH6A 5B40D 1KX3B 3X1UB 4E45A 5CPKA 1ID3D 5FUGB 4YS3B 1P3PC 3MGQB 1S32A 2CWEA 1P3AB 3AZGD 1KX4B 4NE5A 3WA9D 5CP6A 1A7WA 3UTBD 3REJA 3VH6T 3MGPA 4JJND 3AZLD 5B31D 5DNND 3W99D 3C1CA 3AZHD 4LD9C 2F8NK 1WWSA 3B6GA 4NE6A 3V9RB 5B1LD 1P3LD 5JA4A 3B0CT 3AZMD 3C1CC 1U35C 3C1BB 5AY8C 1Z2CB 2IO5C 4WNNB 3LZ1B 3MGQA 3REKC 4WU8C 2FJ7A 4KHAB 2PYOD 1F66D 4ZBJB 4KUDA 1P3AA 1KX3C 3X1UC 1KX4A 4E44A 3MGSD 5C3IB 4YS3C 1P3ID 4DRAA 3AZID 3R45A 3AZFA 3MGQC 5GT3D 2CV5D 2NZDB 3W97A 5AVBD 1P3AC 3LZ0B 4QLCB 2AROA 1KX4C 3AV1A 4CAYB 4XZQD 3WTPD 1P3KB 3UT9B 3WAAD 3H0LC 3NQJB 1T3UA 3AV2D 5AV9B 3AZNA 4X23B 2YFWB 5AV5D 1BH8B 1H3OB 1P3GD 1AOIB 4J8XD 5AVCC 1HTAA 3W96B 3KUYB 3AYWA 3LJAB 4KHAA 4XUJD 5E5AD 5G49B 3KWQD 5B1MB 3B6FD 1HQ3A 3C1BC 1KX5D 5B0YD 4H9PA 5BT1C 1ZLAA 3LZ1C 3MNNA 5AV8C 4NE3A 3W98D 2NZDA 2JCHA 4ZBJC 4EO5B 2JSSA 3AZKD 4QLCA 3VH5A 4CAYA 3MGRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I C;  3NQJ A;  5GXQ D;  3AFA D;  3AN2 D;  4X23 A;  3UTA A;  5BS7 C;  3TU4 A;  1AOI A;  3W96 A;  2NZD C;  1P3M A;  4J8U A;  5B2I D;  2BYM B;  3LZ0 C;  1M19 D;  3WKJ A;  1TZY D;  5JRG D;  2NQB A;  1P3K C;  3LEL D;  3UT9 C;  5CPI D;  1M1A A;  3AZE A;  5AV9 C;  1BH9 A;  3VH5 T;  4X23 C;  1P34 D;  3MVD B;  1M18 D;  3KSY A;  3A6N D;  1AOI C;  3W96 C;  4H9S A;  1ULY A;  3KUY C;  5GT0 A;  4R8P B;  3LJA C;  5GSU B;  1WWI A;  4YM6 B;  2HIO B;  4LD9 B;  5B1M C;  5CPK D;  1P3O A;  4Z66 B;  4WU9 B;  4UUZ B;  5F99 B;  1R4V A;  3REH A;  3REI B;  5BNX B;  1S32 D;  4EO5 C;  5B33 D;  5B24 B;  5CP6 D;  5AY8 B;  3REJ D;  1Q9C A;  1P3P A;  3MGR C;  3MGP D;  3X1S B;  3X1T B;  1TAF B;  1EQZ B;  1F1E A;  3B6G D;  3B0C W;  4Z5T B;  2HUE B;  1KU5 A;  4J8W B;  4ZUX B;  5KDM B;  5B0Z B;  4LD9 A;  5DNM B;  3O62 B;  1P3B B;  2YFV B;  3MVD C;  5BNV A;  3X1V D;  5CPJ B;  3KXB B;  2FJ7 D;  3MGQ D;  1JFI B;  3REI A;  5B2J B;  4R8P C;  5B40 B;  1P3A D;  5GSU C;  4YM6 C;  4KUD D;  2HIO C;  1KX4 D;  1U35 A;  1ID3 B;  4Z66 C;  5AY8 A;  4WU9 C;  4G91 B;  5AVC B;  5F99 C;  1BFM A;  3X1T A;  1TAF A;  4WU8 A;  3REK A;  3AZF D;  3B0D B;  3W97 D;  3REI C;  1KX3 A;  3X1U A;  2ARO D;  3AV1 D;  5B24 C;  5FUG A;  3UTB B;  4YS3 A;  5KDM A;  4JJN B;  3X1T C;  1N1J B;  3AZL B;  3AZN D;  3X1S C;  5DNN B;  3W99 B;  3AZH B;  5AV8 B;  1EQZ C;  2RVQ D;  4Z5T C;  2HUE C;  3AYW D;  5B32 G;  5B1L B;  1P3L B;  4J8W C;  4ZUX C;  3AZM B;  5B0Z C;  5DNM C;  3O62 C;  1P3B C;  1HQ3 D;  5AVC A;  5B32 B;  1ZLA D;  3V9R A;  5CPJ C;  3KXB C;  3MNN D;  2PYO B;  2NZD D;  1F66 B;  5B2J C;  5B40 C;  4QLC D;  1ID3 C;  1P3I B;  3C1B A;  4G91 C;  4X23 D;  3UTA D;  3AZI B;  3TU4 D;  3AZH A;  4WNN A;  3LZ1 A;  1AOI D;  5GT3 B;  3B0D C;  5AV8 A;  2CV5 B;  4KGC B;  