5AY8C

Crystal structure of human nucleosome containing h3.y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8C00
5AV6A 1P3ID 3C1CA 3WA9B 4J8VC 1M1AB 5BNVA 1KX3C 5BNXB 3MVDD 1KX4C 3KUYB 4KGCD 4J8UC 1KX5D 4DRBA 4H9RA 5CP6C 4XUJC 3AYWB 1M18A 3W96D 4KHAB 2HUEC 3AZHC 2NZDB 1S32A 4YM6A 2RVQC 3REIC 5B1MB 5AY8C 3VH5W 1F66C 5AV6B 3B6GB 4WU8A 3C1CB 3W97B 1KX5A 3W96A 1HQ3D 5GT3D 3B0CW 4H9RB 1M18B 1P3KA 5B31C 1P3FA 1ID3D 3MGRD 3W98A 3X1TC 5B32C 3V9RB 1F1EA 1P34A 5B2JA 3A6NA 3AV1D 5GSUA 1BH9A 5CPJD 4WU8B 3AZMD 1P3PC 4J8XD 2CWEA 4QLCA 5B31G 4H9NA 5B32G 5BS7C 3X1SD 3R45A 3AZEC 1ID3A 3NQUA 3LZ1A 4Z66C 4G91B 4WZSB 1P3KB 2IO5C 4J8WC 1P3FB 3W98B 3WAAA 1TZYD 3B6FC 3AZFD 3MGPD 3VH5T 5DNNB 1P34B 3A6NB 3AZJA 4AWLB 5AVBD 5GSUB 5B33D 4R8PA 3TU4C 3REHA 5B2IB 5E5AD 4QLCB 3UTBD 4H9NB 5AVCC 5CPKD 1A7WA 1P3IC 4CAYA 1P3OD 5B0ZD 3R45B 4CSRA 3MVDC 3LZ1B 5G49A 3WAAB 5CPIA 2F8NG 3LELD 4ZBJC 1U35D 1B6WA 5AVBA 3KXBC 1WWIA 3AZJB 3LZ0C 5B33A 1EQZA 5BT1D 4R8PB 1AOIC 3REHB 2FJ7B 4NE5A 4WU9A 5JA4A 5CPKA 2LY8A 2BYKA 3X1UD 3W99A 1KX3D 4WNNB 3AV2A 1HQ3C 4CSRB 5CP6D 4XUJD 5AV5C 5KDMA 4G92B 5CPIB 3AZHD 5F99D 4M6BA 2RVQD 3REID 3AV1C 1F66D 5JA4B 4J8VA 5CPJC 3UT9D 1P3AD 1KX4A 4J8UA 3W99B 3AZKB 3AV2B 3X1SC 2NQBD 5B31D 5KDMB 5JRGC 5B32D 1B67A 1TZYC 5C3IB 4Z5TC 4JJNC 3AZFC 3MGPC 5AY8A 1F66A 1P3MA 5DNMB 3X1VD 3RELC 3KWQB 1P3PD 2BYMA 4J8VB 3MGQD 1KX4B 5E5AC 3AZGB 1P3GC 1P3OC 3AFAA 5B31A 3X1TA 4Z66D 1BFMA 4J8WD 1M19C 2PYOC 3MNNA 1M1AD 3B6FD 3LELC 3MGSC 5B40C 1U35C 5B24A 4H9SC 3REJA 2F8ND 2CV5A 1P3MB 1P3PA 3TU4D 5B1LC 3NQJB 2HIOC 5AVCD 3AZEA 3X1UC 3WTPB 3AFAB 4NE6A 4J8WA 2AROC 1ZLAC 3MNNB 3WTPE 4LD9B 3AZND 5F99C 3KXBD 5GT0A 5B24B 3LZ0D 3TU4A 3REKC 4YS3C 3REJB 2CV5B 4ZUXC 1AOID 4H9OB 4XZQD 4HGAC 1P3IA 3C1BD 4KUDD 3MVDA 3UT9C 3AZEB 1P3AC 4KGCA 5BNVB 3WKJC 5AV5D 2NQBC 1BH8A 5GXQC 3KXBA 1S32B 5GT0B 4YM6B 1H3OA 5AV9D 5AV8C 3X1VC 5DNND 5B0YC 1P3BD 1KU5A 3MGQC 1HQ3A 3MVDB 1JFIA 5GT3A 4KGCB 1KX5B 3LJAC 3W96B 3MGRA 5JRGD 1BH8B 3WA9C 4NE3A 4Z5TD 4EO5C 4JJND 1M1AC 3AV1A 5B2JB 1H3OB 3AYWC 3AZMA 3RELD 5CPJA 4J8XA 2NZDC 3AN2D 1BH9B 1HQ3B 1P3GD 5GT3B 3VH6T 4E44A 3X1SA 5B1MC 4WV4B 3O62D 2FJ7D 1ID3B 5AV6C 3MGRB 3NQUB 1HTAA 1TZYA 1M19D 4Z5TA 2PYOD 4JJNA 3C1CC 3AZFA 3MGPA 3W97C 5B40D 3MGSD 3AV1B 3AZNC 3AZMB 5CPJB 5B1LD 1TAFA 5E5AA 2JSSA 4XZQC 4J8XB 