3AV1C

The human nucleosome structure containing the histone variant h3.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1C00
2NQBC 5CPJA 5CPKC 3X1SD 4Z66C 4YM6B 5B31D 1S32A 2CV5D 5B0ZA 1P3LA 3REHD 5CPIA 5GT0D 5BT1C 5AV9C 4J8WC 3AZGC 2RVQD 3O62C 4J8XA 3B0CW 3REHB 3B6FA 1P3OA 1P3AB 5AV9B 4Z5TD 1M1AB 3LELC 2BYKB 1P3BA 3W99C 1ID3D 5CHLB 5AY8D 3MGQC 3W99B 2FJ7A 3MGSD 5B24A 3AZJD 3LZ0D 1P3KC 3X1SA 3MGQB 5GT3D 5AY8B 1H3OB 5BO0A 4QLCC 4JJND 2CV5A 1P3KB 2AROD 2CWEA 3AZNC 3AZHA 1F66D 4R8PC 5B0YD 5GT0A 5B32C 3AZNB 3REJD 1F66B 4X23C 5AV6B 2F8NK 5JRGC 5B0YB 1WWIA 3WAAD 5B32B 4J8UB 4Z5TA 3REJB 5BNVA 3AN2D 5FUGB 4WNNB 5E5AA 3WAAB 1ID3A 4H9NA 3C1CC 3X1TD 3RELD 3MGSA 3AZJA 1ULYA 4CAYA 3LZ0A 5GT3A 3TU4A 4WU9B 3C1BC 5B33D 3RELB 2PYOB 3B0DC 4JJNA 3W97B 5F99D 5GSUD 2AROA 4DRAA 1AOID 3AZFB 5DNMA 1KX3C 3B0DB 5B33B 1P3GD 4EO5C 1P3IB 5GSUB 5B2JD 1P3MC 1B6WA 4M6BA 5B2IB 3REIB 4UUZA 1JFIB 1P3MB 1P3PC 3AN2A 5B1MC 1M19A 3B0CT 4XZQD 1ZLAC 3MVDD 3AZMC 4KUDD 5DNNC 3WA9D 3X1TA 4LD9A 5GXQD 1A7WA 1ZLAB 3VH5W 2HIOA 5AVBD 3AV1C 3WTPD 5B1LC 3WA9B 3AZLD 5F99A 4J8VC 3MGPB 3KXBC 5KDMB 1AOIA 3KUYC 3UTBB 1P3GA 3MNNA 4J8VB 4KHAA 3KXBB 5B2JA 3KWQB 4WU8C 1KX5A 1TZYB 5BNXA 3AYWD 3AZKA 3AV2B 1P3FD 3LZ1D 5AVCD 3W98C 5AV8D 4XZQA 4ZUXD 1U35D 3MVDA 3UTAC 1P3FB 3A6NC 4KUDA 4H9RA 4XUJC 3LJAB 1KX4D 3UT9B 5GXQA 3VH6T 4CSRA 4ZUXB 3AZIC 1P34D 1U35B 5AVBA 3WKJD 3WTPA 5JA4B 3X1VD 2YFWB 4KGCD 5CPJC 5BS7C 3AZIB 1P34B 3MGRC 3AZLA 4YM6D 1S32C 5AV5B 5B0ZC 5CPKD 1HQ3B 3NQJB 3MGRB 1P3LC 3V9RA 5CPIC 1BH8A 2NQBB 5CPKB 4AWLC 4J8XC 3AYWA 4Z66B 2LY8A 3LZ1A 1P3OC 5AVCA 1P3AD 5BT1D 5AV9D 5AV8A 1M1AD 1P3BC 1P3OB 4Z2MH 1N1JA 1KX4A 2IO5C 3NQUA 4J8WB 3AZGB 3O62B 3WKJA 3X1VA 5B24C 3W99D 4KGCA 3X1SC 3LELB 3MGQD 3VH5T 2F8ND 4YM6A 4H9QB 1P3KD 3AZHC 2F8NB 4QLCD 1R4VA 5B31A 3AZHB 4H9OB 3AZND 3X1UC 5AV6D 3REHA 4QLCB 1P3AA 5AV9A 5B32D 4J8UD 1M1AA 3X1UB 4R8PB 2BYKA 1Q9CA 4WV4B 5JRGD 5E5AC 1ID3C 5BNVB 4YS3C 4X23B 3VH6W 5E5AB 5JRGB 3MGSC 3AZJC 4H9SA 3LZ0C 1BFMA 2HUEC 3C1CD 4YS3B 3TU4C 4NE6A 3W96C 2NZDC 3MGQA 5AY8A 1H3OA 4WU9D 4CAYB 2PYOD 3W97D 2AROC 1P3KA 3C1CB 1EQZC 3W96B 2NZDB 5DNMC 4E44A 3AZFD 1EQZB 1TAFB 3AFAC 1P3ID 3AZNA 5CP6C 1F1EA 1F66A 3C1BB 5AV6A 5B2ID 3B6GC 3REID 5B0YA 3AFAB 5B31G 5B32A 4J8UA 5CP6B 1P3MD 3REJA 3B6GB 1M19C 1KX3B 5FUGA 4WNNA 1KU5A 4EO5B 3WAAA 3X1TC 4LD9C 1P3PD 1M19B 1BH9B 3REKC 3R45B 5B1MD 2HIOC 1ZLAD 4Z2MG 3AZMD 4LD9B 4NFTA 1P3PB 3REKB 5B1MB 4WU9A 3RELA 3KSYA 3AZMB 2PYOA 3W97A 5DNNB 1AOIC 3MGPD 3AZFA 3MNNC 3UTBD 5B33A 3AV1B 4J8VD 1P3IA 5B1LB 5GSUA 3KXBD 4ZBJC 1KX5C 3KUYD 3KWQD 5B2IA 3AZKC 1TZYD 2BYMB 3REIA 3AV2D 3AZEC 5B40C 1JFIA 4ZBJB 1P3MA 1KX5B 4XZQC 3KUYB 3AZKB 3MVDC 4KUDC 3AZEB 5B40B 2JSSA 5GXQC 3LJAD 3UT9D 4WU8B 3VH5A 1ZLAA 3A6ND 3WA9A 3W98B 1M18C 3AZID 3AZLC 2YFVB 3UTAB 3A6NB 4XUJB 4NE5A 3MGPA 4H9PB 1M18B 5KDMA 5AV5D 1HQ3D 3UTBA 3MGRD 5G49B 4J8VA 3KXBA 5B0ZD 5CPJB 3KWQA 2NQBD 1TZYA 4Z66D 5AVCC 3AV2A 1S32B 5AV8C 5B0ZB 1P3LB 4J8XD 5CPIB 1P3OD 3B6FC 1P3FA 1KX4C 4NE3A 3LJAA 3UT9A 4J8WD 3AZGD 4AWLB 4J8XB 4ZUXA 3O62D 5C3IC 1U35A 3B6FB 3WKJC 4KGCC 5JA4A 2YFWA 1P3BB 3AZIA 3LELD 2L5AA 1P34A 2FJ7C 2IO5B 5AV5A 5BS7A 1HQ3A 3NQJA 4DRBA 3MGRA 2F8NH 2FJ7B 5B31C 5B24B 2CV5C 3X1SB 3AZHD 2NQBA 5CPKA 4Z66A 3REHC 5B31B 5BO0B 2CV5B 5GT0C 1P3AC 1M1AC 2RVQC 3X1UD 4R8PD 4G92C 5GT0B 4Z5TC 4J8WA 3AZGA 3O62A 4X23D 4G92B 5E5AD 4H9SC 4Z5TB 4G91C 4YS3D 5AY8C 3LELA 3WTPE 4H9QA 1ID3B 4H9NB 4G91B 3W99A 3TU4D 3W96D 2NZDD 5GT3C 3MGSB 3AZJB 4JJNC 2F8NA 3LZ0B 2HUEB 1EQZD 5GT3B 3TU4B 4H9OA 5DNMD 1F66C 5AV6C 3C1BD 5B0YC 4JJNB 4QLCA 3AFAD 4J8UC 2AROB 3REJC 5CP6D 3X1UA 5DNMB 3B6GD 4R8PA 1KX3D 3WAAC 3B0BA 1M19D 3VH6A 4E45A 3AN2C 4X23A 4UUZB 5JRGA 4LD9D 4YS3A 3AN2B 3REKD 4WU9C 2HIOD 3RELC 2PYOC 3W97C 3X1TB 5DNND 3W96A 3C1CA 2NZDA 3AZFC 5B33C 2HIOB 1P3IC 5F99C 3AV1D 5GSUC 4WZSB 1EQZA 1TAFA 5B1LD 4HGAC 5B2IC 3MNND 3REIC 3C1BA 1P3GC 5F99B 2F8NG 3AFAA 4HGAB 1AOIB 5B2JC 5CP6A 1KX5D 3B6GA 1P3GB 3MNNB 3AZKD 1KX3A 4KHAB 3AZED 5B40D 5B2JB 1BH9A 3R45A 5BNXB 4WU8D 1B67A 3WA9C 5B32G 1P3PA 3REKA 3W98D 4XZQB 5B1MA 3MVDB 4KUDB 5AVBC 4H9RB 3WTPC 3UTAD 3AZMA 5DNNA 3MGPC 5GXQB 4XUJD 4CSRB 1M18D 3UTBC 5AVBB 3WTPB 3AV1A 5B1LA 3KWQC 5CPJD 1TZYC 3AZLB 2BYMA 3AV2C 1S32D 3KUYA 3V9RB 3AYWC 1P3LD 1P3FC 3LZ1C 3AZEA 5B40A 5CPID 3LJAC 1BH8B 3UT9C 1WWSA 3AYWB 4WU8A 4ZUXC 1U35C 3LZ1B 3B6FD 5AVCB 5AV8B 3W98A 1P34C 1HTAA 1P3BD 2YFVA 1N1JB 3UTAA 3A6NA 3X1VC 1KX4B 4XUJA 3NQUB 5AV5C 1HQ3C 4H9PA 1M18A 3WKJB 5C3IB 5G49A 3X1VB 4YM6C 4KGCB 2FJ7D 5B24D