3W96 D;  1P3M D;  4J8U D;  3VH5 W;  3WKJ D;  4XZQ B;  3WTP B;  2NQB D;  3WAA B;  4HGA B;  3UTB C;  1P3L A;  3REL D;  3AV2 B;  1M1A D;  4WZS B;  3AZE D;  4JJN C;  4J8V B;  4Z2M G;  3AZL C;  5BS7 A;  5B31 C;  5DNN C;  3W99 C;  5AV5 B;  3AZH C;  1P3G B;  4J8X B;  5B32 A;  3LZ0 A;  4H9O B;  1P3K A;  4H9Q B;  5GT0 D;  4XUJ B;  5E5A B;  3UT9 A;  5B1L C;  1P3L C;  3KWQ B;  5AV9 A;  3AZM C;  2YFW A;  1P3O D;  1BH8 A;  1H3O A;  1KX5 B;  5B0Y B;  5B32 C;  3REH D;  3AZJ B;  4Z2M H;  3KUY A;  3LJA A;  3W98 B;  4KGC A;  2PYO C;  1F66 C;  5G49 A;  3AZK B;  5B1M A;  1P3P D;  1P3I C;  3AFA B;  3AV2 A;  4J8V A;  3AZI C;  5GT3 C;  2CV5 C;  4KGC C;  1B6W A;  5B2I B;  5AVB C;  1M19 B;  1P3F B;  1TZY B;  4XZQ C;  5AV6 B;  3WTP C;  4H9Q A;  5BO0 B;  3LEL B;  3WAA C;  4HGA C;  4CSR B;  3MGR A;  5CPI B;  3AV2 C;  4LD9 D;  4J8V C;  1P34 B;  1M18 B;  5AV5 C;  3A6N B;  3VH6 W;  1P3G C;  4J8X C;  2BYK B;  2BYM A;  3AZJ A;  4XUJ C;  5E5A C;  3KWQ C;  3C1C D;  5CPK B;  1U35 D;  3MVD A;  5AY8 D;  1KX5 C;  5B0Y C;  4WU8 D;  3REK D;  3AZJ C;  1S32 B;  4R8P A;  2F8N G;  3W98 C;  5GSU A;  4YM6 A;  1KX3 D;  2HIO A;  3X1U D;  5B33 B;  3AZK C;  1P3F A;  5CP6 B;  4Z66 A;  5AV6 A;  4YS3 D;  4WU9 A;  4UUZ A;  5F99 A;  4CSR A;  3MGP B;  5GXQ C;  3AFA C;  3AN2 C;  2F8N B;  1M18 A;  4H9R B;  3B6G B;  5BNX A;  5B2I C;  4NFT A;  1M19 C;  5B24 A;  1P3F C;  1TZY C;  5AV6 C;  3LEL C;  5JA4 B;  3X1S A;  5CPI C;  2F8N H;  1P34 C;  1M18 C;  1EQZ A;  3A6N C;  5AVC D;  5B31 G;  3X1V B;  4Z5T A;  3AZG B;  4H9N B;  2FJ7 B;  1B67 A;  3WA9 B;  4J8W A;  4ZUX A;  4KUD B;  5B0Z A;  5B31 B;  4AWL B;  5B33 A;  5DNM A;  3O62 A;  5CPK C;  1P3B A;  2YFV A;  3C1B D;  4G92 B;  5BT1 D;  2F8N A;  3R45 B;  3LZ1 D;  3KXB A;  4H9R A;  3AZF B;  5AV8 D;  5CPJ A;  1JFI A;  3W97 B;  5B2J A;  1S32 C;  5B40 A;  2ARO B;  3AV1 B;  5B33 C;  1ID3 A;  5CP6 C;  3REJ C;  3MGP C;  3AZN B;  5B32 D;  3B6G C;  3X1V A;  3AZG A;  3LZ0 D;  4H9N A;  3MGS B;  3AYW B;  3WA9 A;  1P3K D;  3UTB A;  3UT9 D;  4WV4 B;  4JJN A;  5AV9 D;  1N1J A;  3AZL A;  5B31 A;  5DNN A;  3W99 A;  1HQ3 B;  3B0B A;  3WTP E;  4H9P B;  1ZLA B;  5AVB B;  3X1V C;  3AZG C;  5CHL B;  3MNN B;  3KUY D;  2FJ7 C;  3WA9 C;  3LJA D;  4KGC D;  5B1L A;  4KUD C;  5B1M D;  3AZM A;  4AWL C;  3NQU B;  4G92 C;  4J8V D;  3UTA B;  3TU4 B;  3AZF C;  2PYO A;  1P3M B;  4J8U B;  1F66 A;  3W97 C;  4DRB A;  3B6F B;  2ARO C;  3WKJ B;  3MGS A;  3AV1 C;  2NQB B;  3MGR D;  1P3I A;  3REL B;  1M1A B;  3AZE B;  3AZN C;  1BH9 B;  3AZI A;  5GT3 A;  2CV5 A;  2RVQ C;  2L5A A;  5AVB A;  3AZJ D;  4XZQ A;  3MGS C;  3WTP A;  3AYW C;  5GT0 B;  3WAA A;  5GXQ B;  3AN2 B;  1P3O B;  5AV5 A;  3NQU A;  3MVD D;  1P3G A;  