5AY8C

Crystal structure of human nucleosome containing h3.y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8C00
5CPJD 5AV8A 5KDMA 3AV1B 1HQ3A 3WA9A 5B32B 1EQZB 5B31A 5B33D 3W97D 4KGCC 3MNNC 4NE3A 3MNNA 3UTAB 4WZSB 5BS7C 3WTPA 3MGRD 4JJNA 2HUEC 4QLCB 3VH5W 1HTAA 4WU8B 1P3BC 1P3GB 5B1MA 1P3PC 4R8PD 1TZYD 5DNMD 3AN2A 3UTAD 1KX3C 3X1VC 3AZEC 5AV9B 5AVCD 2JSSA 5AVBD 3W98D 3KWQC 3VH6A 1BH9B 3MGSD 3REJC 5DNNB 3WAAD 2AROB 3B6GA 4E45A 4H9QA 3MGQA 5B0YC 5BT1C 1P3AD 4H9SA 3X1TB 5B40A 4J8UD 3X1SD 1KX4B 1TAFB 3KXBB 3NQUA 3O62B 3AFAB 5F99D 5GXQC 1S32B 2NQBB 2AROD 3R45A 5CHLB 3UTBC 5AV8D 1HQ3D 3WA9D 2NZDC 5AV5A 4G91C 5B31D 2F8NA 5G49B 3B6FD 3REHC 5B2JA 3REHA 4CSRA 5BNVB 1P3KB 5CP6A 4J8WA 3WTPD 4JJND 1P3LC 5GT3C 4HGAC 5FUGA 3TU4C 4KUDA 1P3FB 5B1MD 3A6NB 1M18A 5CPIA 3C1CB 3AN2D 3V9RB 5GSUB 3MGPC 3MVDA 1H3OB 3VH5A 3AYWB 1ID3B 2FJ7A 1Q9CA 5BO0A 3LZ1A 3UT9A 5JRGC 4UUZA 5JRGA 3AZHC 5GT0B 1P3FD 1P3MA 3AZGC 2PYOB 3B6GD 1M1AB 3AZGA 5CPKB 3MGQD 4X23B 1ZLAB 4LD9A 3AZKD 4YM6C 4H9OA 3REIB 5B40D 5B0ZA 5E5AB 5C3IB 3AZIA 2BYKA 4WU9A 2HIOB 3AZJA 4H9PA 3AZLB 2F8NK 5CPJC 5CPJA 4ZUXB 3B0DC 5AY8D 5AV5D 3RELA 5B33C 2IO5B 3W97C 1B6WA 4YS3A 5B2JD 3AV2B 5B2IB 4J8VA 5CP6D 4J8WD 3MGRC 3X1UB 3AZLD 1KU5A 3AV1A 5BNXB 5B32A 3NQJA 4KUDD 4H9RB 1EQZA 1M18D 5CPID 4R8PC 3AV2D 1TZYC 5DNMC 1TZYA 3UTAC 5B2ID 3UTAA 4Z66B 3MVDD 1BH8B 1U35B 5AVCC 5AVBC 3X1UD 5AVCA 3W98C 2FJ7D 2F8NH 3MGSC 4QLCA 3KSYA 3LZ1D 3UT9D 3WAAC 4WU8A 4G92C 1P3MD 1P3GA 4LD9D 1P3AC 4XUJB 5B0ZD 4J8UC 4Z5TB 3X1SC 5AV9A 5B24D 1P34B 1BH9A 5DNNA 4CAYB 5F99C 3AZJD 2AROC 2BYMB 5F99A 4J8XB 2AROA 3W96B 5AV8C 1HQ3C 1M19B 3WA9C 5B31C 1B67A 3RELD 3X1TA 3AZNB 3B6FC 5B31G 3B6FA 4YS3D 4J8VD 1F66B 3KXBA 3AFAA 3O62A 1P3IB 3WTPC 4JJNC 4J8XD 3AZFB 1S32A 2NQBA 3W96D 3LJAB 4Z2MH 3REKB 3AV1D 5JA4B 5B32D 1EQZD 3WKJB 5G49A 5B1MC 1KX5B 3AN2C 4EO5C 4AWLB 1P3ID 1P3KA 3LELB 2YFVB 5AV6B 4QLCD 3REKD 3KUYB 4WU8D 1P3FC 3B6GC 1P3OB 1P3FA 1P3GD 4KHAB 3A6NA 3MGQC 3AZKC 4H9SC 3C1CA 3AZKA 3V9RA 5B40C 5AV9D 3AYWA 1ID3A 5DNND 2L5AA 2PYOA 5GT0A 3C1BB 3B0CW 1ZLAA 4X23A 5AY8C 5AV5C 5AY8A 3X1TD 5E5AA 2F8NG 5C3IC 5B2JC 3LZ0B 2YFWB 1KX4D 1A7WA 1N1JB 3KXBD 3AFAD 3O62D 5CP6C 4J8WC 2HIOA 1S32D 3AZLC 2NQBD 3AZLA 5B1LB 4ZUXA 4KUDC 4KGCB 3MNNB 4XZQB 1M18C 5CPIC 1AOIB 3AV2C 3AV2A 5B2IC 2HUEB 5B2IA 3AZMB 3MVDC 1P3KD 3X1UC 2LY8A 3X1UA 2FJ7C 5B1LD 4DRAA 3LZ1C 1P3BB 3UT9C 1P3PB 5BNXA 1P3MC 4H9RA 1WWSA 4XZQD 1KX3B 3A6ND 3AZEB 3X1VB 1AOID 4LD9C 3C1CD 3AZMD 5B0ZC 3KWQB 5GSUD 4Z66A 3REJB 3AZIC 1BH8A 5B24C 4Z2MG 1U35A 5B24A 3AYWD 4WU9C 1ID3D 3AZJC 5B0YB 2PYOD 5GT0D 1M1AD 5CPKD 1ZLAD 4X23D 3RELC 3REID 5E5AD 4Z5TA 4DRBA 4YS3C 5GXQB 4J8VC 3UTBB 4CAYA 2HIOD 4J8XC 2BYMA 3W96C 4J8XA 2F8NB 3W96A 2NZDB 4G91B 3WTPE 3AV1C 4ZUXD 1M19A 5B32C 1EQZC 4E44A 3AZNA 1P3LB 1F66A 5GT3B 1P3IC 1P3IA 3AZFA 5FUGB 4HGAB 3TU4B 4QLCC 3REKC 3LJAA 3REKA 5JA4A 4WU8C 3WKJA 1P3GC 3MGPB 1KX5A 4Z66D 5AV9C 1U35D 3LELA 2YFVA 5AV6A 5DNNC 3AZHB 3KUYA 3W99B 4ZBJB 4YM6B 1P3OA 4KHAA 1WWIA 4XUJD 3VH6T 3X1TC 4Z5TD 1P34D 1KX4C 1KX4A 3KXBC 3AFAC 1TAFA 3O62C 2RVQD 3W99D 2CV5B 1S32C 2NQBC 1JFIB 5B33B 3W97B 1M19D 3AZND 3LZ0A 2YFWA 3MGRB 1N1JA 5BNVA 1F66D 4NE5A 1P3KC 2CV5D 3AZFD 3NQJB 5B1LC 5B1LA 3LJAD 4R8PB 3WKJD 1TZYB 5DNMB 4KGCA 4XZQC 3A6NC 4XZQA 1AOIC 1KX5D 1AOIA 3C1CC 5AVCB 5BS7A 5AVBB 3AZMC 3W98B 5GSUC 3AZMA 3MGSB 5GSUA 1H3OA 3LELD 3WAAB 3AYWC 4G92B 2CWEA 5AV6D 1ID3C 1P3BA 4WNNB 3KUYD 1P3PA 2PYOC 1P3AB 5GT0C 1P3OD 1M1AC 5CPKC 1M1AA 4X23C 4J8UB 3AZEA 3X1VA 5CPKA 4H9NB 3X1SB 1KX3A 1ZLAC 3VH5T 3REIC 3KWQA 5E5AC 3REIA 3REJA 5F99B 5AV8B 5KDMB 1HQ3B 2HIOC 3WA9B 5B0YA 5B31B 3C1BD 4ZUXC 3B6FB 2IO5C 3LZ0D 3WTPB 4JJNB 5GXQA 3UTBA 2NZDA 5B1MB 4KGCD 3AN2B 3MNND 4EO5B 3B0CT 1P3LA 4Z66C 1BFMA 5GT3A 1U35C 3TU4A 1P3BD 3B6GB 4H9QB 1P3PD 3MGQB 3AZKB 4M6BA 1KX3D 5B40B 3AZED 3X1VD 3MGPA 4XUJC 4XUJA 3KWQD 3NQUB 4NFTA 4Z5TC 3REJD 1P34C 1P34A 3R45B 3AZHA 2RVQC 3W99C 4WV4B 3W99A 4ZBJC 5B0YD 5BT1D 5AY8B 5AV5B 4YM6A 1M19C 1R4VA 5B2JB 3REHB 4CSRB 3AZNC 3B0BA 5B32G 5CP6B 4J8WB 5GXQD 1F66C 3UTBD 2CV5C 3AZFC 2CV5A 1JFIA 2F8ND 3LJAC 4KUDB 2NZDD 5B33A 3W97A 1M18B 3REHD 5CPIB 3WKJC 1KX5C 3MVDB 3MGRA 1P3LD 2FJ7B 4AWLC 5GT3D 5BO0B 1ULYA 3VH6W 3LZ1B 3UT9B 3LELC 5AV6C 4UUZB 5JRGB 3TU4D 1P3MB 3KUYC 3AZGB 4LD9B 4R8PA 1P3OC 4H9OB 5DNMA 5B0ZB 3MGPD 3AZIB 5B24B 5AVBA 3W98A 2BYKB 4WU9B 3MGSA 3AZJB 4H9PB 5JRGD 3WAAA 3AZHD 5CPJB 3AZGD 4WNNA 1P3AA 3B0DB 4YM6D 3C1BC 3RELB 3C1BA 1F1EA 4J8UA 3AZID 4H9NA 3X1SA 4NE6A 4YS3B 4WU9D 4J8VB 3LZ0C