chains in the Genus database with same CATH superfamily
2NQBC 2Y2IA 5CPJA 5CPKC 3X1SD 4Z66C 4YM6B 5B31D 1S32A 2CV5D 5B0ZA 2J8PA 2Y2KA 1P3LA 3REHD 5CPIA 5GT0D 5BT1C 5AV9C 4J8WC 3AZGC 2RVQD 3O62C 4J8XA 3B0CW 3REHB 3B6FA 1P3OA 1P3AB 5AV9B 3EPLA 4Z5TD 1M1AB 3LELC 2BYKB 1P3BA 3W99C 1ID3D 5CHLB 2G5IC 5AY8D 2Y2MA 3MGQC 3W99B 2FJ7A 3MGSD 5B24A 3AZJD 2Y2OA 3LZ0D 1P3KC 3AL0C 3X1SA 3MGQB 5GT3D 5AY8B 1H3OB 5BO0A 4QLCC 4JJND 2CV5A 1P3KB 2AROD 2CWEA 3AZNC 3AZHA 1F66D 4R8PC 3H0MC 5B0YD 5GT0A 5B32C 3AZNB 3REJD 1F66B 4X23C 5AV6B 2F8NK 5JRGC 5B0YB 1WWIA 3WAAD 5B32B 4J8UB 4Z5TA 3REJB 5BNVA 3AN2D 5FUGB 4WNNB 3H0LC 5E5AA 3WAAB 1ID3A 4H9NA 3C1CC 3X1TD 3RELD 2ZY2A 2Y2NA 3MGSA 3AZJA 1ULYA 4CAYA 3LZ0A 5GT3A 3TU4A 4WU9B 2RIQA 3C1BC 5B33D 3RELB 2PYOB 3B0DC 4JJNA 3W97B 5F99D 5GSUD 2AROA 4DRAA 1AOID 3AZFB 5DNMA 1KX3C 3B0DB 5B33B 1P3GD 4EO5C 1P3IB 5GSUB 5B2JD 1P3MC 1B6WA 2ZY4A 4M6BA 3FDDA 5B2IB 3REIB 4UUZA 1JFIB 1P3MB 1P3PC 3AN2A 5B1MC 1M19A 3B0CT 4XZQD 1ZLAC 3MVDD 3AZMC 3KFUG 4KUDD 5DNNC 3WA9D 3X1TA 4LD9A 4DQYB 5GXQD 1A7WA 1ZLAB 3VH5W 2HIOA 5AVBD 3AV1C 3WTPD 5B1LC 3WA9B 3AZLD 5F99A 4J8VC 3MGPB 3KXBC 5KDMB 1AOIA 3KUYC 3UTBB 1P3GA 3MNNA 4J8VB 4KHAA 3KXBB 2Y2JA 3EPKA 5B2JA 3KWQB 4WU8C 1KX5A 1TZYB 5BNXA 3AYWD 3AZKA 3EPJA 3AV2B 1P3FD 3LZ1D 5AVCD 3W98C 5AV8D 4XZQA 4ZUXD 1U35D 3MVDA 3UTAC 1P3FB 3A6NC 4KUDA 4H9RA 4XUJC 3LJAB 1KX4D 3UT9B 5GXQA 3VH6T 4CSRA 4ZUXB 3AZIC 1P34D 1U35B 5AVBA 3WKJD 3WTPA 5JA4B 3X1VD 2YFWB 4KGCD 5CPJC 5BS7C 3AZIB 1P34B 3MGRC 3AZLA 2BG1A 4YM6D 1S32C 5AV5B 5B0ZC 5CPKD 1HQ3B 3NQJB 3MGRB 1P3LC 3V9RA 2Y2HA 5CPIC 1BH8A 2NQBB 5CPKB 3P5JB 4AWLC 4J8XC 3AYWA 2ZY5A 3A1IA 4Z66B 2LY8A 3LZ1A 1P3OC 5AVCA 1P3AD 5BT1D 5AV9D 5AV8A 1M1AD 1P3BC 1P3OB 4Z2MH 1N1JA 1KX4A 2IO5C 3NQUA 4J8WB 3AZGB 3O62B 3WKJA 3X1VA 5B24C 3W99D 4KGCA 3X1SC 3LELB 3MGQD 3VH5T 2F8ND 4YM6A 4H9QB 1P3KD 3AZHC 2F8NB 4QLCD 1R4VA 5B31A 3AZHB 4H9OB 3AZND 3X1UC 5AV6D 3REHA 1W2EA 4QLCB 1P3AA 5AV9A 5B32D 4J8UD 1M1AA 3X1UB 3EPHA 4R8PB 2BYKA 1Q9CA 4WV4B 5JRGD 5E5AC 1ID3C 5BNVB 4YS3C 2JE5A 4X23B 3VH6W 5E5AB 5JRGB 3MGSC 2XD5A 3AZJC 4H9SA 3IP4C 3LZ0C 2HUEC 1BFMA 3C1CD 4YS3B 3TU4C 4NE6A 3W96C 2NZDC 3MGQA 5AY8A 1H3OA 4WU9D 4CAYB 2PYOD 3W97D 2AROC 1P3KA 3C1CB 1EQZC 3W96B 2NZDB 5DNMC 4E44A 3AZFD 1EQZB 2ZY3A 1TAFB 3AFAC 1P3ID 3AZNA 5CP6C 1F1EA 1F66A 3C1BB 5AV6A 5B2ID 3B6GC 3REID 5B0YA 3AFAB 5B31G 5B32A 4J8UA 5CP6B 1P3MD 3REJA 3B6GB 1M19C 2DQNC 1KX3B 5FUGA 4WNNA 1KU5A 4EO5B 3WAAA 3X1TC 4LD9C 1P3PD 1M19B 1BH9B 3REKC 3R45B 5B1MD 2HIOC 1ZLAD 4Z2MG 3AZMD 4LD9B 2G5HC 4NFTA 1P3PB 3REKB 5B1MB 4WU9A 4WJ3C 2W8SA 3KSYA 3RELA 3AZMB 3W97A 5DNNB 2PYOA 1AOIC 3MGPD 3AZFA 3MNNC 3UTBD 5B33A 3AV1B 4J8VD 1P3IA 5B1LB 5GSUA 3KXBD 4ZBJC 1KX5C 3KUYD 3KWQD 5B2IA 3AZKC 1TZYD 2BYMB 3REIA 3AV2D 3AZEC 5B40C 1JFIA 4ZBJB 1P3MA 1KX5B 4XZQC 3KUYB 3AZKB 3MVDC 4KUDC 3AZEB 5B40B 2JSSA 2F2AC 5GXQC 3LJAD 3UT9D 3EG5B 4WU8B 3VH5A 1ZLAA 3A6ND 3WA9A 3W98B 1M18C 3AZID 3AZLC 2YFVB 3UTAB 3A6NB 4XUJB 4NE5A 3MGPA 4H9PB 1M18B 5KDMA 5AV5D 1HQ3D 1Z2CB 3UTBA 3MGRD 5G49B 4J8VA 3KXBA 5B0ZD 5CPJB 3KWQA 2NQBD 1TZYA 4Z66D 5AVCC 3AV2A 1S32B 5AV8C 5B0ZB 1P3LB 4J8XD 3H0RC 5CPIB 1P3OD 3B6FC 1P3FA 1KX4C 4NE3A 3LJAA 3UT9A 2Y2LA 4J8WD 3AZGD 4AWLB 4J8XB 4ZUXA 3O62D 5C3IC 1U35A 3B6FB 3WKJC 4KGCC 2ZM5A 5JA4A 2YFWA 1P3BB 3AZIA 3LELD 2L5AA 1P34A 2FJ7C 2IO5B 5AV5A 5BS7A 1HQ3A 3NQJA 4DRBA 3MGRA 2F8NH 2FJ7B 5B31C 5B24B 2CV5C 3X1SB 3AZHD 2NQBA 5CPKA 4Z66A 3REHC 5B31B 5BO0B 2CV5B 5GT0C 1P3AC 1M1AC 2RVQC 3X1UD 4R8PD 4G92C 5GT0B 4Z5TC 4J8WA 3AZGA 3O62A 4X23D 4G92B 5E5AD 4H9SC 4Z5TB 4G91C 2Y2GA 4YS3D 5AY8C 3LELA 3F6TA 3WTPE 4H9QA 1ID3B 4H9NB 4G91B 3W99A 3TU4D 3W96D 2NZDD 5GT3C 3MGSB 3AZJB 4JJNC 2F8NA 3LZ0B 2HUEB 1EQZD 5GT3B 3TU4B 4H9OA 5DNMD 1F66C 5AV6C 3C1BD 5B0YC 4JJNB 4QLCA 3AFAD 4J8UC 2AROB 3REJC 5CP6D 3X1UA 5DNMB 3B6GD 4R8PA 1KX3D 2DF4C 3WAAC 3B0BA 1M19D 3VH6A 4E45A 3AN2C 4X23A 4UUZB 5JRGA 4LD9D 4YS3A 3AN2B 3REKD 4WU9C 2HIOD 3RELC 2PYOC 3W97C 3X1TB 5DNND 3W96A 3C1CA 2NZDA 3AZFC 5B33C 2HIOB 1P3IC 5F99C 3AV1D 5GSUC 4WZSB 1EQZA 1TAFA 5B1LD 4HGAC 5B2IC 3MNND 3REIC 3C1BA 1P3GC 5F99B 2F8NG 3AFAA 4HGAB 1AOIB 5B2JC 5CP6A 1KX5D 3B6GA 1P3GB 3MNNB 3AZKD 1KX3A 4KHAB 3AZED 5B40D 5B2JB 1BH9A 3R45A 5BNXB 4WU8D 1B67A 3WA9C 5B32G 1P3PA 3REKA 3W98D 4XZQB 5B1MA 3MVDB 4KUDB 5AVBC 4H9RB 3WTPC 3UTAD 3AZMA 5DNNA 3MGPC 5GXQB 4XUJD 4CSRB 2VQRA 3UTBC 1M18D 5AVBB 3WTPB 3AV1A 1T3UA 5B1LA 3KWQC 5CPJD 1TZYC 2Y2PA 2FFFB 3AZLB 2XD1A 2BYMA 2Y2QA 3AV2C 1S32D 4UPKA 3KUYA 3V9RB 3AYWC 1P3LD 1P3FC 3LZ1C 3AZEA 5B40A 5CPID 3LJAC 1BH8B 3UT9C 1WWSA 3AYWB 4WU8A 4ZUXC 1U35C 1PZRA 3LZ1B 3B6FD 5AVCB 3A1KA 2UWXA 5AV8B 3W98A 1P34C 1HTAA 1P3BD 2YFVA 1N1JB 3UTAA 3A6NA 3X1VC 1KX4B 4XUJA 3NQUB 5AV5C 1HQ3C 4H9PA 1M18A 3WKJB 2JCHA 5C3IB 5G49A 3X1VB 4YM6C 4KGCB 2FJ7D 5B24D