4J8X A;  1HQ3 C;  1ZLA C;  3REH B;  2LY8 A;  5JRG B;  4H9O A;  3MNN C;  4XUJ A;  5E5A A;  4R8P D;  5GSU D;  4YM6 D;  3KWQ A;  2HIO D;  4QLC C;  1P3F D;  3B6F A;  4Z66 D;  5AV6 D;  4WU9 D;  1P3P B;  5F99 D;  3REL A;  5B0Y A;  1KX5 A;  3UTA C;  3TU4 C;  3REI D;  3W98 A;  1P3M C;  4J8U C;  3AZK A;  3B6F C;  5B24 D;  3WKJ C;  2NQB C;  5GXQ A;  3X1T D;  3X1S D;  3AFA A;  3REL C;  3AZE C;  3AN2 A;  1M1A C;  1EQZ D;  5BNV B;  4Z5T D;  5B2I A;  4H9S C;  1M19 A;  1TZY A;  5JRG A;  3REJ B;  4J8W D;  4ZUX D;  5BO0 A;  5GT0 C;  3LEL A;  5CPI A;  5B0Z D;  3C1C B;  5DNM D;  3O62 D;  1U35 B;  1P3B D;  1P34 A;  1P3O C;  4M6B A;  3A6N A;  2F8N D;  2BYK A;  2IO5 B;  4WU8 B;  5CPJ D;  3REH C;  3KXB D;  3REK B;  5JRG C;  5B2J D;  3VH6 A;  5B40 D;  1KX3 B;  3X1U B;  4E45 A;  5CPK A;  1ID3 D;  5FUG B;  4YS3 B;  1P3P C;  3MGQ B;  1S32 A;  2CWE A;  1P3A B;  3AZG D;  1KX4 B;  4NE5 A;  3WA9 D;  5CP6 A;  1A7W A;  3UTB D;  3REJ A;  3VH6 T;  3MGP A;  4JJN D;  3AZL D;  5B31 D;  5DNN D;  3W99 D;  3C1C A;  3AZH D;  4LD9 C;  2F8N K;  1WWS A;  3B6G A;  4NE6 A;  3V9R B;  5B1L D;  1P3L D;  5JA4 A;  3B0C T;  3AZM D;  3C1C C;  1U35 C;  3C1B B;  5AY8 C;  2IO5 C;  4WNN B;  3LZ1 B;  3MGQ A;  3REK C;  4WU8 C;  2FJ7 A;  4KHA B;  2PYO D;  1F66 D;  4ZBJ B;  4KUD A;  1P3A A;  1KX3 C;  3X1U C;  1KX4 A;  4E44 A;  3MGS D;  4YS3 C;  5C3I B;  1P3I D;  4DRA A;  3AZI D;  3R45 A;  3AZF A;  3MGQ C;  5GT3 D;  2CV5 D;  2NZD B;  3W97 A;  5AVB D;  1P3A C;  3LZ0 B;  4QLC B;  2ARO A;  1KX4 C;  3AV1 A;  4CAY B;  4XZQ D;  3WTP D;  1P3K B;  3UT9 B;  3WAA D;  3NQJ B;  3AV2 D;  5AV9 B;  3AZN A;  4X23 B;  2YFW B;  5AV5 D;  1BH8 B;  1H3O B;  1P3G D;  1AOI B;  4J8X D;  5AVC C;  1HTA A;  3W96 B;  3KUY B;  3AYW A;  3LJA B;  4KHA A;  4XUJ D;  5E5A D;  5G49 B;  3KWQ D;  5B1M B;  3B6F D;  1HQ3 A;  3C1B C;  1KX5 D;  5B0Y D;  4H9P A;  5BT1 C;  1ZLA A;  3LZ1 C;  3MNN A;  5AV8 C;  4NE3 A;  3W98 D;  2NZD A;  4ZBJ C;  4EO5 B;  2JSS A;  3AZK D;  4QLC A;  3VH5 A;  4CAY A;  3MGR B; 
#chains in the Genus database with same CATH topology
 5C3I C;  3NQJ A;  5GXQ D;  3AFA D;  3AN2 D;  4X23 A;  3UTA A;  5BS7 C;  3TU4 A;  1AOI A;  3W96 A;  2NZD C;  1P3M A;  4J8U A;  2G5H C;  5B2I D;  2BYM B;  3LZ0 C;  1M19 D;  3WKJ A;  1TZY D;  5JRG D;  2NQB A;  1P3K C;  3LEL D;  3UT9 C;  5CPI D;  1M1A A;  3AZE A;  5AV9 C;  1BH9 A;  3VH5 T;  4X23 C;  1P34 D;  3MVD B;  1M18 D;  3KFU G;  3KSY A;  3A6N D;  1AOI C;  2ZY2 A;  3W96 C;  4H9S A;  1ULY A;  3KUY C;  5GT0 A;  4R8P B;  3LJA C;  5GSU B;  1WWI A;  4YM6 B;  2ZY4 A;  2HIO B;  4LD9 B;  5B1M C;  5CPK D;  1P3O A;  4Z66 B;  4WU9 B;  4UUZ B;  5F99 B;  1R4V A;  3EPK A;  3REH A;  3REI B;  5BNX B;  1S32 D;  4EO5 