chains in the Genus database with same CATH superfamily
5CPJD 5AV8A 5KDMA 3AV1B 1HQ3A 3WA9A 5B32B 2G5IC 5B31A 1EQZB 5B33D 3W97D 2XD5A 4KGCC 3MNNC 4NE3A 3MNNA 3UTAB 4WZSB 5BS7C 3WTPA 3MGRD 4JJNA 2HUEC 4QLCB 3VH5W 1HTAA 3EPJA 3IP4C 4WU8B 2VQRA 2Y2LA 1P3BC 1P3GB 5B1MA 1P3PC 4R8PD 1TZYD 5DNMD 3AN2A 3UTAD 1KX3C 3X1VC 3AZEC 5AV9B 5AVCD 2Y2HA 2JSSA 5AVBD 3KWQC 3VH6A 3W98D 1BH9B 3MGSD 3REJC 5DNNB 3WAAD 2AROB 3B6GA 4E45A 4H9QA 2RIQA 5B0YC 3MGQA 5BT1C 1P3AD 4H9SA 3X1TB 5B40A 2ZM5A 4J8UD 3X1SD 1KX4B 1TAFB 3KXBB 3NQUA 3O62B 3AFAB 5F99D 5GXQC 1S32B 2NQBB 2AROD 3R45A 2ZY2A 5CHLB 3UTBC 5AV8D 1HQ3D 3WA9D 2NZDC 5AV5A 4G91C 5B31D 2F8NA 5G49B 3B6FD 3REHC 5B2JA 3REHA 4CSRA 5BNVB 1P3KB 5CP6A 4J8WA 3WTPD 2ZY3A 4JJND 1P3LC 5GT3C 2Y2PA 4HGAC 5FUGA 3TU4C 4KUDA 1P3FB 5B1MD 3A6NB 1M18A 5CPIA 2Y2IA 3C1CB 3AN2D 3V9RB 5GSUB 3MGPC 3MVDA 1H3OB 3VH5A 3AYWB 1ID3B 2FJ7A 1Q9CA 5BO0A 3LZ1A 3UT9A 5JRGC 4UUZA 5JRGA 3AZHC 5GT0B 1P3FD 1P3MA 3AZGC 2PYOB 3B6GD 1M1AB 3AZGA 5CPKB 3MGQD 4X23B 1ZLAB 4LD9A 3AZKD 4YM6C 4H9OA 3REIB 5B40D 5B0ZA 5E5AB 5C3IB 3P5JB 3AZIA 2BYKA 4WU9A 2Y2QA 2HIOB 3AZJA 4H9PA 3AZLB 2F8NK 5CPJC 5CPJA 4ZUXB 3B0DC 5AY8D 5AV5D 3RELA 5B33C 2IO5B 3W97C 2ZY4A 1B6WA 4YS3A 5B2JD 3AV2B 5B2IB 4J8VA 5CP6D 4J8WD 3MGRC 3X1UB 3AZLD 1KU5A 3AV1A 5BNXB 2Y2NA 5B32A 3NQJA 4KUDD 4H9RB 1EQZA 1M18D 5CPID 4R8PC 3AV2D 1TZYC 5DNMC 1TZYA 3UTAC 5B2ID 3UTAA 4Z66B 3MVDD 1BH8B 1U35B 5AVCC 5AVBC 3X1UD 5AVCA 3W98C 2FJ7D 2F8NH 3MGSC 4QLCA 3KSYA 3LZ1D 3UT9D 3WAAC 4WU8A 4G92C 1P3MD 1P3GA 4LD9D 1P3AC 4XUJB 3KFUG 5B0ZD 4J8UC 4Z5TB 3X1SC 5AV9A 5B24D 1P34B 1BH9A 5DNNA 4CAYB 5F99C 3AZJD 2AROC 2BYMB 5F99A 4J8XB 2AROA 3W96B 5AV8C 1HQ3C 1M19B 3WA9C 5B31C 1B67A 3RELD 3X1TA 3AZNB 3B6FC 5B31G 3B6FA 4YS3D 4J8VD 1F66B 3KXBA 3AFAA 3O62A 1P3IB 3WTPC 4JJNC 4J8XD 3AZFB 1S32A 2NQBA 3W96D 3LJAB 4WJ3C 4Z2MH 3REKB 3AV1D 5JA4B 5B32D 3EPHA 1EQZD 2DF4C 3WKJB 5G49A 5B1MC 1KX5B 3AN2C 4EO5C 4AWLB 1P3ID 1P3KA 3LELB 2YFVB 5AV6B 4QLCD 3REKD 3KUYB 4WU8D 2Y2GA 1P3FC 3B6GC 1P3OB 1P3FA 1P3GD 4KHAB 3A6NA 3MGQC 3AZKC 4H9SC 3C1CA 3AZKA 3V9RA 2Y2KA 5B40C 1T3UA 5AV9D 3AYWA 1ID3A 5DNND 2L5AA 2PYOA 5GT0A 3C1BB 3B0CW 1ZLAA 4X23A 5AY8C 5AV5C 2UWXA 5AY8A 3X1TD 2F2AC 5E5AA 2F8NG 5C3IC 5B2JC 3LZ0B 2YFWB 1KX4D 1A7WA 1N1JB 3KXBD 3AFAD 3O62D 2G5HC 5CP6C 4J8WC 1KX3A 2HIOA 1S32D 3AZLC 2NQBD 3AZLA 5B1LB 4ZUXA 4KUDC 4KGCB 3MNNB 4XZQB 1M18C 5CPIC 1AOIB 3AV2C 3AV2A 5B2IC 2HUEB 5B2IA 3AZMB 3MVDC 1P3KD 3X1UC 2LY8A 3X1UA 2FJ7C 3A1KA 5B1LD 4DRAA 3LZ1C 1P3BB 3UT9C 1P3PB 5BNXA 4DQYB 1P3MC 4H9RA 1WWSA 4XZQD 1KX3B 3A6ND 3AZEB 3X1VB 1AOID 4LD9C 3C1CD 3AZMD 5B0ZC 3KWQB 5GSUD 4Z66A 3REJB 3AZIC 1BH8A 5B24C 4Z2MG 1U35A 5B24A 3H0LC 3AYWD 4WU9C 1ID3D 3AZJC 5B0YB 2PYOD 5GT0D 1M1AD 5CPKD 1ZLAD 4X23D 3RELC 3REID 5E5AD 4Z5TA 4DRBA 4YS3C 5GXQB 4J8VC 3UTBB 4CAYA 2HIOD 4J8XC 2BYMA 3W96C 4J8XA 2F8NB 3W96A 2NZDB 4G91B 3WTPE 3AV1C 4ZUXD 1M19A 5B32C 1EQZC 4E44A 3AZNA 2Y2MA 1P3LB 1F66A 5GT3B 1P3IC 1P3IA 3AZFA 5FUGB 4HGAB 3TU4B 4QLCC 3REKC 3LJAA 3REKA 5JA4A 4WU8C 3WKJA 1P3GC 3MGPB 1KX5A 4Z66D 5AV9C 1U35D 3LELA 2YFVA 5AV6A 5DNNC 3AZHB 3KUYA 3W99B 4ZBJB 4YM6B 1P3OA 4KHAA 1WWIA 1W2EA 4XUJD 3VH6T 3X1TC 4Z5TD 1P34D 1KX4C 1KX4A 3KXBC 3AFAC 1TAFA 3O62C 2RVQD 3W99D 2CV5B 1S32C 2NQBC 1JFIB 2Y2OA 5B33B 3W97B 1M19D 2ZY5A 3AZND 3LZ0A 2YFWA 3MGRB 2J8PA 1N1JA 5BNVA 1F66D 3AL0C 4NE5A 1P3KC 2CV5D 3AZFD 3NQJB 5B1LC 5B1LA 3LJAD 4R8PB 3WKJD 1TZYB 5DNMB 4KGCA 4XZQC 3A6NC 4XZQA 1AOIC 1KX5D 1AOIA 3EPKA 3C1CC 5AVCB 5BS7A 5AVBB 3AZMC 3W98B 5GSUC 3AZMA 3MGSB 5GSUA 1H3OA 3LELD 3WAAB 3AYWC 4G92B 2CWEA 5AV6D 1ID3C 1P3BA 4WNNB 3KUYD 1P3PA 2PYOC 1P3AB 5GT0C 1P3OD 1M1AC 5CPKC 1M1AA 4X23C 4J8UB 3AZEA 3X1VA 5CPKA 4H9NB 3X1SB 1PZRA 1ZLAC 3VH5T 3REIC 3KWQA 5E5AC 3REIA 3REJA 5F99B 1Z2CB 5AV8B 5KDMB 1HQ3B 2HIOC 3WA9B 5B0YA 5B31B 3C1BD 4ZUXC 3B6FB 2JCHA 2IO5C 4UPKA 3LZ0D 3WTPB 4JJNB 5GXQA 2W8SA 3UTBA 2NZDA 5B1MB 2JE5A 4KGCD 3AN2B 3MNND 4EO5B 3B0CT 1P3LA 4Z66C 1BFMA 5GT3A 1U35C 3TU4A 1P3BD 3B6GB 2DQNC 4H9QB 1P3PD 3MGQB 3AZKB 4M6BA 2BG1A 1KX3D 5B40B 3AZED 3X1VD 3MGPA 4XUJC 4XUJA 3KWQD 3NQUB 4NFTA 4Z5TC 3REJD 1P34C 1P34A 3R45B 2Y2JA 3AZHA 2RVQC 3W99C 4WV4B 3W99A 4ZBJC 5B0YD 5BT1D 5AY8B 5AV5B 4YM6A 1M19C 1R4VA 5B2JB 3REHB 4CSRB 3AZNC 3B0BA 5B32G 5CP6B 4J8WB 3H0MC 5GXQD 1F66C 3UTBD 2CV5C 3AZFC 2CV5A 1JFIA 2F8ND 3LJAC 4KUDB 2NZDD 5B33A 3W97A 1M18B 3REHD 5CPIB 3EG5B 3WKJC 3EPLA 1KX5C 3MVDB 3MGRA 1P3LD 2FJ7B 4AWLC 5GT3D 5BO0B 3F6TA 1ULYA 3VH6W 3LZ1B 3FDDA 3UT9B 2FFFB 3LELC 2XD1A 5AV6C 4UUZB 5JRGB 3TU4D 1P3MB 3KUYC 3AZGB 4LD9B 4R8PA 1P3OC 4H9OB 5DNMA 5B0ZB 3MGPD 3AZIB 5B24B 5AVBA 3W98A 2BYKB 3A1IA 4WU9B 3MGSA 3AZJB 4H9PB 5JRGD 3WAAA 3AZHD 5CPJB 3AZGD 4WNNA 1P3AA 3B0DB 4YM6D 3C1BC 3RELB 3C1BA 1F1EA 4J8UA 3AZID 4H9NA 3X1SA 4NE6A 4YS3B 3H0RC 4WU9D 4J8VB 3LZ0C