chains in the Genus database with same CATH topology
2NQBC 2Y2IA 5CPJA 5CPKC 3X1SD 4Z66C 4YM6B 5B31D 1S32A 2CV5D 5B0ZA 2J8PA 2Y2KA 1P3LA 3REHD 5CPIA 5GT0D 5BT1C 5AV9C 4J8WC 3AZGC 2RVQD 3O62C 4J8XA 3B0CW 3REHB 3B6FA 1P3OA 1P3AB 5AV9B 3EPLA 4Z5TD 1M1AB 3LELC 2BYKB 1P3BA 3W99C 1ID3D 5CHLB 2G5IC 5AY8D 2Y2MA 3MGQC 3W99B 2FJ7A 3MGSD 5B24A 3AZJD 2Y2OA 3LZ0D 1P3KC 3AL0C 3X1SA 3MGQB 5GT3D 5AY8B 1H3OB 5BO0A 4QLCC 4JJND 2CV5A 1P3KB 2AROD 2CWEA 3AZNC 3AZHA 1F66D 4R8PC 3H0MC 5B0YD 5GT0A 5B32C 3AZNB 3REJD 1F66B 4X23C 5AV6B 2F8NK 5JRGC 5B0YB 1WWIA 3WAAD 5B32B 4J8UB 4Z5TA 3REJB 5BNVA 3AN2D 5FUGB 4WNNB 3H0LC 5E5AA 3WAAB 1ID3A 4H9NA 3C1CC 3X1TD 3RELD 2ZY2A 2Y2NA 3MGSA 3AZJA 1ULYA 4CAYA 3LZ0A 5GT3A 3TU4A 4WU9B 2RIQA 3C1BC 5B33D 3RELB 2PYOB 3B0DC 4JJNA 3W97B 5F99D 5GSUD 2AROA 4DRAA 1AOID 3AZFB 5DNMA 1KX3C 3B0DB 5B33B 1P3GD 4EO5C 1P3IB 5GSUB 5B2JD 1P3MC 1B6WA 2ZY4A 4M6BA 3FDDA 5B2IB 3REIB 4UUZA 1JFIB 1P3MB 1P3PC 3AN2A 5B1MC 1M19A 3B0CT 4XZQD 1ZLAC 3MVDD 3AZMC 3KFUG 4KUDD 5DNNC 3WA9D 3X1TA 4LD9A 4DQYB 5GXQD 1A7WA 1ZLAB 3VH5W 2HIOA 5AVBD 3AV1C 3WTPD 5B1LC 3WA9B 3AZLD 5F99A 4J8VC 3MGPB 3KXBC 5KDMB 1AOIA 3KUYC 3UTBB 1P3GA 3MNNA 4J8VB 4KHAA 3KXBB 2Y2JA 3EPKA 5B2JA 3KWQB 4WU8C 1KX5A 1TZYB 5BNXA 3AYWD 3AZKA 3EPJA 3AV2B 1P3FD 3LZ1D 5AVCD 3W98C 5AV8D 4XZQA 4ZUXD 1U35D 3MVDA 3UTAC 1P3FB 3A6NC 4KUDA 4H9RA 4XUJC 3LJAB 1KX4D 3UT9B 5GXQA 3VH6T 4CSRA 4ZUXB 3AZIC 1P34D 1U35B 5AVBA 3WKJD 3WTPA 5JA4B 3X1VD 2YFWB 4KGCD 5CPJC 5BS7C 3AZIB 1P34B 3MGRC 3AZLA 2BG1A 4YM6D 1S32C 5AV5B 5B0ZC 5CPKD 1HQ3B 3NQJB 3MGRB 1P3LC 3V9RA 2Y2HA 5CPIC 1BH8A 2NQBB 5CPKB 3P5JB 4AWLC 4J8XC 3AYWA 2ZY5A 3A1IA 4Z66B 2LY8A 3LZ1A 1P3OC 5AVCA 1P3AD 5BT1D 5AV9D 5AV8A 1M1AD 1P3BC 1P3OB 4Z2MH 1N1JA 1KX4A 2IO5C 3NQUA 4J8WB 3AZGB 3O62B 3WKJA 3X1VA 5B24C 3W99D 4KGCA 3X1SC 3LELB 3MGQD 3VH5T 2F8ND 4YM6A 4H9QB 1P3KD 3AZHC 2F8NB 4QLCD 1R4VA 5B31A 3AZHB 4H9OB 3AZND 3X1UC 5AV6D 3REHA 1W2EA 4QLCB 1P3AA 5AV9A 5B32D 4J8UD 1M1AA 3X1UB 3EPHA 4R8PB 2BYKA 1Q9CA 4WV4B 5JRGD 5E5AC 1ID3C 5BNVB 4YS3C 2JE5A 4X23B 3VH6W 5E5AB 5JRGB 3MGSC 2XD5A 3AZJC 4H9SA 3IP4C 3LZ0C 2HUEC 1BFMA 3C1CD 4YS3B 3TU4C 4NE6A 3W96C 2NZDC 3MGQA 5AY8A 1H3OA 4WU9D 4CAYB 2PYOD 3W97D 2AROC 1P3KA 3C1CB 1EQZC 3W96B 2NZDB 5DNMC 4E44A 3AZFD 1EQZB 2ZY3A 1TAFB 3AFAC 1P3ID 3AZNA 5CP6C 1F1EA 1F66A 3C1BB 5AV6A 5B2ID 3B6GC 3REID 5B0YA 3AFAB 5B31G 5B32A 4J8UA 5CP6B 1P3MD 3REJA 3B6GB 1M19C 2DQNC 1KX3B 5FUGA 4WNNA 1KU5A 4EO5B 3WAAA 3X1TC 4LD9C 1P3PD 1M19B 1BH9B 3REKC 3R45B 5B1MD 2HIOC 1ZLAD 4Z2MG 3AZMD 4LD9B 2G5HC 4NFTA 1P3PB 3REKB 5B1MB 4WU9A 4WJ3C 2W8SA 3KSYA 3RELA 3AZMB 3W97A 5DNNB 2PYOA 1AOIC 3MGPD 3AZFA 3MNNC 3UTBD 5B33A 3AV1B 4J8VD 1P3IA 5B1LB 5GSUA 3KXBD 4ZBJC 1KX5C 3KUYD 3KWQD 5B2IA 3AZKC 1TZYD 2BYMB 3REIA 3AV2D 3AZEC 5B40C 1JFIA 4ZBJB 1P3MA 1KX5B 4XZQC 3KUYB 3AZKB 3MVDC 4KUDC 3AZEB 5B40B 2JSSA 2F2AC 5GXQC 3LJAD 3UT9D 3EG5B 4WU8B 3VH5A 1ZLAA 3A6ND 3WA9A 3W98B 1M18C 3AZID 3AZLC 2YFVB 3UTAB 3A6NB 4XUJB 4NE5A 3MGPA 4H9PB 1M18B 5KDMA 5AV5D 1HQ3D 1Z2CB 3UTBA 3MGRD 5G49B 4J8VA 3KXBA 5B0ZD 5CPJB 3KWQA 2NQBD 1TZYA 4Z66D 5AVCC 3AV2A 1S32B 5AV8C 5B0ZB 1P3LB 4J8XD 3H0RC 5CPIB 1P3OD 3B6FC 1P3FA 1KX4C 4NE3A 3LJAA 3UT9A 2Y2LA 4J8WD 3AZGD 4AWLB 4J8XB 4ZUXA 3O62D 5C3IC 1U35A 3B6FB 3WKJC 4KGCC 2ZM5A 5JA4A 2YFWA 1P3BB 3AZIA 3LELD 2L5AA 1P34A 2FJ7C 2IO5B 5AV5A 5BS7A 1HQ3A 3NQJA 4DRBA 3MGRA 2F8NH 2FJ7B 5B31C 5B24B 2CV5C 3X1SB 3AZHD 2NQBA 5CPKA 4Z66A 3REHC 5B31B 5BO0B 2CV5B 5GT0C 1P3AC 1M1AC 2RVQC 3X1UD 4R8PD 4G92C 5GT0B 4Z5TC 4J8WA 3AZGA 3O62A 4X23D 4G92B 5E5AD 4H9SC 4Z5TB 4G91C 2Y2GA 4YS3D 5AY8C 3LELA 3F6TA 3WTPE 4H9QA 1ID3B 4H9NB 4G91B 3W99A 3TU4D 3W96D 2NZDD 5GT3C 3MGSB 3AZJB 4JJNC 2F8NA 3LZ0B 2HUEB 1EQZD 5GT3B 3TU4B 4H9OA 5DNMD 1F66C 5AV6C 3C1BD 5B0YC 4JJNB 4QLCA 3AFAD 4J8UC 2AROB 3REJC 5CP6D 3X1UA 5DNMB 3B6GD 4R8PA 1KX3D 2DF4C 3WAAC 