3UTBA 1P3OA 3C1BC 2HIOD 5B0ZA 3AZID 3X1SB 4KUDC 1R4VA 4CAYB 1M19A 4H9QA 2PYOA 2YFWA 2AROD 1ZLAD 1TZYB 3LELA 5B40A 3MGSA 5G49B 3MGPB 5CHLB 3AZFB 1U35A 5AVBB 3REKD 4YS3D 4H9PA 4G91C 5B1LA 5B33B 4ZUXD 1EQZB 5AV9C 1TAFB 5E5AB 4X23D 3UTBB 3X1UA 5DNNC 4WU9B 5CPKB 1P34C 3A6NC 1P3BC 2YFVA 2BYKB 1KX3A 5B0ZB 1P3LD 4AWLC 5GSUC 2AROA 4XUJA 5CP6A 4H9QB 3B0DB 5B2IC 3WKJD 3UTAD 3AZHA 3LELB 4QLCC 5F99A 5GXQD 3AZLD 3REIA 3REKA 4UUZA 3B0BA 4H9PB 3WAAC 5AV8D 5B0YD 3UT9A 1P3AA 3AN2C 3AZJC 2F8NH 1KX3B 1Q9CA 4J8UB 3WKJA 3LJAD 3VH6A 5CP6B 4XUJB 2NQBA 4R8PC 3O62C 2FJ7C 5GXQA 5FUGA 2HUEB 5B32A 3AZHB 4DRAA 3WA9D 3REIB 3KUYD 5AY8B 3AYWD 3X1VA 1F66B 4G92C 5CPIC 4LD9D 3MGQA 2NZDD 3UT9B 2BYMB 5BS7A 3AZIC 5B1MD 2NQBB 4Z66A 5B31B 5AV6D 3B6GD 3X1TB 5B32B 1M1AA 3C1CD 3B6FA 3W97D 3W99C 3AZKC 2F8NA 1M18D 1P3PB 3MGQB 5C3IC 5AVCA 4X23C 5B1MA 1P3LC 4Z66B 5DNMC 2IO5B 4J8WB 3KWQC 4WU8D 3W97A 4EO5B 3UTAC 3VH6W 3B6FB 3AZGC 3AZNA 3AZLC 3LZ0A 2F8NB 1AOIA 3TU4B 3V9RA 4XZQA 1P3KD 1P3FD 3W98D 2L5AA 3C1BA 1P34D 5AVCB 1P3IB 4KUDA 5B2JD 3A6ND 5GSUD 1P3MC 5AV5A 5B2ID 4ZBJB 4QLCD 2F8NK 3AZNB 3KXBB 3WTPC 3LZ0B 3AFAC 3KUYC 3LZ1D 1AOIB 5AV9A 4XZQB 1P3BA 5DNNA 3WAAD 3MNNC 3C1BB 4LD9C 4KUDB 3AZJD 5B24C 5B2IA 3REJC 1JFIB 2CV5C 4R8PD 5AV5B 3REHD 5JRGA 3B6GC 3KSYA 5AV9B 3RELA 1M18C 1P3BB 5CPID 1ULYA 3AN2A 1S32C 1P3GA 5GT0C 4YM6C 1EQZD 3O62A 2FJ7A 3B0CT 5JRGB 4WU9D 4WU8C 4WNNA 4Z5TB 4JJNB 3W99D 4KGCC 4H9SA 1KX5C 3AZKD 3AV2D 3W96C 3RELB 1P3KC 1P3FC 3AN2B 3W98C 2HIOA 3AZIA 1P3GB 1P3OB 5B2JC 4NFTA 3O62B 5DNMD 4E45A 1ZLAA 1M19B 3KWQD 2PYOB 2YFWB 4J8VD 4Z2MG 1KX4D 3AZKA 5B40B 3MGSB 4J8UD 3AZGD 1U35B 5GT3C 4YS3A 4ZUXA 1ID3C 3MGRC 3LZ1C 5B1LB 4X23A 2HIOB 3AZIB 3X1UB 5AY8D 5BO0A 1P3LA 5DNMA 2YFVB 3KWQA 1P3MD 3AZMC 2AROB 3UTAA 1ZLAB 4J8XC 3REHC 3AZGA 3AZLA 5F99B 3WTPD 3AFAD 3REKB 4UUZB 4YS3B 1N1JA 4ZUXB 3X1TD 5AV8A 4HGAB 5B0YA 3MNND 4X23B 3VH5A 1P3AB 5BO0B 5B24D 1P3LB 5AVBC 3LJAA 3REJD 5B33C 2CV5D 1EQZC 3WKJB 3NQJA 3UTAB 3UTBC 3WA9A 5GXQB 5FUGB 3WTPA 3AZLB 4WU9C 5CPKC 5BNXA 5B0ZC 3AZED 3KUYA 1WWSA 3AYWA 3AV2C 1N1JB 3B0DC 4KHAA 5AV8B 4LD9A 3X1VB 5B0YB 2NZDA 4Z2MH 1S32D 5GT0D 4YM6D 4H9OA 3LJAB 5BT1C 3B6GA
chains in the Genus database with same CATH superfamily