chains in the Genus database with same CATH topology
5CPJD 5AV8A 5KDMA 3AV1B 1HQ3A 3WA9A 5B32B 2G5IC 5B31A 1EQZB 5B33D 3W97D 2XD5A 4KGCC 3MNNC 4NE3A 3MNNA 3UTAB 4WZSB 5BS7C 3WTPA 3MGRD 4JJNA 2HUEC 4QLCB 3VH5W 1HTAA 3EPJA 3IP4C 4WU8B 2VQRA 2Y2LA 1P3BC 1P3GB 5B1MA 1P3PC 4R8PD 1TZYD 5DNMD 3AN2A 3UTAD 1KX3C 3X1VC 3AZEC 5AV9B 5AVCD 2Y2HA 2JSSA 5AVBD 3KWQC 3VH6A 3W98D 1BH9B 3MGSD 3REJC 5DNNB 3WAAD 2AROB 3B6GA 4E45A 4H9QA 2RIQA 5B0YC 3MGQA 5BT1C 1P3AD 4H9SA 3X1TB 5B40A 2ZM5A 4J8UD 3X1SD 1KX4B 1TAFB 3KXBB 3NQUA 3O62B 3AFAB 5F99D 5GXQC 1S32B 2NQBB 2AROD 3R45A 2ZY2A 5CHLB 3UTBC 5AV8D 1HQ3D 3WA9D 2NZDC 5AV5A 4G91C 5B31D 2F8NA 5G49B 3B6FD 3REHC 5B2JA 3REHA 4CSRA 5BNVB 1P3KB 5CP6A 4J8WA 3WTPD 2ZY3A 4JJND 1P3LC 5GT3C 2Y2PA 4HGAC 5FUGA 3TU4C 4KUDA 1P3FB 5B1MD 3A6NB 1M18A 5CPIA 2Y2IA 3C1CB 3AN2D 3V9RB 5GSUB 3MGPC 3MVDA 1H3OB 3VH5A 3AYWB 1ID3B 2FJ7A 1Q9CA 5BO0A 3LZ1A 3UT9A 5JRGC 4UUZA 5JRGA 3AZHC 5GT0B 1P3FD 1P3MA 3AZGC 2PYOB 3B6GD 1M1AB 3AZGA 5CPKB 3MGQD 4X23B 1ZLAB 4LD9A 3AZKD 4YM6C 4H9OA 3REIB 5B40D 5B0ZA 5E5AB 5C3IB 3P5JB 3AZIA 2BYKA 4WU9A 2Y2QA 2HIOB 3AZJA 4H9PA 3AZLB 2F8NK 5CPJC 5CPJA 4ZUXB 3B0DC 5AY8D 5AV5D 3RELA 5B33C 2IO5B 3W97C 2ZY4A 1B6WA 4YS3A 5B2JD 3AV2B 5B2IB 4J8VA 5CP6D 4J8WD 3MGRC 3X1UB 3AZLD 1KU5A 3AV1A 5BNXB 2Y2NA 5B32A 3NQJA 4KUDD 4H9RB 1EQZA 1M18D 5CPID 4R8PC 3AV2D 1TZYC 5DNMC 1TZYA 3UTAC 5B2ID 3UTAA 4Z66B 3MVDD 1BH8B 1U35B 5AVCC 5AVBC 3X1UD 5AVCA 3W98C 2FJ7D 2F8NH 3MGSC 4QLCA 3KSYA 3LZ1D 3UT9D 3WAAC 4WU8A 4G92C 1P3MD 1P3GA 4LD9D 1P3AC 4XUJB 3KFUG 5B0ZD 4J8UC 4Z5TB 3X1SC 5AV9A 5B24D 1P34B 1BH9A 5DNNA 4CAYB 5F99C 3AZJD 2AROC 2BYMB 5F99A 4J8XB 2AROA 3W96B 5AV8C 1HQ3C 1M19B 3WA9C 5B31C 1B67A 3RELD 3X1TA 3AZNB 3B6FC 5B31G 3B6FA 4YS3D 4J8VD 1F66B 3KXBA 3AFAA 3O62A 1P3IB 3WTPC 4JJNC 4J8XD 3AZFB 1S32A 2NQBA 3W96D 3LJAB 4WJ3C 4Z2MH 3REKB 3AV1D 5JA4B 5B32D 3EPHA 1EQZD 2DF4C 3WKJB 5G49A 5B1MC 1KX5B 3AN2C 4EO5C 4AWLB 1P3ID 1P3KA 3LELB 2YFVB 5AV6B 4QLCD 3REKD 3KUYB 4WU8D 2Y2GA 1P3FC 3B6GC 1P3OB 1P3FA 1P3GD 4KHAB 3A6NA 3MGQC 3AZKC 4H9SC 3C1CA 3AZKA 3V9RA 2Y2KA 5B40C 1T3UA 5AV9D 3AYWA 1ID3A 5DNND 2L5AA 2PYOA 5GT0A 3C1BB 3B0CW 1ZLAA 4X23A 5AY8C 5AV5C 2UWXA 5AY8A 3X1TD 2F2AC 5E5AA 2F8NG 5C3IC 5B2JC 3LZ0B 2YFWB 1KX4D 1A7WA 1N1JB 3KXBD 3AFAD 3O62D 2G5HC 5CP6C 4J8WC 1KX3A 2HIOA 1S32D 3AZLC 2NQBD 3AZLA 5B1LB 4ZUXA 4KUDC 4KGCB 3MNNB 4XZQB 1M18C 5CPIC 1AOIB 3AV2C 3AV2A 5B2IC 2HUEB 5B2IA 3AZMB 3MVDC 1P3KD 3X1UC 2LY8A 3X1UA 2FJ7C 3A1KA 5B1LD 4DRAA 3LZ1C 1P3BB 3UT9C 1P3PB 5BNXA 4DQYB 1P3MC 4H9RA 1WWSA 4XZQD 1KX3B 3A6ND 3AZEB 3X1VB 1AOID 4LD9C 3C1CD 3AZMD 5B0ZC 3KWQB 5GSUD 4Z66A 3REJB 3AZIC 1BH8A 5B24C 4Z2MG 1U35A 5B24A 3H0LC 3AYWD 4WU9C 1ID3D 3AZJC 5B0YB 2PYOD 5GT0D 1M1AD 5CPKD 1ZLAD 4X23D 3RELC 3REID 5E5AD 4Z5TA 4DRBA 4YS3C 5GXQB 4J8VC 3UTBB 4CAYA 2HIOD 4J8XC 2BYMA 3W96C 4J8XA 2F8NB 3W96A 2NZDB 4G91B 3WTPE 3AV1C 4ZUXD 1M19A 5B32C 1EQZC 4E44A 3AZNA 2Y2MA 1P3LB 1F66A 5GT3B 1P3IC 1P3IA 3AZFA 5FUGB 4HGAB 3TU4B 4QLCC 3REKC 3LJAA 3REKA 5JA4A 4WU8C 3WKJA 1P3GC 3MGPB 1KX5A 4Z66D 5AV9C 1U35D 3LELA 2YFVA 5AV6A 5DNNC 3AZHB 3KUYA 3W99B 4ZBJB 4YM6B 1P3OA 4KHAA 1WWIA 1W2EA 4XUJD 3VH6T 3X1TC 4Z5TD 1P34D 1KX4C 1KX4A 3KXBC 3AFAC 1TAFA 3O62C 2RVQD 3W99D 2CV5B 1S32C 2NQBC 1JFIB 2Y2OA 5B33B 3W97B 1M19D 2ZY5A 3AZND 3LZ0A 2YFWA 3MGRB 2J8PA 1N1JA 5BNVA 1F66D 3AL0C 4NE5A 1P3KC 2CV5D 3AZFD 3NQJB 5B1LC 5B1LA 3LJAD 4R8PB 3WKJD 1TZYB 5DNMB 4KGCA 4XZQC 3A6NC 4XZQA 1AOIC 1KX5D 1AOIA 3EPKA 3C1CC 5AVCB 5BS7A 5AVBB 3AZMC 3W98B 5GSUC 3AZMA 3MGSB 5GSUA 1H3OA 3LELD 3WAAB 3AYWC 4G92B 2CWEA 5AV6D 1ID3C 1P3BA 4WNNB 3KUYD 1P3PA 2PYOC 1P3AB 5GT0C 1P3OD 1M1AC 5CPKC 1M1AA 4X23C 4J8UB 3AZEA 3X1VA 5CPKA 4H9NB 3X1SB 1PZRA 1ZLAC 3VH5T 3REIC 3KWQA 5E5AC 3REIA 3REJA 5F99B 1Z2CB 5AV8B 5KDMB 1HQ3B 2HIOC 3WA9B 5B0YA 5B31B 3C1BD 4ZUXC 3B6FB 2JCHA 2IO5C 4UPKA 3LZ0D 3WTPB 