3B0BA 1M19D 3VH6A 4E45A 3AN2C 4X23A 4UUZB 5JRGA 4LD9D 4YS3A 3AN2B 3REKD 4WU9C 2HIOD 3RELC 2PYOC 3W97C 3X1TB 5DNND 3W96A 3C1CA 2NZDA 3AZFC 5B33C 2HIOB 1P3IC 5F99C 3AV1D 5GSUC 4WZSB 1EQZA 1TAFA 5B1LD 4HGAC 5B2IC 3MNND 3REIC 3C1BA 1P3GC 5F99B 2F8NG 3AFAA 4HGAB 1AOIB 5B2JC 5CP6A 1KX5D 3B6GA 1P3GB 3MNNB 3AZKD 1KX3A 4KHAB 3AZED 5B40D 5B2JB 1BH9A 3R45A 5BNXB 4WU8D 1B67A 3WA9C 5B32G 1P3PA 3REKA 3W98D 4XZQB 5B1MA 3MVDB 4KUDB 5AVBC 4H9RB 3WTPC 3UTAD 3AZMA 5DNNA 3MGPC 5GXQB 4XUJD 4CSRB 2VQRA 3UTBC 1M18D 5AVBB 3WTPB 3AV1A 1T3UA 5B1LA 3KWQC 5CPJD 1TZYC 2Y2PA 2FFFB 3AZLB 2XD1A 2BYMA 2Y2QA 3AV2C 1S32D 4UPKA 3KUYA 3V9RB 3AYWC 1P3LD 1P3FC 3LZ1C 3AZEA 5B40A 5CPID 3LJAC 1BH8B 3UT9C 1WWSA 3AYWB 4WU8A 4ZUXC 1U35C 1PZRA 3LZ1B 3B6FD 5AVCB 3A1KA 2UWXA 5AV8B 3W98A 1P34C 1HTAA 1P3BD 2YFVA 1N1JB 3UTAA 3A6NA 3X1VC 1KX4B 4XUJA 3NQUB 5AV5C 1HQ3C 4H9PA 1M18A 3WKJB 2JCHA 5C3IB 5G49A 3X1VB 4YM6C 4KGCB 2FJ7D 5B24D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB C;  5CPJ A;  5CPK C;  3X1S D;  4Z66 C;  4YM6 B;  5B31 D;  1S32 A;  2CV5 D;  5B0Z A;  1P3L A;  3REH D;  5CPI A;  5GT0 D;  5BT1 C;  5AV9 C;  4J8W C;  3AZG C;  2RVQ D;  3O62 C;  4J8X A;  3B0C W;  3REH B;  3B6F A;  1P3O A;  1P3A B;  5AV9 B;  4Z5T D;  1M1A B;  3LEL C;  2BYK B;  1P3B A;  3W99 C;  1ID3 D;  5CHL B;  5AY8 D;  3MGQ C;  3W99 B;  2FJ7 A;  3MGS D;  5B24 A;  3AZJ D;  3LZ0 D;  1P3K C;  3X1S A;  3MGQ B;  5GT3 D;  5AY8 B;  1H3O B;  5BO0 A;  4QLC C;  4JJN D;  2CV5 A;  1P3K B;  2ARO D;  2CWE A;  3AZN C;  3AZH A;  1F66 D;  4R8P C;  5B0Y D;  5GT0 A;  5B32 C;  3AZN B;  3REJ D;  1F66 B;  4X23 C;  5AV6 B;  2F8N K;  5JRG C;  5B0Y B;  1WWI A;  3WAA D;  5B32 B;  4J8U B;  4Z5T A;  3REJ B;  5BNV A;  3AN2 D;  5FUG B;  4WNN B;  5E5A A;  3WAA B;  1ID3 A;  4H9N A;  3C1C C;  3X1T D;  3REL D;  3MGS A;  3AZJ A;  1ULY A;  4CAY A;  3LZ0 A;  5GT3 A;  3TU4 A;  4WU9 B;  3C1B C;  5B33 D;  3REL B;  2PYO B;  3B0D C;  4JJN A;  3W97 B;  5F99 D;  5GSU D;  2ARO A;  4DRA A;  1AOI D;  3AZF B;  5DNM A;  1KX3 C;  3B0D B;  5B33 B;  1P3G D;  4EO5 C;  1P3I B;  5GSU B;  5B2J D;  1P3M C;  1B6W A;  4M6B A;  5B2I B;  3REI B;  4UUZ A;  1JFI B;  1P3M B;  1P3P C;  3AN2 A;  5B1M C;  1M19 A;  3B0C T;  4XZQ D;  1ZLA C;  3MVD D;  3AZM C;  4KUD D;  5DNN C;  3WA9 D;  3X1T A;  4LD9 A;  5GXQ D;  1A7W A;  1ZLA B;  3VH5 W;  2HIO A;  5AVB D;  3AV1 C;  3WTP D;  5B1L C;  3WA9 B;  3AZL D;  5F99 A;  4J8V C;  3MGP B;  3KXB C;  5KDM B;  1AOI A;  3KUY C;  3UTB B;  1P3G A;  3MNN A;  4J8V B;  4KHA A;  3KXB B;  5B2J A;  3KWQ B;  4WU8 C;  1KX5 A;  1TZY B;  5BNX A;  3AYW D;  3AZK A;  3AV2 B;  1P3F D;  3LZ1 D;  5AVC D;  3W98 C;  5AV8 D;  4XZQ A;  4ZUX D;  1U35 D;  3MVD A;  3UTA C;  1P3F B;  3A6N C;  4KUD A;  4H9R A;  4XUJ C;  3LJA B;  1KX4 D;  3UT9 B;  5GXQ A;  3VH6 T;  4CSR A;  4ZUX B;  3AZI C;  1P34 D;  1U35 B;  5AVB A;  3WKJ D;  3WTP A;  5JA4 B;  3X1V D;  2YFW B;  4KGC D;  5CPJ C;  5BS7 C;  3AZI B;  1P34 B;  3MGR C;  3AZL A;  4YM6 D;  1S32 C;  5AV5 B;  5B0Z C;  5CPK D;  1HQ3 B;  3NQJ B;  3MGR B;  1P3L C;  3V9R A;  5CPI C;  1BH8 A;  2NQB B;  5CPK B;  4AWL C;  4J8X C;  3AYW A;  4Z66 B;  2LY8 A;  3LZ1 A;  1P3O C;  5AVC A;  1P3A D;  5BT1 D;  5AV9 D;  5AV8 A;  1M1A D;  1P3B C;  1P3O B;  4Z2M H;  1N1J A;  1KX4 A;  2IO5 C;  3NQU A;  4J8W B;  3AZG B;  3O62 B;  3WKJ A;  3X1V A;  5B24 C;  3W99 D;  4KGC A;  3X1S C;  3LEL B;  3MGQ D;  3VH5 T;  2F8N D;  4YM6 A;  4H9Q B;  1P3K D;  3AZH C;  2F8N B;  4QLC D;  1R4V A;  5B31 A;  3AZH B;  4H9O B;  3AZN D;  3X1U C;  5AV6 D;  3REH A;  4QLC B;  1P3A A;  5AV9 A;  5B32 D;  4J8U D;  1M1A A;  3X1U B;  4R8P B;  2BYK A;  1Q9C A;  4WV4 B;  5JRG D;  5E5A C;  1ID3 C;  5BNV B;  4YS3 C;  4X23 B;  3VH6 W;  5E5A B;  5JRG B;  3MGS C;  3AZJ C;  4H9S A;  3LZ0 C;  1BFM A;  2HUE C;  3C1C D;  4YS3 B;  3TU4 C;  4NE6 A;  3W96 C;  2NZD C;  3MGQ A;  5AY8 A;  1H3O A;  4WU9 D;  4CAY B;  2PYO D;  3W97 D;  2ARO C;  1P3K A;  3C1C B;  1EQZ C;  3W96 B;  2NZD B;  5DNM C;  4E44 A;  3AZF D;  1EQZ B;  1TAF B;  3AFA C;  1P3I D;  3AZN A;  5CP6 C;  1F1E A;  1F66 A;  3C1B B;  5AV6 A;  5B2I D;  3B6G C;  3REI D;  5B0Y A;  3AFA B;  5B31 G;  5B32 A;  4J8U A;  5CP6 B;  1P3M D;  3REJ A;  3B6G B;  1M19 C;  1KX3 B;  5FUG A;  4WNN A;  1KU5 A;  4EO5 B;  3WAA A;  3X1T C;  4LD9 C;  1P3P D;  1M19 B;  1BH9 B;  3REK C;  3R45 B;  5B1M D;  2HIO C;  1ZLA D;  