C;  5B33 D;  5B24 B;  5CP6 D;  5AY8 B;  3REJ D;  1Q9C A;  1P3P A;  3MGR C;  3MGP D;  2DQN C;  3X1S B;  3X1T B;  1TAF B;  1EQZ B;  1F1E A;  3B6G D;  3B0C W;  4Z5T B;  2HUE B;  1KU5 A;  4J8W B;  4ZUX B;  5KDM B;  5B0Z B;  4LD9 A;  5DNM B;  3O62 B;  1P3B B;  2YFV B;  2DF4 C;  3MVD C;  5BNV A;  3X1V D;  3EPH A;  5CPJ B;  3KXB B;  2FJ7 D;  3MGQ D;  1JFI B;  3REI A;  5B2J B;  4R8P C;  5B40 B;  1P3A D;  5GSU C;  4YM6 C;  4KUD D;  2HIO C;  1KX4 D;  1U35 A;  1ID3 B;  4Z66 C;  5AY8 A;  4WU9 C;  4G91 B;  5AVC B;  5F99 C;  1BFM A;  3X1T A;  1TAF A;  2Y2P A;  4WU8 A;  3REK A;  3AZF D;  3B0D B;  3W97 D;  3REI C;  3FDD A;  1KX3 A;  3X1U A;  2ARO D;  3AV1 D;  5B24 C;  5FUG A;  3UTB B;  4YS3 A;  5KDM A;  4JJN B;  3X1T C;  1N1J B;  3AZL B;  3AZN D;  3X1S C;  5DNN B;  3W99 B;  3AZH B;  5AV8 B;  1EQZ C;  2RVQ D;  4Z5T C;  2HUE C;  3AYW D;  5B32 G;  5B1L B;  1P3L B;  4J8W C;  4ZUX C;  3AZM B;  5B0Z C;  5DNM C;  3O62 C;  1P3B C;  1HQ3 D;  5AVC A;  5B32 B;  1ZLA D;  3V9R A;  5CPJ C;  3KXB C;  3MNN D;  2PYO B;  2NZD D;  1F66 B;  5B2J C;  5B40 C;  4QLC D;  1ID3 C;  1P3I B;  3C1B A;  4G91 C;  4X23 D;  3UTA D;  3AZI B;  3TU4 D;  3AZH A;  4WNN A;  3LZ1 A;  2Y2I A;  1AOI D;  5GT3 B;  3B0D C;  5AV8 A;  2CV5 B;  4KGC B;  3W96 D;  1P3M D;  4J8U D;  3VH5 W;  2Y2H A;  3WKJ D;  4XZQ B;  3WTP B;  2NQB D;  3WAA B;  4HGA B;  3UTB C;  4UPK A;  3REL D;  3AV2 B;  1P3L A;  1M1A D;  4WZS B;  3AZE D;  4JJN C;  4J8V B;  4Z2M G;  3AZL C;  5BS7 A;  5B31 C;  5DNN C;  3W99 C;  5AV5 B;  3AZH C;  1P3G B;  4J8X B;  3F6T A;  5B32 A;  3LZ0 A;  4H9O B;  1P3K A;  4H9Q B;  5GT0 D;  4XUJ B;  5E5A B;  3UT9 A;  5B1L C;  1P3L C;  3KWQ B;  5AV9 A;  2XD1 A;  3AZM C;  2YFW A;  1P3O D;  1BH8 A;  1H3O A;  1KX5 B;  5B0Y B;  2FFF B;  2Y2M A;  5B32 C;  3AL0 C;  3REH D;  2J8P A;  3AZJ B;  4Z2M H;  2W8S A;  3KUY A;  3LJA A;  3W98 B;  2Y2N A;  2PYO C;  4KGC A;  1F66 C;  5G49 A;  3AZK B;  5B1M A;  1P3P D;  1P3I C;  3AFA B;  3AV2 A;  4J8V A;  3AZI C;  5GT3 C;  2CV5 C;  4KGC C;  1B6W A;  5B2I B;  5AVB C;  1M19 B;  1P3F B;  1TZY B;  4XZQ C;  5AV6 B;  3WTP C;  4H9Q A;  5BO0 B;  3LEL B;  3WAA C;  4HGA C;  4CSR B;  3MGR A;  5CPI B;  3AV2 C;  4LD9 D;  4J8V C;  1P34 B;  1M18 B;  5AV5 C;  3A6N B;  3VH6 W;  1P3G C;  2ZM5 A;  4J8X C;  2BYK B;  2BYM A;  3AZJ A;  4XUJ C;  5E5A C;  3KWQ C;  1W2E A;  3C1C D;  5CPK B;  1U35 D;  3MVD A;  2F2A C;  5AY8 D;  1KX5 C;  5B0Y C;  2Y2K A;  4WU8 D;  3REK D;  3AZJ C;  1S32 B;  4R8P A;  2F8N G;  3W98 C;  5GSU A;  4YM6 A;  1KX3 D;  2HIO A;  3X1U D;  5B33 B;  3AZK C;  1P3F A;  5CP6 B;  4YS3 D;  5AV6 A;  4Z66 A;  4WU9 A;  4UUZ A;  5F99 A;  4CSR A;  3MGP B;  5GXQ C;  3AFA C;  2Y2O A;  3AN2 C;  2F8N B;  1M18 