4JJNB 5GXQA 2W8SA 3UTBA 2NZDA 5B1MB 2JE5A 4KGCD 3AN2B 3MNND 4EO5B 3B0CT 1P3LA 4Z66C 1BFMA 5GT3A 1U35C 3TU4A 1P3BD 3B6GB 2DQNC 4H9QB 1P3PD 3MGQB 3AZKB 4M6BA 2BG1A 1KX3D 5B40B 3AZED 3X1VD 3MGPA 4XUJC 4XUJA 3KWQD 3NQUB 4NFTA 4Z5TC 3REJD 1P34C 1P34A 3R45B 2Y2JA 3AZHA 2RVQC 3W99C 4WV4B 3W99A 4ZBJC 5B0YD 5BT1D 5AY8B 5AV5B 4YM6A 1M19C 1R4VA 5B2JB 3REHB 4CSRB 3AZNC 3B0BA 5B32G 5CP6B 4J8WB 3H0MC 5GXQD 1F66C 3UTBD 2CV5C 3AZFC 2CV5A 1JFIA 2F8ND 3LJAC 4KUDB 2NZDD 5B33A 3W97A 1M18B 3REHD 5CPIB 3EG5B 3WKJC 3EPLA 1KX5C 3MVDB 3MGRA 1P3LD 2FJ7B 4AWLC 5GT3D 5BO0B 3F6TA 1ULYA 3VH6W 3LZ1B 3FDDA 3UT9B 2FFFB 3LELC 2XD1A 5AV6C 4UUZB 5JRGB 3TU4D 1P3MB 3KUYC 3AZGB 4LD9B 4R8PA 1P3OC 4H9OB 5DNMA 5B0ZB 3MGPD 3AZIB 5B24B 5AVBA 3W98A 2BYKB 3A1IA 4WU9B 3MGSA 3AZJB 4H9PB 5JRGD 3WAAA 3AZHD 5CPJB 3AZGD 4WNNA 1P3AA 3B0DB 4YM6D 3C1BC 3RELB 3C1BA 1F1EA 4J8UA 3AZID 4H9NA 3X1SA 4NE6A 4YS3B 3H0RC 4WU9D 4J8VB 3LZ0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ D;  5AV8 A;  5KDM A;  3AV1 B;  1HQ3 A;  3WA9 A;  5B32 B;  1EQZ B;  5B31 A;  5B33 D;  3W97 D;  4KGC C;  3MNN C;  4NE3 A;  3MNN A;  3UTA B;  4WZS B;  5BS7 C;  3WTP A;  3MGR D;  4JJN A;  2HUE C;  4QLC B;  3VH5 W;  1HTA A;  4WU8 B;  1P3B C;  1P3G B;  5B1M A;  1P3P C;  4R8P D;  1TZY D;  5DNM D;  3AN2 A;  3UTA D;  1KX3 C;  3X1V C;  3AZE C;  5AV9 B;  5AVC D;  2JSS A;  5AVB D;  3W98 D;  3KWQ C;  3VH6 A;  1BH9 B;  3MGS D;  3REJ C;  5DNN B;  3WAA D;  2ARO B;  3B6G A;  4E45 A;  4H9Q A;  3MGQ A;  5B0Y C;  5BT1 C;  1P3A D;  4H9S A;  3X1T B;  5B40 A;  4J8U D;  3X1S D;  1KX4 B;  1TAF B;  3KXB B;  3NQU A;  3O62 B;  3AFA B;  5F99 D;  5GXQ C;  1S32 B;  2NQB B;  2ARO D;  3R45 A;  5CHL B;  3UTB C;  5AV8 D;  1HQ3 D;  3WA9 D;  2NZD C;  5AV5 A;  4G91 C;  5B31 D;  2F8N A;  5G49 B;  3B6F D;  3REH C;  5B2J A;  3REH A;  4CSR A;  5BNV B;  1P3K B;  5CP6 A;  4J8W A;  3WTP D;  4JJN D;  1P3L C;  5GT3 C;  4HGA C;  5FUG A;  3TU4 C;  4KUD A;  1P3F B;  5B1M D;  3A6N B;  1M18 A;  5CPI A;  3C1C B;  3AN2 D;  3V9R B;  5GSU B;  3MGP C;  3MVD A;  1H3O B;  3VH5 A;  3AYW B;  1ID3 B;  2FJ7 A;  1Q9C A;  5BO0 A;  3LZ1 A;  3UT9 A;  5JRG C;  4UUZ A;  5JRG A;  3AZH C;  5GT0 B;  1P3F D;  1P3M A;  3AZG C;  2PYO B;  3B6G D;  1M1A B;  3AZG A;  5CPK B;  3MGQ D;  4X23 B;  1ZLA B;  4LD9 A;  3AZK D;  4YM6 C;  4H9O A;  3REI B;  5B40 D;  5B0Z A;  5E5A B;  5C3I B;  3AZI A;  2BYK A;  4WU9 A;  2HIO B;  3AZJ A;  4H9P A;  3AZL B;  2F8N K;  5CPJ C;  5CPJ A;  4ZUX B;  3B0D C;  5AY8 D;  5AV5 D;  3REL A;  5B33 C;  2IO5 B;  3W97 C;  1B6W A;  4YS3 A;  5B2J D;  3AV2 B;  5B2I B;  4J8V A;  5CP6 D;  4J8W D;  3MGR C;  3X1U B;  3AZL D;  1KU5 A;  3AV1 A;  5BNX B;  5B32 A;  3NQJ A;  4KUD D;  4H9R B;  1EQZ A;  1M18 D;  5CPI D;  4R8P C;  3AV2 D;  1TZY C;  5DNM C;  1TZY A;  3UTA C;  5B2I D;  3UTA A;  4Z66 B;  3MVD D;  1BH8 B;  1U35 B;  5AVC C;  5AVB C;  3X1U D;  5AVC A;  3W98 C;  2FJ7 D;  2F8N H;  3MGS C;  4QLC A;  3KSY A;  3LZ1 D;  3UT9 D;  3WAA C;  4WU8 A;  4G92 C;  1P3M D;  1P3G A;  4LD9 D;  1P3A C;  4XUJ B;  5B0Z D;  4J8U C;  4Z5T B;  3X1S C;  5AV9 A;  5B24 D;  1P34 B;  1BH9 A;  5DNN A;  4CAY B;  5F99 C;  3AZJ D;  2ARO C;  2BYM B;  5F99 A;  4J8X B;  2ARO A;  3W96 B;  5AV8 C;  1HQ3 C;  1M19 B;  3WA9 C;  5B31 C;  1B67 A;  3REL D;  3X1T A;  3AZN B;  3B6F C;  5B31 G;  3B6F A;  4YS3 D;  4J8V D;  1F66 B;  3KXB A;  3AFA A;  3O62 A;  1P3I B;  3WTP C;  4JJN C;  4J8X D;  3AZF B;  1S32 A;  2NQB A;  3W96 D;  3LJA B;  4Z2M H;  3REK B;  3AV1 D;  5JA4 B;  5B32 D;  1EQZ D;  3WKJ B;  5G49 A;  5B1M C;  1KX5 B;  3AN2 C;  4EO5 C;  4AWL B;  1P3I D;  1P3K A;  3LEL B;  2YFV B;  5AV6 B;  4QLC D;  3REK D;  3KUY B;  4WU8 D;  1P3F C;  3B6G C;  1P3O B;  1P3F A;  1P3G D;  4KHA B;  3A6N A;  3MGQ C;  3AZK C;  4H9S C;  3C1C A;  3AZK A;  3V9R A;  5B40 C;  5AV9 D;  3AYW A;  1ID3 A;  5DNN D;  2L5A A;  2PYO A;  5GT0 A;  3C1B B;  3B0C W;  1ZLA A;  4X23 A;  5AY8 C;  5AV5 C;  5AY8 A;  3X1T D;  5E5A A;  2F8N G;  5C3I C;  5B2J C;  3LZ0 B;  2YFW B;  1KX4 D;  1A7W A;  1N1J B;  3KXB D;  3AFA D;  3O62 D;  5CP6 C;  4J8W C;  2HIO A;  1S32 D;  3AZL C;  2NQB D;  3AZL A;  5B1L B;  4ZUX A;  4KUD C;  4KGC B;  3MNN B;  4XZQ B;  1M18 C;  5CPI C;  1AOI B;  3AV2 C;  3AV2 A;  5B2I C;  2HUE B;  5B2I A;  3AZM B;  3MVD C;  1P3K D;  3X1U C;  2LY8 A;  3X1U A;  2FJ7 C;  5B1L D;  4DRA A;  3LZ1 C;  1P3B B;  3UT9 