4Z2M G;  3AZM D;  4LD9 B;  4NFT A;  1P3P B;  3REK B;  5B1M B;  4WU9 A;  3REL A;  3KSY A;  3AZM B;  2PYO A;  3W97 A;  5DNN B;  1AOI C;  3MGP D;  3AZF A;  3MNN C;  3UTB D;  5B33 A;  3AV1 B;  4J8V D;  1P3I A;  5B1L B;  5GSU A;  3KXB D;  4ZBJ C;  1KX5 C;  3KUY D;  3KWQ D;  5B2I A;  3AZK C;  1TZY D;  2BYM B;  3REI A;  3AV2 D;  3AZE C;  5B40 C;  1JFI A;  4ZBJ B;  1P3M A;  1KX5 B;  4XZQ C;  3KUY B;  3AZK B;  3MVD C;  4KUD C;  3AZE B;  5B40 B;  2JSS A;  5GXQ C;  3LJA D;  3UT9 D;  4WU8 B;  3VH5 A;  1ZLA A;  3A6N D;  3WA9 A;  3W98 B;  1M18 C;  3AZI D;  3AZL C;  2YFV B;  3UTA B;  3A6N B;  4XUJ B;  4NE5 A;  3MGP A;  4H9P B;  1M18 B;  5KDM A;  5AV5 D;  1HQ3 D;  3UTB A;  3MGR D;  5G49 B;  4J8V A;  3KXB A;  5B0Z D;  5CPJ B;  3KWQ A;  2NQB D;  1TZY A;  4Z66 D;  5AVC C;  3AV2 A;  1S32 B;  5AV8 C;  5B0Z B;  1P3L B;  4J8X D;  5CPI B;  1P3O D;  3B6F C;  1P3F A;  1KX4 C;  4NE3 A;  3LJA A;  3UT9 A;  4J8W D;  3AZG D;  4AWL B;  4J8X B;  4ZUX A;  3O62 D;  5C3I C;  1U35 A;  3B6F B;  3WKJ C;  4KGC C;  5JA4 A;  2YFW A;  1P3B B;  3AZI A;  3LEL D;  2L5A A;  1P34 A;  2FJ7 C;  2IO5 B;  5AV5 A;  5BS7 A;  1HQ3 A;  3NQJ A;  4DRB A;  3MGR A;  2F8N H;  2FJ7 B;  5B31 C;  5B24 B;  2CV5 C;  3X1S B;  3AZH D;  2NQB A;  5CPK A;  4Z66 A;  3REH C;  5B31 B;  5BO0 B;  2CV5 B;  5GT0 C;  1P3A C;  1M1A C;  2RVQ C;  3X1U D;  4R8P D;  4G92 C;  5GT0 B;  4Z5T C;  4J8W A;  3AZG A;  3O62 A;  4X23 D;  4G92 B;  5E5A D;  4H9S C;  4Z5T B;  4G91 C;  4YS3 D;  5AY8 C;  3LEL A;  3WTP E;  4H9Q A;  1ID3 B;  4H9N B;  4G91 B;  3W99 A;  3TU4 D;  3W96 D;  2NZD D;  5GT3 C;  3MGS B;  3AZJ B;  4JJN C;  2F8N A;  3LZ0 B;  2HUE B;  1EQZ D;  5GT3 B;  3TU4 B;  4H9O A;  5DNM D;  1F66 C;  5AV6 C;  3C1B D;  5B0Y C;  4JJN B;  4QLC A;  3AFA D;  4J8U C;  2ARO B;  3REJ C;  5CP6 D;  3X1U A;  5DNM B;  3B6G D;  4R8P A;  1KX3 D;  3WAA C;  3B0B A;  1M19 D;  3VH6 A;  4E45 A;  3AN2 C;  4X23 A;  4UUZ B;  5JRG A;  4LD9 D;  4YS3 A;  3AN2 B;  3REK D;  4WU9 C;  2HIO D;  3REL C;  2PYO C;  3W97 C;  3X1T B;  5DNN D;  3W96 A;  3C1C A;  2NZD A;  3AZF C;  5B33 C;  2HIO B;  1P3I C;  5F99 C;  3AV1 D;  5GSU C;  4WZS B;  1EQZ A;  1TAF A;  5B1L D;  4HGA C;  5B2I C;  3MNN D;  3REI C;  3C1B A;  1P3G C;  5F99 B;  2F8N G;  3AFA A;  4HGA B;  1AOI B;  5B2J C;  5CP6 A;  1KX5 D;  3B6G A;  1P3G B;  3MNN B;  3AZK D;  1KX3 A;  4KHA B;  3AZE D;  5B40 D;  5B2J B;  1BH9 A;  3R45 A;  5BNX B;  4WU8 D;  1B67 A;  3WA9 C;  5B32 G;  1P3P A;  3REK A;  3W98 D;  4XZQ B;  5B1M A;  3MVD B;  4KUD B;  5AVB C;  4H9R B;  3WTP C;  3UTA D;  3AZM A;  5DNN A;  3MGP C;  5GXQ B;  4XUJ D;  4CSR B;  1M18 D;  3UTB C;  5AVB B;  3WTP B;  3AV1 A;  5B1L A;  3KWQ C;  5CPJ D;  1TZY C;  3AZL B;  2BYM A;  3AV2 C;  1S32 D;  3KUY A;  3V9R B;  3AYW C;  1P3L D;  1P3F C;  3LZ1 C;  3AZE A;  5B40 A;  5CPI D;  3LJA C;  1BH8 B;  3UT9 C;  1WWS A;  3AYW B;  4WU8 A;  4ZUX C;  1U35 C;  3LZ1 B;  3B6F D;  5AVC B;  5AV8 B;  3W98 A;  1P34 C;  1HTA A;  1P3B D;  2YFV A;  1N1J B;  3UTA A;  3A6N A;  3X1V C;  1KX4 B;  4XUJ A;  3NQU B;  5AV5 C;  1HQ3 C;  4H9P A;  1M18 A;  3WKJ B;  5C3I B;  5G49 A;  3X1V B;  4YM6 C;  4KGC B;  2FJ7 D;  5B24 D; 
#chains in the Genus database with same CATH topology
 2NQB C;  2Y2I A;  5CPJ A;  5CPK C;  3X1S D;  4Z66 C;  4YM6 B;  5B31 D;  1S32 A;  2CV5 D;  5B0Z A;  2J8P A;  2Y2K A;  1P3L A;  3REH D;  5CPI A;  5GT0 D;  5BT1 C;  5AV9 C;  4J8W C;  3AZG C;  2RVQ D;  3O62 C;  4J8X A;  3B0C W;  3REH B;  3B6F A;  1P3O A;  1P3A B;  5AV9 B;  3EPL A;  4Z5T D;  1M1A B;  3LEL C;  2BYK B;  1P3B A;  3W99 C;  1ID3 D;  5CHL B;  2G5I C;  5AY8 D;  2Y2M A;  3MGQ C;  3W99 B;  2FJ7 A;  3MGS D;  5B24 A;  3AZJ D;  2Y2O A;  3LZ0 D;  1P3K C;  3AL0 C;  3X1S A;  3MGQ B;  5GT3 D;  5AY8 B;  1H3O B;  5BO0 A;  4QLC C;  4JJN D;  2CV5 A;  1P3K B;  2ARO D;  2CWE A;  3AZN C;  3AZH A;  1F66 D;  4R8P C;  3H0M C;  5B0Y D;  5GT0 A;  5B32 C;  3AZN B;  3REJ D;  1F66 B;  4X23 C;  5AV6 B;  2F8N K;  5JRG C;  5B0Y B;  1WWI A;  3WAA D;  5B32 B;  4J8U B;  4Z5T A;  3REJ B;  5BNV A;  3AN2 D;  5FUG B;  4WNN B;  3H0L C;  5E5A A;  3WAA B;  1ID3 A;  4H9N A;  3C1C C;  3X1T D;  3REL D;  2ZY2 A;  2Y2N A;  3MGS A;  3AZJ A;  1ULY A;  4CAY A;  3LZ0 A;  5GT3 A;  3TU4 A;  4WU9 B;  2RIQ A;  3C1B C;  5B33 D;  3REL B;  2PYO B;  3B0D C;  4JJN A;  3W97 B;  5F99 D;  5GSU D;  2ARO A;  4DRA A;  1AOI D;  