A;  4H9R B;  3B6G B;  5BNX A;  5B2I C;  4NFT A;  1M19 C;  5B24 A;  1P3F C;  1TZY C;  5AV6 C;  3LEL C;  3A1K A;  5JA4 B;  3X1S A;  5CPI C;  2F8N H;  1P34 C;  1M18 C;  1EQZ A;  3A6N C;  5AVC D;  5B31 G;  3X1V B;  4Z5T A;  3AZG B;  4H9N B;  2FJ7 B;  1B67 A;  3WA9 B;  4J8W A;  4ZUX A;  4KUD B;  2BG1 A;  2Y2Q A;  5B31 B;  5B0Z A;  4AWL B;  5B33 A;  5DNM A;  3O62 A;  5CPK C;  1P3B A;  2YFV A;  4WJ3 C;  3C1B D;  2JE5 A;  4G92 B;  5BT1 D;  2F8N A;  3R45 B;  3LZ1 D;  3KXB A;  4H9R A;  3AZF B;  5AV8 D;  5CPJ A;  1JFI A;  3W97 B;  5B2J A;  1S32 C;  5B40 A;  2ARO B;  3AV1 B;  5B33 C;  1ID3 A;  5CP6 C;  3REJ C;  3MGP C;  3AZN B;  2Y2G A;  2ZY3 A;  1PZR A;  5B32 D;  3B6G C;  3X1V A;  3AZG A;  3LZ0 D;  2VQR A;  4H9N A;  2Y2L A;  3MGS B;  3AYW B;  3H0M C;  3WA9 A;  1P3K D;  3UTB A;  3UT9 D;  4WV4 B;  3H0R C;  5AV9 D;  4JJN A;  1N1J A;  3AZL A;  5B31 A;  5DNN A;  4DQY B;  3W99 A;  1HQ3 B;  2Y2J A;  3B0B A;  3WTP E;  4H9P B;  1ZLA B;  5AVB B;  3X1V C;  3AZG C;  5CHL B;  3MNN B;  3KUY D;  2FJ7 C;  3WA9 C;  3LJA D;  4KGC D;  5B1L A;  4KUD C;  5B1M D;  3AZM A;  4AWL C;  3NQU B;  4G92 C;  4J8V D;  3UTA B;  3TU4 B;  3AZF C;  2PYO A;  1P3M B;  4J8U B;  1F66 A;  3W97 C;  4DRB A;  3B6F B;  2ARO C;  3WKJ B;  3MGS A;  3AV1 C;  2NQB B;  3P5J B;  3MGR D;  3REL B;  1P3I A;  1M1A B;  3AZE B;  3AZN C;  1BH9 B;  3AZI A;  5GT3 A;  2CV5 A;  2RVQ C;  3IP4 C;  3EPL A;  2L5A A;  5AVB A;  3AZJ D;  4XZQ A;  3MGS C;  3WTP A;  3AYW C;  5GT0 B;  3WAA A;  5GXQ B;  3AN2 B;  3EPJ A;  1P3O B;  5AV5 A;  3NQU A;  3MVD D;  1P3G A;  4J8X A;  1HQ3 C;  1ZLA C;  3REH B;  2LY8 A;  5JRG B;  4H9O A;  3MNN C;  3EG5 B;  2RIQ A;  4XUJ A;  5E5A A;  4R8P D;  5GSU D;  4YM6 D;  3KWQ A;  2HIO D;  4QLC C;  1P3F D;  3B6F A;  4Z66 D;  5AV6 D;  4WU9 D;  1P3P B;  5F99 D;  3REL A;  5B0Y A;  1KX5 A;  3UTA C;  3TU4 C;  2ZY5 A;  3REI D;  3W98 A;  1P3M C;  4J8U C;  3AZK A;  3B6F C;  5B24 D;  3WKJ C;  2NQB C;  2G5I C;  3X1T D;  3X1S D;  5GXQ A;  3AFA A;  3REL C;  3AZE C;  3AN2 A;  2XD5 A;  1M1A C;  1EQZ D;  5BNV B;  2UWX A;  4Z5T D;  5B2I A;  4H9S C;  1M19 A;  1TZY A;  5JRG A;  3REJ B;  4J8W D;  4ZUX D;  5BO0 A;  5GT0 C;  3LEL A;  5CPI A;  5B0Z D;  3C1C B;  5DNM D;  3O62 D;  1U35 B;  1P3B D;  1P34 A;  1P3O C;  4M6B A;  3A6N A;  2F8N D;  2BYK A;  2IO5 B;  4WU8 B;  5CPJ D;  3A1I A;  3KXB D;  3REH C;  3REK B;  5JRG C;  5B2J D;  3VH6 A;  5B40 D;  1KX3 B;  3X1U B;  4E45 A;  5CPK A;  1ID3 D;  5FUG B;  4YS3 B;  1P3P C;  3MGQ B;  1S32 A;  2CWE A;  1P3A B;  3AZG D;  1KX4 B;  4NE5 A;  3WA9 D;  5CP6 A;  1A7W A;  3UTB D;  3REJ A;  3VH6 T;  3MGP A;  4JJN D;  3AZL D;  5B31 D;  5DNN D;  3W99 D;  3C1C A;  3AZH D;  4LD9 C;  2F8N K;  1WWS A;  