C;  1P3P B;  5BNX A;  1P3M C;  4H9R A;  1WWS A;  4XZQ D;  1KX3 B;  3A6N D;  3AZE B;  3X1V B;  1AOI D;  4LD9 C;  3C1C D;  3AZM D;  5B0Z C;  3KWQ B;  5GSU D;  4Z66 A;  3REJ B;  3AZI C;  1BH8 A;  5B24 C;  4Z2M G;  1U35 A;  5B24 A;  3AYW D;  4WU9 C;  1ID3 D;  3AZJ C;  5B0Y B;  2PYO D;  5GT0 D;  1M1A D;  5CPK D;  1ZLA D;  4X23 D;  3REL C;  3REI D;  5E5A D;  4Z5T A;  4DRB A;  4YS3 C;  5GXQ B;  4J8V C;  3UTB B;  4CAY A;  2HIO D;  4J8X C;  2BYM A;  3W96 C;  4J8X A;  2F8N B;  3W96 A;  2NZD B;  4G91 B;  3WTP E;  3AV1 C;  4ZUX D;  1M19 A;  5B32 C;  1EQZ C;  4E44 A;  3AZN A;  1P3L B;  1F66 A;  5GT3 B;  1P3I C;  1P3I A;  3AZF A;  5FUG B;  4HGA B;  3TU4 B;  4QLC C;  3REK C;  3LJA A;  3REK A;  5JA4 A;  4WU8 C;  3WKJ A;  1P3G C;  3MGP B;  1KX5 A;  4Z66 D;  5AV9 C;  1U35 D;  3LEL A;  2YFV A;  5AV6 A;  5DNN C;  3AZH B;  3KUY A;  3W99 B;  4ZBJ B;  4YM6 B;  1P3O A;  4KHA A;  1WWI A;  4XUJ D;  3VH6 T;  3X1T C;  4Z5T D;  1P34 D;  1KX4 C;  1KX4 A;  3KXB C;  3AFA C;  1TAF A;  3O62 C;  2RVQ D;  3W99 D;  2CV5 B;  1S32 C;  2NQB C;  1JFI B;  5B33 B;  3W97 B;  1M19 D;  3AZN D;  3LZ0 A;  2YFW A;  3MGR B;  1N1J A;  5BNV A;  1F66 D;  4NE5 A;  1P3K C;  2CV5 D;  3AZF D;  3NQJ B;  5B1L C;  5B1L A;  3LJA D;  4R8P B;  3WKJ D;  1TZY B;  5DNM B;  4KGC A;  4XZQ C;  3A6N C;  4XZQ A;  1AOI C;  1KX5 D;  1AOI A;  3C1C C;  5AVC B;  5BS7 A;  5AVB B;  3AZM C;  3W98 B;  5GSU C;  3AZM A;  3MGS B;  5GSU A;  1H3O A;  3LEL D;  3WAA B;  3AYW C;  4G92 B;  2CWE A;  5AV6 D;  1ID3 C;  1P3B A;  4WNN B;  3KUY D;  1P3P A;  2PYO C;  1P3A B;  5GT0 C;  1P3O D;  1M1A C;  5CPK C;  1M1A A;  4X23 C;  4J8U B;  3AZE A;  3X1V A;  5CPK A;  4H9N B;  3X1S B;  1KX3 A;  1ZLA C;  3VH5 T;  3REI C;  3KWQ A;  5E5A C;  3REI A;  3REJ A;  5F99 B;  5AV8 B;  5KDM B;  1HQ3 B;  2HIO C;  3WA9 B;  5B0Y A;  5B31 B;  3C1B D;  4ZUX C;  3B6F B;  2IO5 C;  3LZ0 D;  3WTP B;  4JJN B;  5GXQ A;  3UTB A;  2NZD A;  5B1M B;  4KGC D;  3AN2 B;  3MNN D;  4EO5 B;  3B0C T;  1P3L A;  4Z66 C;  1BFM A;  5GT3 A;  1U35 C;  3TU4 A;  1P3B D;  3B6G B;  4H9Q B;  1P3P D;  3MGQ B;  3AZK B;  4M6B A;  1KX3 D;  5B40 B;  3AZE D;  3X1V D;  3MGP A;  4XUJ C;  4XUJ A;  3KWQ D;  3NQU B;  4NFT A;  4Z5T C;  3REJ D;  1P34 C;  1P34 A;  3R45 B;  3AZH A;  2RVQ C;  3W99 C;  4WV4 B;  3W99 A;  4ZBJ C;  5B0Y D;  5BT1 D;  5AY8 B;  5AV5 B;  4YM6 A;  1M19 C;  1R4V A;  5B2J B;  3REH B;  4CSR B;  3AZN C;  3B0B A;  5B32 G;  5CP6 B;  4J8W B;  5GXQ D;  1F66 C;  3UTB D;  2CV5 C;  3AZF C;  2CV5 A;  1JFI A;  2F8N D;  3LJA C;  4KUD B;  2NZD D;  5B33 A;  3W97 A;  1M18 B;  3REH D;  5CPI B;  3WKJ C;  1KX5 C;  3MVD B;  3MGR A;  1P3L D;  2FJ7 B;  4AWL C;  5GT3 D;  5BO0 B;  1ULY A;  3VH6 W;  3LZ1 B;  3UT9 B;  3LEL C;  5AV6 C;  4UUZ B;  5JRG B;  3TU4 D;  1P3M B;  3KUY C;  3AZG B;  4LD9 B;  4R8P A;  1P3O C;  4H9O B;  5DNM A;  5B0Z B;  3MGP D;  3AZI B;  5B24 B;  5AVB A;  3W98 A;  2BYK B;  4WU9 B;  3MGS A;  3AZJ B;  4H9P B;  5JRG D;  3WAA A;  3AZH D;  5CPJ B;  3AZG D;  4WNN A;  1P3A A;  3B0D B;  4YM6 D;  3C1B C;  3REL B;  3C1B A;  1F1E A;  4J8U A;  3AZI D;  4H9N A;  3X1S A;  4NE6 A;  4YS3 B;  4WU9 D;  4J8V B;  3LZ0 C; 
#chains in the Genus database with same CATH topology
 5CPJ D;  5AV8 A;  5KDM A;  3AV1 B;  1HQ3 A;  3WA9 A;  5B32 B;  2G5I C;  5B31 A;  1EQZ B;  5B33 D;  3W97 D;  2XD5 A;  4KGC C;  3MNN C;  4NE3 A;  3MNN A;  3UTA B;  4WZS B;  5BS7 C;  3WTP A;  3MGR D;  4JJN A;  2HUE C;  4QLC B;  3VH5 W;  1HTA A;  3EPJ A;  3IP4 C;  4WU8 B;  2VQR A;  2Y2L A;  1P3B C;  1P3G B;  5B1M A;  1P3P C;  4R8P D;  1TZY D;  5DNM D;  3AN2 A;  3UTA D;  1KX3 C;  3X1V C;  3AZE C;  5AV9 B;  5AVC D;  2Y2H A;  2JSS A;  5AVB D;  3KWQ C;  3VH6 A;  3W98 D;  1BH9 B;  3MGS D;  3REJ C;  5DNN B;  3WAA D;  2ARO B;  3B6G A;  4E45 A;  4H9Q A;  2RIQ A;  5B0Y C;  3MGQ A;  5BT1 C;  1P3A D;  4H9S A;  3X1T B;  5B40 A;  2ZM5 A;  4J8U D;  3X1S D;  1KX4 B;  1TAF B;  3KXB B;  3NQU A;  3O62 B;  3AFA B;  5F99 D;  5GXQ C;  1S32 B;  2NQB B;  2ARO D;  3R45 A;  2ZY2 A;  5CHL B;  3UTB C;  5AV8 D;  1HQ3 D;  3WA9 D;  2NZD C;  5AV5 A;  4G91 C;  5B31 D;  2F8N A;  5G49 B;  3B6F D;  3REH C;  5B2J A;  3REH A;  4CSR A;  5BNV B;  1P3K B;  5CP6 A;  4J8W A;  3WTP D;  2ZY3 A;  4JJN D;  1P3L C;  5GT3 C;  2Y2P A;  4HGA C;  5FUG A;  3TU4 C;  4KUD A;  1P3F B;  5B1M D;  3A6N B;  1M18 A;  5CPI A;  2Y2I A;  3C1C