5AV6A 2FFFB 2DQNC 1P3ID 3C1CA 3WA9B 4J8VC 1M1AB 5BNVA 1KX3C 5BNXB 3MVDD 1KX4C 3KUYB 4KGCD 1PZRA 3A1IA 4J8UC 4DRBA 4H9RA 5CP6C 4XUJC 3AYWB 1M18A 1KX5D 3W96D 4KHAB 3AL0C 2HUEC 3AZHC 2NZDB 1S32A 4YM6A 2RVQC 3REIC 5B1MB 5AY8C 3H0LC 3VH5W 1F66C 5AV6B 3B6GB 4WU8A 2Y2NA 3C1CB 3W97B 1KX5A 3W96A 1HQ3D 5GT3D 3B0CW 4H9RB 1M18B 1P3KA 5B31C 1P3FA 1ID3D 3MGRD 3W98A 3X1TC 5B32C 2Y2LA 3V9RB 1F1EA 1P34A 5B2JA 3A6NA 2Y2QA 3AV1D 5GSUA 1Z2CB 1BH9A 5CPJD 4WU8B 3AZMD 1P3PC 4J8XD 2CWEA 4QLCA 5B31G 4H9NA 5B32G 5BS7C 3X1SD 3R45A 3AZEC 1ID3A 3NQUA 2BG1A 4Z66C 4G91B 4WZSB 3LZ1A 2IO5C 4J8WC 1P3KB 1P3FB 3W98B 3WAAA 1TZYD 3B6FC 3AZFD 3MGPD 3VH5T 5DNNB 1P34B 3A6NB 3AZJA 4AWLB 5AVBD 5GSUB 5B33D 4R8PA 3TU4C 3REHA 5B2IB 1T3UA 5E5AD 4QLCB 3UTBD 4H9NB 5AVCC 5CPKD 1A7WA 4DQYB 4CAYA 1P3IC 1P3OD 5B0ZD 3R45B 4CSRA 3MVDC 3LZ1B 5G49A 3WAAB 5CPIA 2F8NG 3LELD 4ZBJC 1U35D 1B6WA 5AVBA 3KXBC 1WWIA 3AZJB 3LZ0C 5B33A 1EQZA 5BT1D 4R8PB 1AOIC 3REHB 2FJ7B 4NE5A 4WU9A 5JA4A 5CPKA 2LY8A 2BYKA 3X1UD 1W2EA 3W99A 1KX3D 4WNNB 3AV2A 1HQ3C 4CSRB 5CP6D 4XUJD 5AV5C 5KDMA 4G92B 5CPIB 3AZHD 5F99D 4M6BA 2RVQD 3REID 3AV1C 2Y2OA 1F66D 5JA4B 4J8VA 5CPJC 3UT9D 1P3AD 1KX4A 4J8UA 3W99B 3AZKB 3AV2B 3X1SC 2NQBD 5B31D 5KDMB 5JRGC 5B32D 1B67A 4WJ3C 1TZYC 5C3IB 4Z5TC 4JJNC 3AZFC 3MGPC 5AY8A 1F66A 1P3MA 5DNMB 3X1VD 3RELC 3KWQB 1P3PD 2BYMA 4J8VB 3MGQD 3KFUG 1KX4B 5E5AC 3AZGB 1P3GC 1P3OC 3AFAA 5B31A 3X1TA 4Z66D 1BFMA 4J8WD 1M19C 2PYOC 3MNNA 3EPHA 1M1AD 3B6FD 3LELC 3H0RC 3MGSC 5B40C 1U35C 5B24A 4H9SC 3REJA 2F8ND 2UWXA 2CV5A 1P3MB 1P3PA 3TU4D 5B1LC 3NQJB 2HIOC 5AVCD 3AZEA 3X1UC 3WTPB 3AFAB 4NE6A 4J8WA 2AROC 1ZLAC 3MNNB 3WTPE 4LD9B 3AZND 5F99C 3F6TA 5GT0A 5B24B 3KXBD 3LZ0D 3TU4A 3REKC 4YS3C 3REJB 2CV5B 4ZUXC 1AOID 4H9OB 4XZQD 4HGAC 1P3IA 3C1BD 4KUDD 3MVDA 3UT9C 3AZEB 1P3AC 4KGCA 5BNVB 3WKJC 5AV5D 2NQBC 1BH8A 5GXQC 3KXBA 2XD5A 1S32B 5GT0B 4YM6B 2Y2MA 1H3OA 2W8SA 5AV9D 2Y2HA 5AV8C 3X1VC 5DNND 5B0YC 1P3BD 1KU5A 3MGQC 1HQ3A 3MVDB 1JFIA 5GT3A 4KGCB 2Y2PA 1KX5B 3LJAC 3W96B 3MGRA 2ZY3A 5JRGD 1BH8B 3WA9C 4NE3A 4Z5TD 4EO5C 4JJND 1M1AC 3AV1A 5B2JB 1H3OB 3AYWC 3AZMA 3RELD 5CPJA 4J8XA 2NZDC 3AN2D 1BH9B 1HQ3B 1P3GD 5GT3B 3X1SA 3VH6T 4E44A 5B1MC 4WV4B 3O62D 2FJ7D 1ID3B 5AV6C 3MGRB 3NQUB 1HTAA 1TZYA 1M19D 4Z5TA 2PYOD 4JJNA 3C1CC 3AZFA 3MGPA 3A1KA 3W97C 5B40D 3MGSD 3AV1B 3FDDA 3AZNC 3EG5B 3AZMB 5CPJB 5B1LD 1TAFA 5E5AA 2JSSA 4XZQC 3EPJA 4J8XB 3UTBA 1P3OA 3C1BC 