3B6G A;  4NE6 A;  3V9R B;  5B1L D;  1P3L D;  5JA4 A;  3B0C T;  3AZM D;  3C1C C;  1U35 C;  3C1B B;  5AY8 C;  1Z2C B;  2IO5 C;  4WNN B;  3LZ1 B;  3MGQ A;  3REK C;  4WU8 C;  2FJ7 A;  4KHA B;  2PYO D;  1F66 D;  4ZBJ B;  4KUD A;  1P3A A;  1KX3 C;  3X1U C;  1KX4 A;  4E44 A;  3MGS D;  5C3I B;  4YS3 C;  1P3I D;  4DRA A;  3AZI D;  3R45 A;  3AZF A;  3MGQ C;  5GT3 D;  2CV5 D;  2NZD B;  3W97 A;  5AVB D;  1P3A C;  3LZ0 B;  4QLC B;  2ARO A;  1KX4 C;  3AV1 A;  4CAY B;  4XZQ D;  3WTP D;  1P3K B;  3UT9 B;  3WAA D;  3H0L C;  3NQJ B;  1T3U A;  3AV2 D;  5AV9 B;  3AZN A;  4X23 B;  2YFW B;  5AV5 D;  1BH8 B;  1H3O B;  1P3G D;  1AOI B;  4J8X D;  5AVC C;  1HTA A;  3W96 B;  3KUY B;  3AYW A;  3LJA B;  4KHA A;  4XUJ D;  5E5A D;  5G49 B;  3KWQ D;  5B1M B;  3B6F D;  1HQ3 A;  3C1B C;  1KX5 D;  5B0Y D;  4H9P A;  5BT1 C;  1ZLA A;  3LZ1 C;  3MNN A;  5AV8 C;  4NE3 A;  3W98 D;  2NZD A;  2JCH A;  4ZBJ C;  4EO5 B;  2JSS A;  3AZK D;  4QLC A;  3VH5 A;  4CAY A;  3MGR B; 
#chains in the Genus database with same CATH homology
 5C3I C;  3NQJ A;  5GXQ D;  3AFA D;  3AN2 D;  4X23 A;  3UTA A;  5BS7 C;  3TU4 A;  1AOI A;  3W96 A;  2NZD C;  1P3M A;  4J8U A;  2G5H C;  5B2I D;  2BYM B;  3LZ0 C;  1M19 D;  3WKJ A;  1TZY D;  5JRG D;  2NQB A;  1P3K C;  3LEL D;  3UT9 C;  5CPI D;  1M1A A;  3AZE A;  5AV9 C;  1BH9 A;  3VH5 T;  4X23 C;  1P34 D;  3MVD B;  1M18 D;  3KFU G;  3KSY A;  3A6N D;  1AOI C;  2ZY2 A;  3W96 C;  4H9S A;  1ULY A;  3KUY C;  5GT0 A;  4R8P B;  3LJA C;  5GSU B;  1WWI A;  4YM6 B;  2ZY4 A;  2HIO B;  4LD9 B;  5B1M C;  5CPK D;  1P3O A;  4Z66 B;  4WU9 B;  4UUZ B;  5F99 B;  1R4V A;  3EPK A;  3REH A;  3REI B;  5BNX B;  1S32 D;  4EO5 C;  5B33 D;  5B24 B;  5CP6 D;  5AY8 B;  3REJ D;  1Q9C A;  1P3P A;  3MGR C;  3MGP D;  2DQN C;  3X1S B;  3X1T B;  1TAF B;  1EQZ B;  1F1E A;  3B6G D;  3B0C W;  4Z5T B;  2HUE B;  1KU5 A;  4J8W B;  4ZUX B;  5KDM B;  5B0Z B;  4LD9 A;  5DNM B;  3O62 B;  1P3B B;  2YFV B;  2DF4 C;  3MVD C;  5BNV A;  3X1V D;  3EPH A;  5CPJ B;  3KXB B;  2FJ7 D;  3MGQ D;  1JFI B;  3REI A;  5B2J B;  4R8P C;  5B40 B;  1P3A D;  5GSU C;  4YM6 C;  4KUD D;  2HIO C;  1KX4 D;  1U35 A;  1ID3 B;  4Z66 C;  5AY8 A;  4WU9 C;  4G91 B;  5AVC B;  5F99 C;  1BFM A;  3X1T A;  1TAF A;  2Y2P A;  4WU8 A;  3REK A;  3AZF D;  3B0D B;  3W97 D;  3REI C;  3FDD A;  1KX3 A;  3X1U A;  2ARO D;  3AV1 D;  5B24 C;  5FUG A;  3UTB B;  4YS3 A;  5KDM A;  4JJN B;  3X1T C;  1N1J B;  3AZL B;  3AZN D;  3X1S C;  5DNN B;  3W99 B;  3AZH B;  5AV8 B;  1EQZ C;  2RVQ D;  4Z5T C;  2HUE C;  3AYW D;  5B32 G;  5B1L B;  1P3L B;  4J8W C;  4ZUX C;  3AZM B;  5B0Z C;  5DNM C;  3O62 C;  1P3B C;  1HQ3 D;  5AVC A;  5B32 B;  1ZLA D;  3V9R A;  5CPJ C;  3KXB C;  3MNN D;  