B;  3AN2 D;  3V9R B;  5GSU B;  3MGP C;  3MVD A;  1H3O B;  3VH5 A;  3AYW B;  1ID3 B;  2FJ7 A;  1Q9C A;  5BO0 A;  3LZ1 A;  3UT9 A;  5JRG C;  4UUZ A;  5JRG A;  3AZH C;  5GT0 B;  1P3F D;  1P3M A;  3AZG C;  2PYO B;  3B6G D;  1M1A B;  3AZG A;  5CPK B;  3MGQ D;  4X23 B;  1ZLA B;  4LD9 A;  3AZK D;  4YM6 C;  4H9O A;  3REI B;  5B40 D;  5B0Z A;  5E5A B;  5C3I B;  3P5J B;  3AZI A;  2BYK A;  4WU9 A;  2Y2Q A;  2HIO B;  3AZJ A;  4H9P A;  3AZL B;  2F8N K;  5CPJ C;  5CPJ A;  4ZUX B;  3B0D C;  5AY8 D;  5AV5 D;  3REL A;  5B33 C;  2IO5 B;  3W97 C;  2ZY4 A;  1B6W A;  4YS3 A;  5B2J D;  3AV2 B;  5B2I B;  4J8V A;  5CP6 D;  4J8W D;  3MGR C;  3X1U B;  3AZL D;  1KU5 A;  3AV1 A;  5BNX B;  2Y2N A;  5B32 A;  3NQJ A;  4KUD D;  4H9R B;  1EQZ A;  1M18 D;  5CPI D;  4R8P C;  3AV2 D;  1TZY C;  5DNM C;  1TZY A;  3UTA C;  5B2I D;  3UTA A;  4Z66 B;  3MVD D;  1BH8 B;  1U35 B;  5AVC C;  5AVB C;  3X1U D;  5AVC A;  3W98 C;  2FJ7 D;  2F8N H;  3MGS C;  4QLC A;  3KSY A;  3LZ1 D;  3UT9 D;  3WAA C;  4WU8 A;  4G92 C;  1P3M D;  1P3G A;  4LD9 D;  1P3A C;  4XUJ B;  3KFU G;  5B0Z D;  4J8U C;  4Z5T B;  3X1S C;  5AV9 A;  5B24 D;  1P34 B;  1BH9 A;  5DNN A;  4CAY B;  5F99 C;  3AZJ D;  2ARO C;  2BYM B;  5F99 A;  4J8X B;  2ARO A;  3W96 B;  5AV8 C;  1HQ3 C;  1M19 B;  3WA9 C;  5B31 C;  1B67 A;  3REL D;  3X1T A;  3AZN B;  3B6F C;  5B31 G;  3B6F A;  4YS3 D;  4J8V D;  1F66 B;  3KXB A;  3AFA A;  3O62 A;  1P3I B;  3WTP C;  4JJN C;  4J8X D;  3AZF B;  1S32 A;  2NQB A;  3W96 D;  3LJA B;  4WJ3 C;  4Z2M H;  3REK B;  3AV1 D;  5JA4 B;  5B32 D;  3EPH A;  1EQZ D;  2DF4 C;  3WKJ B;  5G49 A;  5B1M C;  1KX5 B;  3AN2 C;  4EO5 C;  4AWL B;  1P3I D;  1P3K A;  3LEL B;  2YFV B;  5AV6 B;  4QLC D;  3REK D;  3KUY B;  4WU8 D;  2Y2G A;  1P3F C;  3B6G C;  1P3O B;  1P3F A;  1P3G D;  4KHA B;  3A6N A;  3MGQ C;  3AZK C;  4H9S C;  3C1C A;  3AZK A;  3V9R A;  2Y2K A;  5B40 C;  1T3U A;  5AV9 D;  3AYW A;  1ID3 A;  5DNN D;  2L5A A;  2PYO A;  5GT0 A;  3C1B B;  3B0C W;  1ZLA A;  4X23 A;  5AY8 C;  5AV5 C;  2UWX A;  5AY8 A;  3X1T D;  2F2A C;  5E5A A;  2F8N G;  5C3I C;  5B2J C;  3LZ0 B;  2YFW B;  1KX4 D;  1A7W A;  1N1J B;  3KXB D;  3AFA D;  3O62 D;  2G5H C;  5CP6 C;  4J8W C;  1KX3 A;  2HIO A;  1S32 D;  3AZL C;  2NQB D;  3AZL A;  5B1L B;  4ZUX A;  4KUD C;  4KGC B;  3MNN B;  4XZQ B;  1M18 C;  5CPI C;  1AOI B;  3AV2 C;  3AV2 A;  5B2I C;  2HUE B;  5B2I A;  3AZM B;  3MVD C;  1P3K D;  3X1U C;  2LY8 A;  3X1U A;  2FJ7 C;  3A1K A;  5B1L D;  4DRA A;  3LZ1 C;  1P3B B;  3UT9 C;  1P3P B;  5BNX A;  4DQY B;  1P3M C;  4H9R A;  1WWS A;  4XZQ D;  1KX3 B;  3A6N D;  3AZE B;  3X1V B;  1AOI D;  4LD9 C;  3C1C D;  3AZM D;  5B0Z C;  3KWQ B;  5GSU D;  4Z66 A;  3REJ B;  3AZI C;  1BH8 A;  5B24 C;  4Z2M G;  1U35 A;  5B24 A;  3H0L C;  3AYW D;  4WU9 C;  1ID3 D;  3AZJ C;  5B0Y B;  2PYO D;  5GT0 D;  1M1A D;  5CPK D;  1ZLA D;  4X23 D;  3REL C;  3REI D;  5E5A D;  4Z5T A;  4DRB A;  4YS3 C;  5GXQ B;  4J8V C;  3UTB B;  4CAY A;  2HIO D;  4J8X C;  2BYM A;  3W96 C;  4J8X A;  2F8N B;  3W96 A;  2NZD B;  4G91 B;  3WTP E;  3AV1 C;  4ZUX D;  1M19 A;  5B32 C;  1EQZ C;  4E44 A;  3AZN A;  2Y2M A;  1P3L B;  1F66 A;  5GT3 B;  1P3I C;  1P3I A;  3AZF A;  5FUG B;  4HGA B;  3TU4 B;  4QLC C;  3REK C;  3LJA A;  3REK A;  5JA4 A;  4WU8 C;  3WKJ A;  1P3G C;  3MGP B;  1KX5 A;  4Z66 D;  5AV9 C;  1U35 D;  3LEL A;  2YFV A;  5AV6 A;  5DNN C;  3AZH B;  3KUY A;  3W99 B;  4ZBJ B;  4YM6 B;  1P3O A;  4KHA A;  1WWI A;  1W2E A;  4XUJ D;  3VH6 T;  3X1T C;  4Z5T D;  1P34 D;  1KX4 C;  1KX4 A;  3KXB C;  3AFA C;  1TAF A;  3O62 C;  2RVQ D;  3W99 D;  2CV5 B;  1S32 C;  2NQB C;  1JFI B;  2Y2O A;  5B33 B;  3W97 B;  1M19 D;  2ZY5 A;  3AZN D;  3LZ0 A;  2YFW A;  3MGR B;  2J8P A;  1N1J A;  5BNV A;  1F66 D;  3AL0 C;  4NE5 A;  1P3K C;  2CV5 D;  3AZF D;  3NQJ B;  5B1L C;  5B1L A;  3LJA D;  4R8P B;  3WKJ D;  1TZY B;  5DNM B;  4KGC A;  4XZQ C;  3A6N C;  4XZQ A;  1AOI C;  1KX5 D;  1AOI A;  3EPK A;  3C1C C;  5AVC B;  5BS7 A;  5AVB B;  3AZM C;  3W98 B;  5GSU C;  3AZM A;  3MGS B;  5GSU A;  1H3O A;  3LEL D;  3WAA B;  3AYW C;  4G92 B;  2CWE A;  5AV6 D;  1ID3 C;  1P3B A;  4WNN B;  3KUY D;  1P3P A;  2PYO C;  1P3A B;  5GT0 C;  1P3O D;  1M1A C;  5CPK C;  1M1A A;  4X23 C;  4J8U B;  3AZE A;  3X1V A;  5CPK A;  4H9N B;  3X1S B;  1PZR A;  1ZLA C;  3VH5 T;  3REI C;  3KWQ A;  5E5A C;  3REI A;  3REJ A;  