2HIOD 5B0ZA 3AZID 3X1SB 4KUDC 1R4VA 4CAYB 1M19A 4H9QA 2PYOA 2YFWA 2AROD 1ZLAD 1TZYB 3LELA 5B40A 3MGSA 5G49B 3MGPB 5CHLB 3AZFB 1U35A 2RIQA 5AVBB 3REKD 4YS3D 4H9PA 4G91C 5B1LA 5B33B 4ZUXD 1EQZB 5AV9C 1TAFB 5E5AB 4X23D 3UTBB 3X1UA 5DNNC 4WU9B 5CPKB 1P34C 3A6NC 1P3BC 2YFVA 2BYKB 1KX3A 5B0ZB 1P3LD 4AWLC 5GSUC 2AROA 4XUJA 5CP6A 4H9QB 2ZY5A 3B0DB 5B2IC 3WKJD 2ZY2A 3UTAD 3AZHA 3LELB 4QLCC 5F99A 5GXQD 3AZLD 3REIA 3REKA 4UUZA 3B0BA 4H9PB 3WAAC 5AV8D 5B0YD 3UT9A 1P3AA 2ZY4A 3AN2C 3AZJC 2F8NH 1KX3B 1Q9CA 4J8UB 3WKJA 3LJAD 3VH6A 5CP6B 4XUJB 2NQBA 4R8PC 3O62C 2FJ7C 5GXQA 5FUGA 2HUEB 5B32A 3AZHB 3EPLA 4DRAA 3WA9D 3REIB 3KUYD 5AY8B 3AYWD 3X1VA 1F66B 4G92C 5CPIC 4LD9D 3MGQA 2NZDD 3UT9B 2BYMB 5BS7A 3AZIC 5B1MD 2NQBB 4Z66A 5B31B 5AV6D 3B6GD 3X1TB 5B32B 1M1AA 3C1CD 3B6FA 3W97D 2Y2JA 3W99C 3H0MC 3AZKC 2F8NA 1M18D 1P3PB 3MGQB 5C3IC 5AVCA 4X23C 5B1MA 4UPKA 1P3LC 4Z66B 5DNMC 2IO5B 4J8WB 3KWQC 4WU8D 2XD1A 3W97A 4EO5B 3UTAC 3VH6W 3B6FB 2G5IC 3AZGC 3AZNA 3AZLC 3LZ0A 2F8NB 2Y2IA 1AOIA 3TU4B 3V9RA 4XZQA 1P3KD 1P3FD 3W98D 2L5AA 3C1BA 1P34D 5AVCB 1P3IB 4KUDA 5B2JD 3A6ND 5GSUD 1P3MC 5AV5A 5B2ID 4ZBJB 2G5HC 4QLCD 2F8NK 3AZNB 3KXBB 3WTPC 3LZ0B 3AFAC 2VQRA 3KUYC 2JE5A 3LZ1D 1AOIB 5AV9A 3EPKA 4XZQB 1P3BA 5DNNA 3WAAD 3MNNC 3C1BB 2ZM5A 4LD9C 4KUDB 3AZJD 5B24C 5B2IA 3REJC 1JFIB 2CV5C 4R8PD 5AV5B 3REHD 5JRGA 3B6GC 3KSYA 5AV9B 3RELA 1M18C 1P3BB 5CPID 1ULYA 3AN2A 3P5JB 1S32C 1P3GA 5GT0C 4YM6C 1EQZD 3O62A 2FJ7A 3B0CT 5JRGB 4WU9D 4WU8C 4WNNA 4Z5TB 4JJNB 3W99D 4KGCC 4H9SA 1KX5C 3AZKD 3AV2D 3W96C 3RELB 1P3KC 1P3FC 3AN2B 3W98C 2HIOA 3AZIA 1P3GB 1P3OB 5B2JC 4NFTA 3O62B 5DNMD 4E45A 1ZLAA 1M19B 3KWQD 2PYOB 2YFWB 4J8VD 4Z2MG 1KX4D 3AZKA 5B40B 3MGSB 4J8UD 3AZGD 1U35B 5GT3C 4YS3A 4ZUXA 1ID3C 3MGRC 3LZ1C 5B1LB 4X23A 2HIOB 3AZIB 3X1UB 5AY8D 5BO0A 1P3LA 5DNMA 2J8PA 2YFVB 3KWQA 1P3MD 2F2AC 3AZMC 2AROB 3UTAA 1ZLAB 2Y2GA 4J8XC 3REHC 3AZGA 3AZLA 3IP4C 5F99B 3WTPD 3AFAD 3REKB 4UUZB 4YS3B 2DF4C 1N1JA 4ZUXB 3X1TD 5AV8A 4HGAB 5B0YA 3MNND 4X23B 3VH5A 1P3AB 5BO0B 5B24D 1P3LB 5AVBC 3LJAA 3REJD 5B33C 2CV5D 1EQZC 3WKJB 3NQJA 3UTAB 2Y2KA 3UTBC 3WA9A 5GXQB 5FUGB 3WTPA 3AZLB 4WU9C 5CPKC 5BNXA 5B0ZC 3AZED 3KUYA 1WWSA 3AYWA 2JCHA 1N1JB 3B0DC 3AV2C 4KHAA 5AV8B 4LD9A 3X1VB 5B0YB 2NZDA 4Z2MH 1S32D 5GT0D 4YM6D 4H9OA 3LJAB 5BT1C 3B6GA