2PYO B;  2NZD D;  1F66 B;  5B2J C;  5B40 C;  4QLC D;  1ID3 C;  1P3I B;  3C1B A;  4G91 C;  4X23 D;  3UTA D;  3AZI B;  3TU4 D;  3AZH A;  4WNN A;  3LZ1 A;  2Y2I A;  1AOI D;  5GT3 B;  3B0D C;  5AV8 A;  2CV5 B;  4KGC B;  3W96 D;  1P3M D;  4J8U D;  3VH5 W;  2Y2H A;  3WKJ D;  4XZQ B;  3WTP B;  2NQB D;  3WAA B;  4HGA B;  3UTB C;  4UPK A;  3REL D;  3AV2 B;  1P3L A;  1M1A D;  4WZS B;  3AZE D;  4JJN C;  4J8V B;  4Z2M G;  3AZL C;  5BS7 A;  5B31 C;  5DNN C;  3W99 C;  5AV5 B;  3AZH C;  1P3G B;  4J8X B;  3F6T A;  5B32 A;  3LZ0 A;  4H9O B;  1P3K A;  4H9Q B;  5GT0 D;  4XUJ B;  5E5A B;  3UT9 A;  5B1L C;  1P3L C;  3KWQ B;  5AV9 A;  2XD1 A;  3AZM C;  2YFW A;  1P3O D;  1BH8 A;  1H3O A;  1KX5 B;  5B0Y B;  2FFF B;  2Y2M A;  5B32 C;  3AL0 C;  3REH D;  2J8P A;  3AZJ B;  4Z2M H;  2W8S A;  3KUY A;  3LJA A;  3W98 B;  2Y2N A;  2PYO C;  4KGC A;  1F66 C;  5G49 A;  3AZK B;  5B1M A;  1P3P D;  1P3I C;  3AFA B;  3AV2 A;  4J8V A;  3AZI C;  5GT3 C;  2CV5 C;  4KGC C;  1B6W A;  5B2I B;  5AVB C;  1M19 B;  1P3F B;  1TZY B;  4XZQ C;  5AV6 B;  3WTP C;  4H9Q A;  5BO0 B;  3LEL B;  3WAA C;  4HGA C;  4CSR B;  3MGR A;  5CPI B;  3AV2 C;  4LD9 D;  4J8V C;  1P34 B;  1M18 B;  5AV5 C;  3A6N B;  3VH6 W;  1P3G C;  2ZM5 A;  4J8X C;  2BYK B;  2BYM A;  3AZJ A;  4XUJ C;  5E5A C;  3KWQ C;  1W2E A;  3C1C D;  5CPK B;  1U35 D;  3MVD A;  2F2A C;  5AY8 D;  1KX5 C;  5B0Y C;  2Y2K A;  4WU8 D;  3REK D;  3AZJ C;  1S32 B;  4R8P A;  2F8N G;  3W98 C;  5GSU A;  4YM6 A;  1KX3 D;  2HIO A;  3X1U D;  5B33 B;  3AZK C;  1P3F A;  5CP6 B;  4YS3 D;  5AV6 A;  4Z66 A;  4WU9 A;  4UUZ A;  5F99 A;  4CSR A;  3MGP B;  5GXQ C;  3AFA C;  2Y2O A;  3AN2 C;  2F8N B;  1M18 A;  4H9R B;  3B6G B;  5BNX A;  5B2I C;  4NFT A;  1M19 C;  5B24 A;  1P3F C;  1TZY C;  5AV6 C;  3LEL C;  3A1K A;  5JA4 B;  3X1S A;  5CPI C;  2F8N H;  1P34 C;  1M18 C;  1EQZ A;  3A6N C;  5AVC D;  5B31 G;  3X1V B;  4Z5T A;  3AZG B;  4H9N B;  2FJ7 B;  1B67 A;  3WA9 B;  4J8W A;  4ZUX A;  4KUD B;  2BG1 A;  2Y2Q A;  5B31 B;  5B0Z A;  4AWL B;  5B33 A;  5DNM A;  3O62 A;  5CPK C;  1P3B A;  2YFV A;  4WJ3 C;  3C1B D;  2JE5 A;  4G92 B;  5BT1 D;  2F8N A;  3R45 B;  3LZ1 D;  3KXB A;  4H9R A;  3AZF B;  5AV8 D;  5CPJ A;  1JFI A;  3W97 B;  5B2J A;  1S32 C;  5B40 A;  2ARO B;  3AV1 B;  5B33 C;  1ID3 A;  5CP6 C;  3REJ C;  3MGP C;  3AZN B;  2Y2G A;  2ZY3 A;  1PZR A;  5B32 D;  3B6G C;  3X1V A;  3AZG A;  3LZ0 D;  2VQR A;  4H9N A;  2Y2L A;  3MGS B;  3AYW B;  3H0M C;  3WA9 A;  1P3K D;  3UTB A;  3UT9 D;  4WV4 B;  3H0R C;  5AV9 D;  4JJN A;  1N1J A;  3AZL A;  5B31 A;  5DNN A;  4DQY B;  3W99 A;  1HQ3 B;  2Y2J A;  3B0B A;  3WTP E;  4H9P B;  1ZLA B;  5AVB B;  3X1V C;  3AZG C;  5CHL B;  3MNN B;  3KUY D;  2FJ7 C;  