5F99 B;  1Z2C B;  5AV8 B;  5KDM B;  1HQ3 B;  2HIO C;  3WA9 B;  5B0Y A;  5B31 B;  3C1B D;  4ZUX C;  3B6F B;  2JCH A;  2IO5 C;  4UPK A;  3LZ0 D;  3WTP B;  4JJN B;  5GXQ A;  2W8S A;  3UTB A;  2NZD A;  5B1M B;  2JE5 A;  4KGC D;  3AN2 B;  3MNN D;  4EO5 B;  3B0C T;  1P3L A;  4Z66 C;  1BFM A;  5GT3 A;  1U35 C;  3TU4 A;  1P3B D;  3B6G B;  2DQN C;  4H9Q B;  1P3P D;  3MGQ B;  3AZK B;  4M6B A;  2BG1 A;  1KX3 D;  5B40 B;  3AZE D;  3X1V D;  3MGP A;  4XUJ C;  4XUJ A;  3KWQ D;  3NQU B;  4NFT A;  4Z5T C;  3REJ D;  1P34 C;  1P34 A;  3R45 B;  2Y2J A;  3AZH A;  2RVQ C;  3W99 C;  4WV4 B;  3W99 A;  4ZBJ C;  5B0Y D;  5BT1 D;  5AY8 B;  5AV5 B;  4YM6 A;  1M19 C;  1R4V A;  5B2J B;  3REH B;  4CSR B;  3AZN C;  3B0B A;  5B32 G;  5CP6 B;  4J8W B;  3H0M C;  5GXQ D;  1F66 C;  3UTB D;  2CV5 C;  3AZF C;  2CV5 A;  1JFI A;  2F8N D;  3LJA C;  4KUD B;  2NZD D;  5B33 A;  3W97 A;  1M18 B;  3REH D;  5CPI B;  3EG5 B;  3WKJ C;  3EPL A;  1KX5 C;  3MVD B;  3MGR A;  1P3L D;  2FJ7 B;  4AWL C;  5GT3 D;  5BO0 B;  3F6T A;  1ULY A;  3VH6 W;  3LZ1 B;  3FDD A;  3UT9 B;  2FFF B;  3LEL C;  2XD1 A;  5AV6 C;  4UUZ B;  5JRG B;  3TU4 D;  1P3M B;  3KUY C;  3AZG B;  4LD9 B;  4R8P A;  1P3O C;  4H9O B;  5DNM A;  5B0Z B;  3MGP D;  3AZI B;  5B24 B;  5AVB A;  3W98 A;  2BYK B;  3A1I A;  4WU9 B;  3MGS A;  3AZJ B;  4H9P B;  5JRG D;  3WAA A;  3AZH D;  5CPJ B;  3AZG D;  4WNN A;  1P3A A;  3B0D B;  4YM6 D;  3C1B C;  3REL B;  3C1B A;  1F1E A;  4J8U A;  3AZI D;  4H9N A;  3X1S A;  4NE6 A;  4YS3 B;  3H0R C;  4WU9 D;  4J8V B;  3LZ0 C; 
#chains in the Genus database with same CATH homology
 5CPJ D;  5AV8 A;  5KDM A;  3AV1 B;  1HQ3 A;  3WA9 A;  5B32 B;  2G5I C;  5B31 A;  1EQZ B;  5B33 D;  3W97 D;  2XD5 A;  4KGC C;  3MNN C;  4NE3 A;  3MNN A;  3UTA B;  4WZS B;  5BS7 C;  3WTP A;  3MGR D;  4JJN A;  2HUE C;  4QLC B;  3VH5 W;  1HTA A;  3EPJ A;  3IP4 C;  4WU8 B;  2VQR A;  2Y2L A;  1P3B C;  1P3G B;  5B1M A;  1P3P C;  4R8P D;  1TZY D;  5DNM D;  3AN2 A;  3UTA D;  1KX3 C;  3X1V C;  3AZE C;  5AV9 B;  5AVC D;  2Y2H A;  2JSS A;  5AVB D;  3KWQ C;  3VH6 A;  3W98 D;  1BH9 B;  3MGS D;  3REJ C;  5DNN B;  3WAA D;  2ARO B;  3B6G A;  4E45 A;  4H9Q A;  2RIQ A;  5B0Y C;  3MGQ A;  5BT1 C;  1P3A D;  4H9S A;  3X1T B;  5B40 A;  2ZM5 A;  4J8U D;  3X1S D;  1KX4 B;  1TAF B;  3KXB B;  3NQU A;  3O62 B;  3AFA B;  5F99 D;  5GXQ C;  1S32 B;  2NQB B;  2ARO D;  3R45 A;  2ZY2 A;  5CHL B;  3UTB C;  5AV8 D;  1HQ3 D;  3WA9 D;  2NZD C;  5AV5 A;  4G91 C;  5B31 D;  2F8N A;  5G49 B;  3B6F D;  3REH C;  5B2J A;  3REH A;  4CSR A;  5BNV B;  1P3K B;  5CP6 A;  4J8W A;  3WTP D;  2ZY3 A;  4JJN D;  1P3L C;  5GT3 C;  2Y2P A;  4HGA C;  5FUG A;  3TU4 C;  4KUD A;  1P3F B;  5B1M D;  3A6N B;  1M18 A;  5CPI A;  2Y2I A;  3C1C B;  3AN2 D;  3V9R B;  5GSU B;  3MGP C;  3MVD A;  1H3O B;  3VH5 A;  3AYW B;  1ID3 B;  2FJ7 A;  1Q9C A;  5BO0 A;  3LZ1 A;  3UT9 A;  5JRG C;  4UUZ A;  5JRG A;  3AZH C;  5GT0 B;  1P3F D;  1P3M A;  3AZG C;  2PYO B;  3B6G D;  1M1A B;  3AZG A;  5CPK B;  3MGQ D;  4X23 B;  1ZLA B;  4LD9 A;  3AZK D;  4YM6 C;  4H9O A;  3REI B;  5B40 D;  5B0Z A;  5E5A B;  5C3I B;  3P5J B;  3AZI A;  2BYK A;  4WU9 A;  2Y2Q A;  2HIO B;  3AZJ A;  4H9P A;  3AZL B;  2F8N K;  5CPJ C;  5CPJ A;  4ZUX B;  3B0D C;  5AY8 D;  5AV5 D;  3REL A;  5B33 C;  2IO5 B;  3W97 C;  2ZY4 A;  1B6W A;  4YS3 A;  5B2J D;  3AV2 B;  5B2I B;  4J8V A;  5CP6 D;  4J8W D;  3MGR C;  3X1U B;  3AZL D;  1KU5 A;  3AV1 A;  5BNX B;  2Y2N A;  5B32 A;  3NQJ A;  4KUD D;  4H9R B;  1EQZ A;  1M18 D;  5CPI D;  4R8P C;  3AV2 D;  1TZY C;  5DNM C;  1TZY A;  3UTA C;  5B2I D;  3UTA A;  4Z66 B;  3MVD D;  1BH8 B;  1U35 B;  5AVC C;  5AVB C;  3X1U D;  5AVC A;  3W98 C;  2FJ7 D;  2F8N H;  3MGS C;  4QLC A;  3KSY A;  3LZ1 D;  3UT9 D;  3WAA C;  4WU8 A;  4G92 C;  1P3M D;  1P3G A;  4LD9 D;  1P3A C;  4XUJ B;  3KFU G;  5B0Z D;  4J8U C;  4Z5T B;  3X1S C;  5AV9 A;  5B24 D;  1P34 B;  1BH9 A;  5DNN A;  4CAY B;  5F99 C;  3AZJ D;  2ARO C;  2BYM B;  5F99 A;  4J8X B;  2ARO A;  3W96 B;  5AV8 C;  1HQ3 C;  1M19 B;  3WA9 C;  5B31 C;  1B67 A;  3REL D;  3X1T A;  3AZN B;  3B6F C;  5B31 G;  3B6F A;  4YS3 D;  4J8V D;  1F66 B;  3KXB A;  3AFA A;  3O62 A;  1P3I B;  3WTP C;  4JJN C;  4J8X D;  3AZF B;  1S32 A;  2NQB A;  3W96 D;  3LJA B;  4WJ3 C;  4Z2M H;  3REK B;  3AV1 D;  5JA4 B;  5B32 D;  3EPH A;  1EQZ D;  2DF4 C;  3WKJ B;  5G49 