3AZF B;  5DNM A;  1KX3 C;  3B0D B;  5B33 B;  1P3G D;  4EO5 C;  1P3I B;  5GSU B;  5B2J D;  1P3M C;  1B6W A;  2ZY4 A;  4M6B A;  3FDD A;  5B2I B;  3REI B;  4UUZ A;  1JFI B;  1P3M B;  1P3P C;  3AN2 A;  5B1M C;  1M19 A;  3B0C T;  4XZQ D;  1ZLA C;  3MVD D;  3AZM C;  3KFU G;  4KUD D;  5DNN C;  3WA9 D;  3X1T A;  4LD9 A;  4DQY B;  5GXQ D;  1A7W A;  1ZLA B;  3VH5 W;  2HIO A;  5AVB D;  3AV1 C;  3WTP D;  5B1L C;  3WA9 B;  3AZL D;  5F99 A;  4J8V C;  3MGP B;  3KXB C;  5KDM B;  1AOI A;  3KUY C;  3UTB B;  1P3G A;  3MNN A;  4J8V B;  4KHA A;  3KXB B;  2Y2J A;  3EPK A;  5B2J A;  3KWQ B;  4WU8 C;  1KX5 A;  1TZY B;  5BNX A;  3AYW D;  3AZK A;  3EPJ A;  3AV2 B;  1P3F D;  3LZ1 D;  5AVC D;  3W98 C;  5AV8 D;  4XZQ A;  4ZUX D;  1U35 D;  3MVD A;  3UTA C;  1P3F B;  3A6N C;  4KUD A;  4H9R A;  4XUJ C;  3LJA B;  1KX4 D;  3UT9 B;  5GXQ A;  3VH6 T;  4CSR A;  4ZUX B;  3AZI C;  1P34 D;  1U35 B;  5AVB A;  3WKJ D;  3WTP A;  5JA4 B;  3X1V D;  2YFW B;  4KGC D;  5CPJ C;  5BS7 C;  3AZI B;  1P34 B;  3MGR C;  3AZL A;  2BG1 A;  4YM6 D;  1S32 C;  5AV5 B;  5B0Z C;  5CPK D;  1HQ3 B;  3NQJ B;  3MGR B;  1P3L C;  3V9R A;  2Y2H A;  5CPI C;  1BH8 A;  2NQB B;  5CPK B;  3P5J B;  4AWL C;  4J8X C;  3AYW A;  2ZY5 A;  3A1I A;  4Z66 B;  2LY8 A;  3LZ1 A;  1P3O C;  5AVC A;  1P3A D;  5BT1 D;  5AV9 D;  5AV8 A;  1M1A D;  1P3B C;  1P3O B;  4Z2M H;  1N1J A;  1KX4 A;  2IO5 C;  3NQU A;  4J8W B;  3AZG B;  3O62 B;  3WKJ A;  3X1V A;  5B24 C;  3W99 D;  4KGC A;  3X1S C;  3LEL B;  3MGQ D;  3VH5 T;  2F8N D;  4YM6 A;  4H9Q B;  1P3K D;  3AZH C;  2F8N B;  4QLC D;  1R4V A;  5B31 A;  3AZH B;  4H9O B;  3AZN D;  3X1U C;  5AV6 D;  3REH A;  1W2E A;  4QLC B;  1P3A A;  5AV9 A;  5B32 D;  4J8U D;  1M1A A;  3X1U B;  3EPH A;  4R8P B;  2BYK A;  1Q9C A;  4WV4 B;  5JRG D;  5E5A C;  1ID3 C;  5BNV B;  4YS3 C;  2JE5 A;  4X23 B;  3VH6 W;  5E5A B;  5JRG B;  3MGS C;  2XD5 A;  3AZJ C;  4H9S A;  3IP4 C;  3LZ0 C;  2HUE C;  1BFM A;  3C1C D;  4YS3 B;  3TU4 C;  4NE6 A;  3W96 C;  2NZD C;  3MGQ A;  5AY8 A;  1H3O A;  4WU9 D;  4CAY B;  2PYO D;  3W97 D;  2ARO C;  1P3K A;  3C1C B;  1EQZ C;  3W96 B;  2NZD B;  5DNM C;  4E44 A;  3AZF D;  1EQZ B;  2ZY3 A;  1TAF B;  3AFA C;  1P3I D;  3AZN A;  5CP6 C;  1F1E A;  1F66 A;  3C1B B;  5AV6 A;  5B2I D;  3B6G C;  3REI D;  5B0Y A;  3AFA B;  5B31 G;  5B32 A;  4J8U A;  5CP6 B;  1P3M D;  3REJ A;  3B6G B;  1M19 C;  2DQN C;  1KX3 B;  5FUG A;  4WNN A;  1KU5 A;  4EO5 B;  3WAA A;  3X1T C;  4LD9 C;  1P3P D;  1M19 B;  1BH9 B;  3REK C;  3R45 B;  5B1M D;  2HIO C;  1ZLA D;  4Z2M G;  3AZM D;  4LD9 B;  2G5H C;  4NFT A;  1P3P B;  3REK B;  5B1M B;  4WU9 A;  4WJ3 C;  2W8S A;  3KSY A;  3REL A;  3AZM B;  3W97 A;  5DNN B;  2PYO A;  1AOI C;  3MGP D;  3AZF A;  3MNN C;  3UTB D;  5B33 A;  3AV1 B;  4J8V D;  1P3I A;  5B1L B;  5GSU A;  3KXB D;  4ZBJ C;  1KX5 C;  3KUY D;  3KWQ D;  5B2I A;  3AZK C;  1TZY D;  2BYM B;  3REI A;  3AV2 D;  3AZE C;  5B40 C;  1JFI A;  4ZBJ B;  1P3M A;  1KX5 B;  4XZQ C;  3KUY B;  3AZK B;  3MVD C;  4KUD C;  3AZE B;  5B40 B;  2JSS A;  2F2A C;  5GXQ C;  3LJA D;  3UT9 D;  3EG5 B;  4WU8 B;  3VH5 A;  1ZLA A;  3A6N D;  3WA9 A;  3W98 B;  1M18 C;  3AZI D;  3AZL C;  2YFV B;  3UTA B;  3A6N B;  4XUJ B;  4NE5 A;  3MGP A;  4H9P B;  1M18 B;  5KDM A;  5AV5 D;  1HQ3 D;  1Z2C B;  3UTB A;  3MGR D;  5G49 B;  4J8V A;  3KXB A;  5B0Z D;  5CPJ B;  3KWQ A;  2NQB D;  1TZY A;  4Z66 D;  5AVC C;  3AV2 A;  1S32 B;  5AV8 C;  5B0Z B;  1P3L B;  4J8X D;  3H0R C;  5CPI B;  1P3O D;  3B6F C;  1P3F A;  1KX4 C;  4NE3 A;  3LJA A;  3UT9 A;  2Y2L A;  4J8W D;  3AZG D;  4AWL B;  4J8X B;  4ZUX A;  3O62 D;  5C3I C;  1U35 A;  3B6F B;  3WKJ C;  4KGC C;  2ZM5 A;  5JA4 A;  2YFW A;  1P3B B;  3AZI A;  3LEL D;  2L5A A;  1P34 A;  2FJ7 C;  2IO5 B;  5AV5 A;  5BS7 A;  1HQ3 A;  3NQJ A;  4DRB A;  3MGR A;  2F8N H;  2FJ7 B;  5B31 C;  5B24 B;  2CV5 C;  3X1S B;  3AZH D;  2NQB A;  5CPK A;  4Z66 A;  3REH C;  5B31 B;  5BO0 B;  2CV5 B;  5GT0 C;  1P3A C;  1M1A C;  2RVQ C;  3X1U D;  4R8P D;  4G92 C;  5GT0 B;  4Z5T C;  4J8W A;  3AZG A;  3O62 A;  4X23 D;  4G92 B;  5E5A D;  4H9S C;  4Z5T B;  4G91 C;  2Y2G A;  4YS3 D;  5AY8 C;  3LEL A;  3F6T A;  3WTP E;  4H9Q A;  1ID3 B;  4H9N B;  4G91 B;  3W99 A;  3TU4 D;  3W96 D;  2NZD D;  5GT3 C;  3MGS B;  3AZJ B;  4JJN C;  2F8N A;  3LZ0 B;  2HUE B;  1EQZ D;  5GT3 B;  3TU4 B;  4H9O A;  5DNM D;  1F66 C;  5AV6 C;  