chains in the Genus database with same CATH topology
5AV6A 2FFFB 2DQNC 1P3ID 3C1CA 3WA9B 4J8VC 1M1AB 5BNVA 1KX3C 5BNXB 3MVDD 1KX4C 3KUYB 4KGCD 1PZRA 3A1IA 4J8UC 4DRBA 4H9RA 5CP6C 4XUJC 3AYWB 1M18A 1KX5D 3W96D 4KHAB 3AL0C 2HUEC 3AZHC 2NZDB 1S32A 4YM6A 2RVQC 3REIC 5B1MB 5AY8C 3H0LC 3VH5W 1F66C 5AV6B 3B6GB 4WU8A 2Y2NA 3C1CB 3W97B 1KX5A 3W96A 1HQ3D 5GT3D 3B0CW 4H9RB 1M18B 1P3KA 5B31C 1P3FA 1ID3D 3MGRD 3W98A 3X1TC 5B32C 2Y2LA 3V9RB 1F1EA 1P34A 5B2JA 3A6NA 2Y2QA 3AV1D 5GSUA 1Z2CB 1BH9A 5CPJD 4WU8B 3AZMD 1P3PC 4J8XD 2CWEA 4QLCA 5B31G 4H9NA 5B32G 5BS7C 3X1SD 3R45A 3AZEC 1ID3A 3NQUA 2BG1A 4Z66C 4G91B 4WZSB 3LZ1A 2IO5C 4J8WC 1P3KB 1P3FB 3W98B 3WAAA 1TZYD 3B6FC 3AZFD 3MGPD 3VH5T 5DNNB 1P34B 3A6NB 3AZJA 4AWLB 5AVBD 5GSUB 5B33D 4R8PA 3TU4C 3REHA 5B2IB 1T3UA 5E5AD 4QLCB 3UTBD 4H9NB 5AVCC 5CPKD 1A7WA 4DQYB 4CAYA 1P3IC 1P3OD 5B0ZD 3R45B 4CSRA 3MVDC 3LZ1B 5G49A 3WAAB 5CPIA 2F8NG 3LELD 4ZBJC 1U35D 1B6WA 5AVBA 3KXBC 1WWIA 3AZJB 3LZ0C 5B33A 1EQZA 5BT1D 4R8PB 1AOIC 3REHB 2FJ7B 4NE5A 4WU9A 5JA4A 5CPKA 2LY8A 2BYKA 3X1UD 1W2EA 3W99A 1KX3D 4WNNB 3AV2A 1HQ3C 4CSRB 5CP6D 4XUJD 5AV5C 5KDMA 4G92B 5CPIB 3AZHD 5F99D 4M6BA 2RVQD 3REID 3AV1C 2Y2OA 1F66D 5JA4B 4J8VA 5CPJC 3UT9D 1P3AD 1KX4A 4J8UA 3W99B 3AZKB 3AV2B 3X1SC 2NQBD 5B31D 5KDMB 5JRGC 5B32D 1B67A 4WJ3C 1TZYC 5C3IB 4Z5TC 4JJNC 3AZFC 3MGPC 5AY8A 1F66A 1P3MA 5DNMB 3X1VD 3RELC 3KWQB 1P3PD 2BYMA 4J8VB 3MGQD 3KFUG 1KX4B 5E5AC 3AZGB 1P3GC 1P3OC 3AFAA 5B31A 3X1TA 4Z66D 1BFMA 4J8WD 1M19C 2PYOC 3MNNA 3EPHA 1M1AD 3B6FD 3LELC 3H0RC 3MGSC 5B40C 1U35C 5B24A 4H9SC 3REJA 2F8ND 2UWXA 2CV5A 1P3MB 1P3PA 3TU4D 5B1LC 3NQJB 2HIOC 5AVCD 3AZEA 3X1UC 3WTPB 3AFAB 4NE6A 4J8WA 2AROC 1ZLAC 3MNNB 3WTPE 4LD9B 3AZND 5F99C 3F6TA 5GT0A 5B24B 3KXBD 3LZ0D 3TU4A 3REKC 4YS3C 3REJB 2CV5B 4ZUXC 1AOID 4H9OB 4XZQD 4HGAC 1P3IA 3C1BD 4KUDD 3MVDA 3UT9C 3AZEB 1P3AC 4KGCA 5BNVB 3WKJC 5AV5D 2NQBC 1BH8A 5GXQC 3KXBA 2XD5A 1S32B 5GT0B 4YM6B 2Y2MA 1H3OA 2W8SA 5AV9D 2Y2HA 5AV8C 3X1VC 5DNND 5B0YC 1P3BD 1KU5A 3MGQC 1HQ3A 3MVDB 1JFIA 5GT3A 4KGCB 2Y2PA 1KX5B 3LJAC 3W96B 3MGRA 2ZY3A 5JRGD 1BH8B 3WA9C 4NE3A 4Z5TD 4EO5C 4JJND 1M1AC 3AV1A 5B2JB 1H3OB 3AYWC 3AZMA 3RELD 5CPJA 4J8XA 2NZDC 3AN2D 1BH9B 1HQ3B 1P3GD 5GT3B 3X1SA 3VH6T 4E44A 5B1MC 4WV4B 3O62D 2FJ7D 1ID3B 5AV6C 3MGRB 3NQUB 1HTAA 1TZYA 1M19D 4Z5TA 2PYOD 4JJNA 3C1CC 3AZFA 