3WA9 C;  3LJA D;  4KGC D;  5B1L A;  4KUD C;  5B1M D;  3AZM A;  4AWL C;  3NQU B;  4G92 C;  4J8V D;  3UTA B;  3TU4 B;  3AZF C;  2PYO A;  1P3M B;  4J8U B;  1F66 A;  3W97 C;  4DRB A;  3B6F B;  2ARO C;  3WKJ B;  3MGS A;  3AV1 C;  2NQB B;  3P5J B;  3MGR D;  3REL B;  1P3I A;  1M1A B;  3AZE B;  3AZN C;  1BH9 B;  3AZI A;  5GT3 A;  2CV5 A;  2RVQ C;  3IP4 C;  3EPL A;  2L5A A;  5AVB A;  3AZJ D;  4XZQ A;  3MGS C;  3WTP A;  3AYW C;  5GT0 B;  3WAA A;  5GXQ B;  3AN2 B;  3EPJ A;  1P3O B;  5AV5 A;  3NQU A;  3MVD D;  1P3G A;  4J8X A;  1HQ3 C;  1ZLA C;  3REH B;  2LY8 A;  5JRG B;  4H9O A;  3MNN C;  3EG5 B;  2RIQ A;  4XUJ A;  5E5A A;  4R8P D;  5GSU D;  4YM6 D;  3KWQ A;  2HIO D;  4QLC C;  1P3F D;  3B6F A;  4Z66 D;  5AV6 D;  4WU9 D;  1P3P B;  5F99 D;  3REL A;  5B0Y A;  1KX5 A;  3UTA C;  3TU4 C;  2ZY5 A;  3REI D;  3W98 A;  1P3M C;  4J8U C;  3AZK A;  3B6F C;  5B24 D;  3WKJ C;  2NQB C;  2G5I C;  3X1T D;  3X1S D;  5GXQ A;  3AFA A;  3REL C;  3AZE C;  3AN2 A;  2XD5 A;  1M1A C;  1EQZ D;  5BNV B;  2UWX A;  4Z5T D;  5B2I A;  4H9S C;  1M19 A;  1TZY A;  5JRG A;  3REJ B;  4J8W D;  4ZUX D;  5BO0 A;  5GT0 C;  3LEL A;  5CPI A;  5B0Z D;  3C1C B;  5DNM D;  3O62 D;  1U35 B;  1P3B D;  1P34 A;  1P3O C;  4M6B A;  3A6N A;  2F8N D;  2BYK A;  2IO5 B;  4WU8 B;  5CPJ D;  3A1I A;  3KXB D;  3REH C;  3REK B;  5JRG C;  5B2J D;  3VH6 A;  5B40 D;  1KX3 B;  3X1U B;  4E45 A;  5CPK A;  1ID3 D;  5FUG B;  4YS3 B;  1P3P C;  3MGQ B;  1S32 A;  2CWE A;  1P3A B;  3AZG D;  1KX4 B;  4NE5 A;  3WA9 D;  5CP6 A;  1A7W A;  3UTB D;  3REJ A;  3VH6 T;  3MGP A;  4JJN D;  3AZL D;  5B31 D;  5DNN D;  3W99 D;  3C1C A;  3AZH D;  4LD9 C;  2F8N K;  1WWS A;  3B6G A;  4NE6 A;  3V9R B;  5B1L D;  1P3L D;  5JA4 A;  3B0C T;  3AZM D;  3C1C C;  1U35 C;  3C1B B;  5AY8 C;  1Z2C B;  2IO5 C;  4WNN B;  3LZ1 B;  3MGQ A;  3REK C;  4WU8 C;  2FJ7 A;  4KHA B;  2PYO D;  1F66 D;  4ZBJ B;  4KUD A;  1P3A A;  1KX3 C;  3X1U C;  1KX4 A;  4E44 A;  3MGS D;  5C3I B;  4YS3 C;  1P3I D;  4DRA A;  3AZI D;  3R45 A;  3AZF A;  3MGQ C;  5GT3 D;  2CV5 D;  2NZD B;  3W97 A;  5AVB D;  1P3A C;  3LZ0 B;  4QLC B;  2ARO A;  1KX4 C;  3AV1 A;  4CAY B;  4XZQ D;  3WTP D;  1P3K B;  3UT9 B;  3WAA D;  3H0L C;  3NQJ B;  1T3U A;  3AV2 D;  5AV9 B;  3AZN A;  4X23 B;  2YFW B;  5AV5 D;  1BH8 B;  1H3O B;  1P3G D;  1AOI B;  4J8X D;  5AVC C;  1HTA A;  3W96 B;  3KUY B;  3AYW A;  3LJA B;  4KHA A;  4XUJ D;  5E5A D;  5G49 B;  3KWQ D;  5B1M B;  3B6F D;  1HQ3 A;  3C1B C;  1KX5 D;  5B0Y D;  4H9P A;  5BT1 C;  1ZLA A;  3LZ1 C;  3MNN A;  5AV8 C;  4NE3 A;  3W98 D;  2NZD A;  2JCH A;  4ZBJ C;  4EO5 B;  2JSS A;  3AZK D;  4QLC A;  3VH5 A;  4CAY A;  3MGR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...