3C1B D;  5B0Y C;  4JJN B;  4QLC A;  3AFA D;  4J8U C;  2ARO B;  3REJ C;  5CP6 D;  3X1U A;  5DNM B;  3B6G D;  4R8P A;  1KX3 D;  2DF4 C;  3WAA C;  3B0B A;  1M19 D;  3VH6 A;  4E45 A;  3AN2 C;  4X23 A;  4UUZ B;  5JRG A;  4LD9 D;  4YS3 A;  3AN2 B;  3REK D;  4WU9 C;  2HIO D;  3REL C;  2PYO C;  3W97 C;  3X1T B;  5DNN D;  3W96 A;  3C1C A;  2NZD A;  3AZF C;  5B33 C;  2HIO B;  1P3I C;  5F99 C;  3AV1 D;  5GSU C;  4WZS B;  1EQZ A;  1TAF A;  5B1L D;  4HGA C;  5B2I C;  3MNN D;  3REI C;  3C1B A;  1P3G C;  5F99 B;  2F8N G;  3AFA A;  4HGA B;  1AOI B;  5B2J C;  5CP6 A;  1KX5 D;  3B6G A;  1P3G B;  3MNN B;  3AZK D;  1KX3 A;  4KHA B;  3AZE D;  5B40 D;  5B2J B;  1BH9 A;  3R45 A;  5BNX B;  4WU8 D;  1B67 A;  3WA9 C;  5B32 G;  1P3P A;  3REK A;  3W98 D;  4XZQ B;  5B1M A;  3MVD B;  4KUD B;  5AVB C;  4H9R B;  3WTP C;  3UTA D;  3AZM A;  5DNN A;  3MGP C;  5GXQ B;  4XUJ D;  4CSR B;  2VQR A;  3UTB C;  1M18 D;  5AVB B;  3WTP B;  3AV1 A;  1T3U A;  5B1L A;  3KWQ C;  5CPJ D;  1TZY C;  2Y2P A;  2FFF B;  3AZL B;  2XD1 A;  2BYM A;  2Y2Q A;  3AV2 C;  1S32 D;  4UPK A;  3KUY A;  3V9R B;  3AYW C;  1P3L D;  1P3F C;  3LZ1 C;  3AZE A;  5B40 A;  5CPI D;  3LJA C;  1BH8 B;  3UT9 C;  1WWS A;  3AYW B;  4WU8 A;  4ZUX C;  1U35 C;  1PZR A;  3LZ1 B;  3B6F D;  5AVC B;  3A1K A;  2UWX A;  5AV8 B;  3W98 A;  1P34 C;  1HTA A;  1P3B D;  2YFV A;  1N1J B;  3UTA A;  3A6N A;  3X1V C;  1KX4 B;  4XUJ A;  3NQU B;  5AV5 C;  1HQ3 C;  4H9P A;  1M18 A;  3WKJ B;  2JCH A;  5C3I B;  5G49 A;  3X1V B;  4YM6 C;  4KGC B;  2FJ7 D;  5B24 D; 
#chains in the Genus database with same CATH homology
 2NQB C;  2Y2I A;  5CPJ A;  5CPK C;  3X1S D;  4Z66 C;  4YM6 B;  5B31 D;  1S32 A;  2CV5 D;  5B0Z A;  2J8P A;  2Y2K A;  1P3L A;  3REH D;  5CPI A;  5GT0 D;  5BT1 C;  5AV9 C;  4J8W C;  3AZG C;  2RVQ D;  3O62 C;  4J8X A;  3B0C W;  3REH B;  3B6F A;  1P3O A;  1P3A B;  5AV9 B;  3EPL A;  4Z5T D;  1M1A B;  3LEL C;  2BYK B;  1P3B A;  3W99 C;  1ID3 D;  5CHL B;  2G5I C;  5AY8 D;  2Y2M A;  3MGQ C;  3W99 B;  2FJ7 A;  3MGS D;  5B24 A;  3AZJ D;  2Y2O A;  3LZ0 D;  1P3K C;  3AL0 C;  3X1S A;  3MGQ B;  5GT3 D;  5AY8 B;  1H3O B;  5BO0 A;  4QLC C;  4JJN D;  2CV5 A;  1P3K B;  2ARO D;  2CWE A;  3AZN C;  3AZH A;  1F66 D;  4R8P C;  3H0M C;  5B0Y D;  5GT0 A;  5B32 C;  3AZN B;  3REJ D;  1F66 B;  4X23 C;  5AV6 B;  2F8N K;  5JRG C;  5B0Y B;  1WWI A;  3WAA D;  5B32 B;  4J8U B;  4Z5T A;  3REJ B;  5BNV A;  3AN2 D;  5FUG B;  4WNN B;  3H0L C;  5E5A A;  3WAA B;  1ID3 A;  4H9N A;  3C1C C;  3X1T D;  3REL D;  2ZY2 A;  2Y2N A;  3MGS A;  3AZJ A;  1ULY A;  4CAY A;  3LZ0 A;  5GT3 A;  3TU4 A;  4WU9 B;  2RIQ A;  3C1B C;  5B33 D;  3REL B;  2PYO B;  3B0D C;  4JJN A;  3W97 B;  5F99 D;  5GSU D;  2ARO A;  4DRA A;  1AOI D;  3AZF B;  5DNM A;  1KX3 C;  3B0D B;  5B33 B;  1P3G D;  4EO5 C;  1P3I B;  5GSU B;  5B2J D;  1P3M C;  1B6W A;  2ZY4 A;  4M6B A;  3FDD A;  5B2I B;  3REI B;  4UUZ A;  1JFI B;  1P3M B;  1P3P C;  3AN2 A;  5B1M C;  1M19 A;  3B0C T;  4XZQ D;  1ZLA C;  3MVD D;  3AZM C;  3KFU G;  4KUD D;  5DNN C;  3WA9 D;  3X1T A;  4LD9 A;  4DQY B;  5GXQ D;  1A7W A;  1ZLA B;  3VH5 W;  2HIO A;  5AVB D;  3AV1 C;  3WTP D;  5B1L C;  3WA9 B;  3AZL D;  5F99 A;  4J8V C;  3MGP B;  3KXB C;  5KDM B;  1AOI A;  3KUY C;  3UTB B;  1P3G A;  3MNN A;  4J8V B;  4KHA A;  3KXB B;  2Y2J A;  3EPK A;  5B2J A;  3KWQ B;  4WU8 C;  1KX5 A;  1TZY B;  5BNX A;  3AYW D;  3AZK A;  3EPJ A;  3AV2 B;  1P3F D;  3LZ1 D;  5AVC D;  3W98 C;  5AV8 D;  4XZQ A;  4ZUX D;  1U35 D;  3MVD A;  3UTA C;  1P3F B;  3A6N C;  4KUD A;  4H9R A;  4XUJ C;  3LJA B;  1KX4 D;  3UT9 B;  5GXQ A;  3VH6 T;  4CSR A;  4ZUX B;  3AZI C;  1P34 D;  1U35 B;  5AVB A;  3WKJ D;  3WTP A;  5JA4 B;  3X1V D;  2YFW B;  4KGC D;  5CPJ C;  5BS7 C;  3AZI B;  1P34 B;  3MGR C;  3AZL A;  2BG1 A;  4YM6 D;  1S32 C;  5AV5 B;  5B0Z C;  5CPK D;  1HQ3 B;  3NQJ B;  3MGR B;  1P3L C;  3V9R A;  2Y2H A;  5CPI C;  1BH8 A;  2NQB B;  5CPK B;  3P5J B;  4AWL C;  4J8X C;  3AYW A;  2ZY5 A;  3A1I A;  4Z66 B;  2LY8 A;  3LZ1 A;  1P3O C;  5AVC A;  1P3A D;  5BT1 D;  5AV9 D;  5AV8 A;  1M1A D;  1P3B C;  1P3O B;  4Z2M H;  1N1J A;  1KX4 A;  2IO5 C;  3NQU A;  4J8W B;  3AZG B;  3O62 B;  3WKJ A;  3X1V A;  5B24 C;  3W99 D;  4KGC A;  3X1S C;  3LEL B;  3MGQ D;  3VH5 T;  2F8N D;  4YM6 A;  4H9Q B;  1P3K D;  3AZH C;  2F8N B;  4QLC D;  1R4V A;  5B31 A;  3AZH B;  