A;  5B1M C;  1KX5 B;  3AN2 C;  4EO5 C;  4AWL B;  1P3I D;  1P3K A;  3LEL B;  2YFV B;  5AV6 B;  4QLC D;  3REK D;  3KUY B;  4WU8 D;  2Y2G A;  1P3F C;  3B6G C;  1P3O B;  1P3F A;  1P3G D;  4KHA B;  3A6N A;  3MGQ C;  3AZK C;  4H9S C;  3C1C A;  3AZK A;  3V9R A;  2Y2K A;  5B40 C;  1T3U A;  5AV9 D;  3AYW A;  1ID3 A;  5DNN D;  2L5A A;  2PYO A;  5GT0 A;  3C1B B;  3B0C W;  1ZLA A;  4X23 A;  5AY8 C;  5AV5 C;  2UWX A;  5AY8 A;  3X1T D;  2F2A C;  5E5A A;  2F8N G;  5C3I C;  5B2J C;  3LZ0 B;  2YFW B;  1KX4 D;  1A7W A;  1N1J B;  3KXB D;  3AFA D;  3O62 D;  2G5H C;  5CP6 C;  4J8W C;  1KX3 A;  2HIO A;  1S32 D;  3AZL C;  2NQB D;  3AZL A;  5B1L B;  4ZUX A;  4KUD C;  4KGC B;  3MNN B;  4XZQ B;  1M18 C;  5CPI C;  1AOI B;  3AV2 C;  3AV2 A;  5B2I C;  2HUE B;  5B2I A;  3AZM B;  3MVD C;  1P3K D;  3X1U C;  2LY8 A;  3X1U A;  2FJ7 C;  3A1K A;  5B1L D;  4DRA A;  3LZ1 C;  1P3B B;  3UT9 C;  1P3P B;  5BNX A;  4DQY B;  1P3M C;  4H9R A;  1WWS A;  4XZQ D;  1KX3 B;  3A6N D;  3AZE B;  3X1V B;  1AOI D;  4LD9 C;  3C1C D;  3AZM D;  5B0Z C;  3KWQ B;  5GSU D;  4Z66 A;  3REJ B;  3AZI C;  1BH8 A;  5B24 C;  4Z2M G;  1U35 A;  5B24 A;  3H0L C;  3AYW D;  4WU9 C;  1ID3 D;  3AZJ C;  5B0Y B;  2PYO D;  5GT0 D;  1M1A D;  5CPK D;  1ZLA D;  4X23 D;  3REL C;  3REI D;  5E5A D;  4Z5T A;  4DRB A;  4YS3 C;  5GXQ B;  4J8V C;  3UTB B;  4CAY A;  2HIO D;  4J8X C;  2BYM A;  3W96 C;  4J8X A;  2F8N B;  3W96 A;  2NZD B;  4G91 B;  3WTP E;  3AV1 C;  4ZUX D;  1M19 A;  5B32 C;  1EQZ C;  4E44 A;  3AZN A;  2Y2M A;  1P3L B;  1F66 A;  5GT3 B;  1P3I C;  1P3I A;  3AZF A;  5FUG B;  4HGA B;  3TU4 B;  4QLC C;  3REK C;  3LJA A;  3REK A;  5JA4 A;  4WU8 C;  3WKJ A;  1P3G C;  3MGP B;  1KX5 A;  4Z66 D;  5AV9 C;  1U35 D;  3LEL A;  2YFV A;  5AV6 A;  5DNN C;  3AZH B;  3KUY A;  3W99 B;  4ZBJ B;  4YM6 B;  1P3O A;  4KHA A;  1WWI A;  1W2E A;  4XUJ D;  3VH6 T;  3X1T C;  4Z5T D;  1P34 D;  1KX4 C;  1KX4 A;  3KXB C;  3AFA C;  1TAF A;  3O62 C;  2RVQ D;  3W99 D;  2CV5 B;  1S32 C;  2NQB C;  1JFI B;  2Y2O A;  5B33 B;  3W97 B;  1M19 D;  2ZY5 A;  3AZN D;  3LZ0 A;  2YFW A;  3MGR B;  2J8P A;  1N1J A;  5BNV A;  1F66 D;  3AL0 C;  4NE5 A;  1P3K C;  2CV5 D;  3AZF D;  3NQJ B;  5B1L C;  5B1L A;  3LJA D;  4R8P B;  3WKJ D;  1TZY B;  5DNM B;  4KGC A;  4XZQ C;  3A6N C;  4XZQ A;  1AOI C;  1KX5 D;  1AOI A;  3EPK A;  3C1C C;  5AVC B;  5BS7 A;  5AVB B;  3AZM C;  3W98 B;  5GSU C;  3AZM A;  3MGS B;  5GSU A;  1H3O A;  3LEL D;  3WAA B;  3AYW C;  4G92 B;  2CWE A;  5AV6 D;  1ID3 C;  1P3B A;  4WNN B;  3KUY D;  1P3P A;  2PYO C;  1P3A B;  5GT0 C;  1P3O D;  1M1A C;  5CPK C;  1M1A A;  4X23 C;  4J8U B;  3AZE A;  3X1V A;  5CPK A;  4H9N B;  3X1S B;  1PZR A;  1ZLA C;  3VH5 T;  3REI C;  3KWQ A;  5E5A C;  3REI A;  3REJ A;  5F99 B;  1Z2C B;  5AV8 B;  5KDM B;  1HQ3 B;  2HIO C;  3WA9 B;  5B0Y A;  5B31 B;  3C1B D;  4ZUX C;  3B6F B;  2JCH A;  2IO5 C;  4UPK A;  3LZ0 D;  3WTP B;  4JJN B;  5GXQ A;  2W8S A;  3UTB A;  2NZD A;  5B1M B;  2JE5 A;  4KGC D;  3AN2 B;  3MNN D;  4EO5 B;  3B0C T;  1P3L A;  4Z66 C;  1BFM A;  5GT3 A;  1U35 C;  3TU4 A;  1P3B D;  3B6G B;  2DQN C;  4H9Q B;  1P3P D;  3MGQ B;  3AZK B;  4M6B A;  2BG1 A;  1KX3 D;  5B40 B;  3AZE D;  3X1V D;  3MGP A;  4XUJ C;  4XUJ A;  3KWQ D;  3NQU B;  4NFT A;  4Z5T C;  3REJ D;  1P34 C;  1P34 A;  3R45 B;  2Y2J A;  3AZH A;  2RVQ C;  3W99 C;  4WV4 B;  3W99 A;  4ZBJ C;  5B0Y D;  5BT1 D;  5AY8 B;  5AV5 B;  4YM6 A;  1M19 C;  1R4V A;  5B2J B;  3REH B;  4CSR B;  3AZN C;  3B0B A;  5B32 G;  5CP6 B;  4J8W B;  3H0M C;  5GXQ D;  1F66 C;  3UTB D;  2CV5 C;  3AZF C;  2CV5 A;  1JFI A;  2F8N D;  3LJA C;  4KUD B;  2NZD D;  5B33 A;  3W97 A;  1M18 B;  3REH D;  5CPI B;  3EG5 B;  3WKJ C;  3EPL A;  1KX5 C;  3MVD B;  3MGR A;  1P3L D;  2FJ7 B;  4AWL C;  5GT3 D;  5BO0 B;  3F6T A;  1ULY A;  3VH6 W;  3LZ1 B;  3FDD A;  3UT9 B;  2FFF B;  3LEL C;  2XD1 A;  5AV6 C;  4UUZ B;  5JRG B;  3TU4 D;  1P3M B;  3KUY C;  3AZG B;  4LD9 B;  4R8P A;  1P3O C;  4H9O B;  5DNM A;  5B0Z B;  3MGP D;  3AZI B;  5B24 B;  5AVB A;  3W98 A;  2BYK B;  3A1I A;  4WU9 B;  3MGS A;  3AZJ B;  4H9P B;  5JRG D;  3WAA A;  3AZH D;  5CPJ B;  3AZG D;  4WNN A;  1P3A A;  3B0D B;  4YM6 D;  3C1B C;  3REL B;  3C1B A;  1F1E A;  4J8U A;  3AZI D;  4H9N A;  3X1S A;  4NE6 A;  4YS3 B;  3H0R C;  4WU9 D;  4J8V B;  3LZ0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...