3MGPA 3A1KA 3W97C 5B40D 3MGSD 3AV1B 3FDDA 3AZNC 3EG5B 3AZMB 5CPJB 5B1LD 1TAFA 5E5AA 2JSSA 4XZQC 3EPJA 4J8XB 3UTBA 1P3OA 3C1BC 2HIOD 5B0ZA 3AZID 3X1SB 4KUDC 1R4VA 4CAYB 1M19A 4H9QA 2PYOA 2YFWA 2AROD 1ZLAD 1TZYB 3LELA 5B40A 3MGSA 5G49B 3MGPB 5CHLB 3AZFB 1U35A 2RIQA 5AVBB 3REKD 4YS3D 4H9PA 4G91C 5B1LA 5B33B 4ZUXD 1EQZB 5AV9C 1TAFB 5E5AB 4X23D 3UTBB 3X1UA 5DNNC 4WU9B 5CPKB 1P34C 3A6NC 1P3BC 2YFVA 2BYKB 1KX3A 5B0ZB 1P3LD 4AWLC 5GSUC 2AROA 4XUJA 5CP6A 4H9QB 2ZY5A 3B0DB 5B2IC 3WKJD 2ZY2A 3UTAD 3AZHA 3LELB 4QLCC 5F99A 5GXQD 3AZLD 3REIA 3REKA 4UUZA 3B0BA 4H9PB 3WAAC 5AV8D 5B0YD 3UT9A 1P3AA 2ZY4A 3AN2C 3AZJC 2F8NH 1KX3B 1Q9CA 4J8UB 3WKJA 3LJAD 3VH6A 5CP6B 4XUJB 2NQBA 4R8PC 3O62C 2FJ7C 5GXQA 5FUGA 2HUEB 5B32A 3AZHB 3EPLA 4DRAA 3WA9D 3REIB 3KUYD 5AY8B 3AYWD 3X1VA 1F66B 4G92C 5CPIC 4LD9D 3MGQA 2NZDD 3UT9B 2BYMB 5BS7A 3AZIC 5B1MD 2NQBB 4Z66A 5B31B 5AV6D 3B6GD 3X1TB 5B32B 1M1AA 3C1CD 3B6FA 3W97D 2Y2JA 3W99C 3H0MC 3AZKC 2F8NA 1M18D 1P3PB 3MGQB 5C3IC 5AVCA 4X23C 5B1MA 4UPKA 1P3LC 4Z66B 5DNMC 2IO5B 4J8WB 3KWQC 4WU8D 2XD1A 3W97A 4EO5B 3UTAC 3VH6W 3B6FB 2G5IC 3AZGC 3AZNA 3AZLC 3LZ0A 2F8NB 2Y2IA 1AOIA 3TU4B 3V9RA 4XZQA 1P3KD 1P3FD 3W98D 2L5AA 3C1BA 1P34D 5AVCB 1P3IB 4KUDA 5B2JD 3A6ND 5GSUD 1P3MC 5AV5A 5B2ID 4ZBJB 2G5HC 4QLCD 2F8NK 3AZNB 3KXBB 3WTPC 3LZ0B 3AFAC 2VQRA 3KUYC 2JE5A 3LZ1D 1AOIB 5AV9A 3EPKA 4XZQB 1P3BA 5DNNA 3WAAD 3MNNC 3C1BB 2ZM5A 4LD9C 4KUDB 3AZJD 5B24C 5B2IA 3REJC 1JFIB 2CV5C 4R8PD 5AV5B 3REHD 5JRGA 3B6GC 3KSYA 5AV9B 3RELA 1M18C 1P3BB 5CPID 1ULYA 3AN2A 3P5JB 1S32C 1P3GA 5GT0C 4YM6C 1EQZD 3O62A 2FJ7A 3B0CT 5JRGB 4WU9D 4WU8C 4WNNA 4Z5TB 4JJNB 3W99D 4KGCC 4H9SA 1KX5C 3AZKD 3AV2D 3W96C 3RELB 1P3KC 1P3FC 3AN2B 3W98C 2HIOA 3AZIA 1P3GB 1P3OB 5B2JC 4NFTA 3O62B 5DNMD 4E45A 1ZLAA 1M19B 3KWQD 2PYOB 2YFWB 4J8VD 4Z2MG 1KX4D 3AZKA 5B40B 3MGSB 4J8UD 3AZGD 1U35B 5GT3C 4YS3A 4ZUXA 1ID3C 3MGRC 3LZ1C 5B1LB 4X23A 2HIOB 3AZIB 3X1UB 5AY8D 5BO0A 1P3LA 5DNMA 2J8PA 2YFVB 3KWQA 1P3MD 2F2AC 3AZMC 2AROB 3UTAA 1ZLAB 2Y2GA 4J8XC 3REHC 3AZGA 3AZLA 3IP4C 5F99B 3WTPD 3AFAD 3REKB 4UUZB 4YS3B 2DF4C 1N1JA 4ZUXB 3X1TD 5AV8A 4HGAB 5B0YA 3MNND 4X23B 3VH5A 1P3AB 5BO0B 5B24D 1P3LB 5AVBC 3LJAA 3REJD 5B33C 2CV5D 1EQZC 3WKJB 3NQJA 3UTAB 2Y2KA 3UTBC 3WA9A 5GXQB 5FUGB 3WTPA 3AZLB 4WU9C 5CPKC 5BNXA 5B0ZC 3AZED 3KUYA 1WWSA 3AYWA 2JCHA 