4H9O B;  3AZN D;  3X1U C;  5AV6 D;  3REH A;  1W2E A;  4QLC B;  1P3A A;  5AV9 A;  5B32 D;  4J8U D;  1M1A A;  3X1U B;  3EPH A;  4R8P B;  2BYK A;  1Q9C A;  4WV4 B;  5JRG D;  5E5A C;  1ID3 C;  5BNV B;  4YS3 C;  2JE5 A;  4X23 B;  3VH6 W;  5E5A B;  5JRG B;  3MGS C;  2XD5 A;  3AZJ C;  4H9S A;  3IP4 C;  3LZ0 C;  2HUE C;  1BFM A;  3C1C D;  4YS3 B;  3TU4 C;  4NE6 A;  3W96 C;  2NZD C;  3MGQ A;  5AY8 A;  1H3O A;  4WU9 D;  4CAY B;  2PYO D;  3W97 D;  2ARO C;  1P3K A;  3C1C B;  1EQZ C;  3W96 B;  2NZD B;  5DNM C;  4E44 A;  3AZF D;  1EQZ B;  2ZY3 A;  1TAF B;  3AFA C;  1P3I D;  3AZN A;  5CP6 C;  1F1E A;  1F66 A;  3C1B B;  5AV6 A;  5B2I D;  3B6G C;  3REI D;  5B0Y A;  3AFA B;  5B31 G;  5B32 A;  4J8U A;  5CP6 B;  1P3M D;  3REJ A;  3B6G B;  1M19 C;  2DQN C;  1KX3 B;  5FUG A;  4WNN A;  1KU5 A;  4EO5 B;  3WAA A;  3X1T C;  4LD9 C;  1P3P D;  1M19 B;  1BH9 B;  3REK C;  3R45 B;  5B1M D;  2HIO C;  1ZLA D;  4Z2M G;  3AZM D;  4LD9 B;  2G5H C;  4NFT A;  1P3P B;  3REK B;  5B1M B;  4WU9 A;  4WJ3 C;  2W8S A;  3KSY A;  3REL A;  3AZM B;  3W97 A;  5DNN B;  2PYO A;  1AOI C;  3MGP D;  3AZF A;  3MNN C;  3UTB D;  5B33 A;  3AV1 B;  4J8V D;  1P3I A;  5B1L B;  5GSU A;  3KXB D;  4ZBJ C;  1KX5 C;  3KUY D;  3KWQ D;  5B2I A;  3AZK C;  1TZY D;  2BYM B;  3REI A;  3AV2 D;  3AZE C;  5B40 C;  1JFI A;  4ZBJ B;  1P3M A;  1KX5 B;  4XZQ C;  3KUY B;  3AZK B;  3MVD C;  4KUD C;  3AZE B;  5B40 B;  2JSS A;  2F2A C;  5GXQ C;  3LJA D;  3UT9 D;  3EG5 B;  4WU8 B;  3VH5 A;  1ZLA A;  3A6N D;  3WA9 A;  3W98 B;  1M18 C;  3AZI D;  3AZL C;  2YFV B;  3UTA B;  3A6N B;  4XUJ B;  4NE5 A;  3MGP A;  4H9P B;  1M18 B;  5KDM A;  5AV5 D;  1HQ3 D;  1Z2C B;  3UTB A;  3MGR D;  5G49 B;  4J8V A;  3KXB A;  5B0Z D;  5CPJ B;  3KWQ A;  2NQB D;  1TZY A;  4Z66 D;  5AVC C;  3AV2 A;  1S32 B;  5AV8 C;  5B0Z B;  1P3L B;  4J8X D;  3H0R C;  5CPI B;  1P3O D;  3B6F C;  1P3F A;  1KX4 C;  4NE3 A;  3LJA A;  3UT9 A;  2Y2L A;  4J8W D;  3AZG D;  4AWL B;  4J8X B;  4ZUX A;  3O62 D;  5C3I C;  1U35 A;  3B6F B;  3WKJ C;  4KGC C;  2ZM5 A;  5JA4 A;  2YFW A;  1P3B B;  3AZI A;  3LEL D;  2L5A A;  1P34 A;  2FJ7 C;  2IO5 B;  5AV5 A;  5BS7 A;  1HQ3 A;  3NQJ A;  4DRB A;  3MGR A;  2F8N H;  2FJ7 B;  5B31 C;  5B24 B;  2CV5 C;  3X1S B;  3AZH D;  2NQB A;  5CPK A;  4Z66 A;  3REH C;  5B31 B;  5BO0 B;  2CV5 B;  5GT0 C;  1P3A C;  1M1A C;  2RVQ C;  3X1U D;  4R8P D;  4G92 C;  5GT0 B;  4Z5T C;  4J8W A;  3AZG A;  3O62 A;  4X23 D;  4G92 B;  5E5A D;  4H9S C;  4Z5T B;  4G91 C;  2Y2G A;  4YS3 D;  5AY8 C;  3LEL A;  3F6T A;  3WTP E;  4H9Q A;  1ID3 B;  4H9N B;  4G91 B;  3W99 A;  3TU4 D;  3W96 D;  2NZD D;  5GT3 C;  3MGS B;  3AZJ B;  4JJN C;  2F8N A;  3LZ0 B;  2HUE B;  1EQZ D;  5GT3 B;  3TU4 B;  4H9O A;  5DNM D;  1F66 C;  5AV6 C;  3C1B D;  5B0Y C;  4JJN B;  4QLC A;  3AFA D;  4J8U C;  2ARO B;  3REJ C;  5CP6 D;  3X1U A;  5DNM B;  3B6G D;  4R8P A;  1KX3 D;  2DF4 C;  3WAA C;  3B0B A;  1M19 D;  3VH6 A;  4E45 A;  3AN2 C;  4X23 A;  4UUZ B;  5JRG A;  4LD9 D;  4YS3 A;  3AN2 B;  3REK D;  4WU9 C;  2HIO D;  3REL C;  2PYO C;  3W97 C;  3X1T B;  5DNN D;  3W96 A;  3C1C A;  2NZD A;  3AZF C;  5B33 C;  2HIO B;  1P3I C;  5F99 C;  3AV1 D;  5GSU C;  4WZS B;  1EQZ A;  1TAF A;  5B1L D;  4HGA C;  5B2I C;  3MNN D;  3REI C;  3C1B A;  1P3G C;  5F99 B;  2F8N G;  3AFA A;  4HGA B;  1AOI B;  5B2J C;  5CP6 A;  1KX5 D;  3B6G A;  1P3G B;  3MNN B;  3AZK D;  1KX3 A;  4KHA B;  3AZE D;  5B40 D;  5B2J B;  1BH9 A;  3R45 A;  5BNX B;  4WU8 D;  1B67 A;  3WA9 C;  5B32 G;  1P3P A;  3REK A;  3W98 D;  4XZQ B;  5B1M A;  3MVD B;  4KUD B;  5AVB C;  4H9R B;  3WTP C;  3UTA D;  3AZM A;  5DNN A;  3MGP C;  5GXQ B;  4XUJ D;  4CSR B;  2VQR A;  3UTB C;  1M18 D;  5AVB B;  3WTP B;  3AV1 A;  1T3U A;  5B1L A;  3KWQ C;  5CPJ D;  1TZY C;  2Y2P A;  2FFF B;  3AZL B;  2XD1 A;  2BYM A;  2Y2Q A;  3AV2 C;  1S32 D;  4UPK A;  3KUY A;  3V9R B;  3AYW C;  1P3L D;  1P3F C;  3LZ1 C;  3AZE A;  5B40 A;  5CPI D;  3LJA C;  1BH8 B;  3UT9 C;  1WWS A;  3AYW B;  4WU8 A;  4ZUX C;  1U35 C;  1PZR A;  3LZ1 B;  3B6F D;  5AVC B;  3A1K A;  2UWX A;  5AV8 B;  3W98 A;  1P34 C;  1HTA A;  1P3B D;  2YFV A;  1N1J B;  3UTA A;  3A6N A;  3X1V C;  1KX4 B;  4XUJ A;  3NQU B;  5AV5 C;  1HQ3 C;  4H9P A;  1M18 A;  3WKJ B;  2JCH A;  5C3I B;  5G49 A;  3X1V B;  4YM6 C;  4KGC B;  2FJ7 D;  5B24 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...