1N1JB 3B0DC 3AV2C 4KHAA 5AV8B 4LD9A 3X1VB 5B0YB 2NZDA 4Z2MH 1S32D 5GT0D 4YM6D 4H9OA 3LJAB 5BT1C 3B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 A;  1P3I D;  3C1C A;  3WA9 B;  4J8V C;  1M1A B;  5BNV A;  1KX3 C;  5BNX B;  3MVD D;  1KX4 C;  3KUY B;  4KGC D;  4J8U C;  1KX5 D;  4DRB A;  4H9R A;  5CP6 C;  4XUJ C;  3AYW B;  1M18 A;  3W96 D;  4KHA B;  2HUE C;  3AZH C;  2NZD B;  1S32 A;  4YM6 A;  2RVQ C;  3REI C;  5B1M B;  5AY8 C;  3VH5 W;  1F66 C;  5AV6 B;  3B6G B;  4WU8 A;  3C1C B;  3W97 B;  1KX5 A;  3W96 A;  1HQ3 D;  5GT3 D;  3B0C W;  4H9R B;  1M18 B;  1P3K A;  5B31 C;  1P3F A;  1ID3 D;  3MGR D;  3W98 A;  3X1T C;  5B32 C;  3V9R B;  1F1E A;  1P34 A;  5B2J A;  3A6N A;  3AV1 D;  5GSU A;  1BH9 A;  5CPJ D;  4WU8 B;  3AZM D;  1P3P C;  4J8X D;  2CWE A;  4QLC A;  5B31 G;  4H9N A;  5B32 G;  5BS7 C;  3X1S D;  3R45 A;  3AZE C;  1ID3 A;  3NQU A;  3LZ1 A;  4Z66 C;  4G91 B;  4WZS B;  1P3K B;  2IO5 C;  4J8W C;  1P3F B;  3W98 B;  3WAA A;  1TZY D;  3B6F C;  3AZF D;  3MGP D;  3VH5 T;  5DNN B;  1P34 B;  3A6N B;  3AZJ A;  4AWL B;  5AVB D;  5GSU B;  5B33 D;  4R8P A;  3TU4 C;  3REH A;  5B2I B;  5E5A D;  4QLC B;  3UTB D;  4H9N B;  5AVC C;  5CPK D;  1A7W A;  1P3I C;  4CAY A;  1P3O D;  5B0Z D;  3R45 B;  4CSR A;  3MVD C;  3LZ1 B;  5G49 A;  3WAA B;  5CPI A;  2F8N G;  3LEL D;  4ZBJ C;  1U35 D;  1B6W A;  5AVB A;  3KXB C;  1WWI A;  3AZJ B;  3LZ0 C;  5B33 A;  1EQZ A;  5BT1 D;  4R8P B;  1AOI C;  3REH B;  2FJ7 B;  4NE5 A;  4WU9 A;  5JA4 A;  5CPK A;  2LY8 A;  2BYK A;  3X1U D;  3W99 A;  1KX3 D;  4WNN B;  3AV2 A;  1HQ3 C;  4CSR B;  5CP6 D;  4XUJ D;  5AV5 C;  5KDM A;  4G92 B;  5CPI B;  3AZH D;  5F99 D;  4M6B A;  2RVQ D;  3REI D;  3AV1 C;  1F66 D;  5JA4 B;  4J8V A;  5CPJ C;  3UT9 D;  1P3A D;  1KX4 A;  4J8U A;  3W99 B;  3AZK B;  3AV2 B;  3X1S C;  2NQB D;  5B31 D;  5KDM B;  5JRG C;  5B32 D;  1B67 A;  1TZY C;  5C3I B;  4Z5T C;  4JJN C;  3AZF C;  3MGP C;  5AY8 A;  1F66 A;  1P3M A;  5DNM B;  3X1V D;  3REL C;  3KWQ B;  1P3P D;  2BYM A;  4J8V B;  3MGQ D;  1KX4 B;  5E5A C;  3AZG B;  1P3G C;  1P3O C;  3AFA A;  5B31 A;  3X1T A;  4Z66 D;  1BFM A;  4J8W D;  1M19 C;  2PYO C;  3MNN A;  1M1A D;  3B6F D;  3LEL C;  3MGS C;  5B40 C;  1U35 C;  5B24 A;  4H9S C;  3REJ A;  2F8N D;  2CV5 A;  1P3M B;  1P3P A;  3TU4 D;  5B1L C;  3NQJ B;  2HIO C;  5AVC D;  3AZE A;  3X1U C;  3WTP B;  3AFA B;  4NE6 A;  4J8W A;  2ARO C;  1ZLA C;  3MNN B;  3WTP E;  4LD9 B;  3AZN D;  5F99 C;  3KXB D;  5GT0 A;  5B24 B;  3LZ0 D;  3TU4 A;  3REK C;  4YS3 C;  3REJ B;  2CV5 B;  4ZUX C;  1AOI D;  4H9O B;  4XZQ D;  4HGA C;  1P3I A;  3C1B D;  4KUD D;  3MVD A;  3UT9 C;  3AZE B;  1P3A C;  4KGC A;  5BNV B;  3WKJ C;  5AV5 D;  2NQB C;  1BH8 A;  5GXQ C;  3KXB A;  1S32 B;  5GT0 B;  4YM6 B;  1H3O A;  5AV9 D;  5AV8 C;  3X1V C;  5DNN D;  5B0Y C;  1P3B D;  1KU5 A;  3MGQ C;  1HQ3 A;  3MVD B;  1JFI A;  5GT3 A;  4KGC B;  1KX5 B;  3LJA C;  3W96 B;  3MGR A;  5JRG D;  1BH8 B;  3WA9 C;  4NE3 A;  4Z5T D;  4EO5 C;  4JJN D;  1M1A C;  3AV1 A;  5B2J B;  1H3O B;  3AYW C;  3AZM A;  3REL D;  5CPJ A;  4J8X A;  2NZD C;  3AN2 D;  1BH9 B;  1HQ3 B;  1P3G D;  5GT3 B;  3VH6 T;  4E44 A;  3X1S A;  5B1M C;  4WV4 B;  3O62 D;  2FJ7 D;  1ID3 B;  5AV6 C;  3MGR B;  3NQU B;  1HTA A;  1TZY A;  1M19 D;  4Z5T A;  2PYO D;  4JJN A;  3C1C C;  3AZF A;  3MGP A;  3W97 C;  5B40 D;  3MGS D;  3AV1 B;  3AZN C;  3AZM B;  5CPJ B;  5B1L D;  1TAF A;  5E5A A;  2JSS A;  4XZQ C;  4J8X B;  3UTB A;  1P3O A;  3C1B C;  2HIO D;  5B0Z A;  3AZI D;  3X1S B;  4KUD C;  1R4V A;  4CAY B;  1M19 A;  4H9Q A;  2PYO A;  2YFW A;  2ARO D;  1ZLA D;  1TZY B;  3LEL A;  5B40 A;  3MGS A;  5G49 B;  3MGP B;  5CHL B;  3AZF B;  1U35 A;  5AVB B;  3REK D;  4YS3 D;  4H9P A;  4G91 C;  5B1L A;  5B33 B;  4ZUX D;  1EQZ B;  5AV9 C;  1TAF B;  5E5A B;  4X23 D;  3UTB B;  3X1U A;  5DNN C;  4WU9 B;  5CPK B;  1P34 C;  3A6N C;  1P3B C;  2YFV A;  2BYK B;  1KX3 A;  5B0Z B;  1P3L D;  4AWL C;  5GSU C;  2ARO A;  4XUJ A;  5CP6 A;  4H9Q B;  3B0D B;  5B2I C;  3WKJ D;  3UTA D;  3AZH A;  3LEL B;  4QLC C;  5F99 A;  5GXQ D;  3AZL D;  3REI A;  3REK A;  4UUZ A;  3B0B A;  4H9P B;  3WAA C;  5AV8 D;  5B0Y D;  3UT9 A;  1P3A A;  3AN2 C;  3AZJ C;  2F8N H;  1KX3 B;  1Q9C A;  4J8U B;  3WKJ A;  3LJA D;  3VH6 A;  5CP6 B;  4XUJ B;  2NQB A;  4R8P C;  3O62 C;  2FJ7 C;  5GXQ A;  5FUG A;  2HUE B;  5B32 A;  3AZH B;  4DRA A;  3WA9 D;  3REI B;  3KUY D;  5AY8 B;  3AYW D;  3X1V A;  1F66 B;  4G92 C;  5CPI C;  4LD9 D;  3MGQ A;  2NZD D;  3UT9 B;  2BYM B;  5BS7 A;  3AZI C;  5B1M D;  2NQB B;  4Z66 A;  5B31 B;  5AV6 D;  3B6G D;  3X1T B;  5B32 B;  1M1A A;  3C1C D;  3B6F A;  3W97 D;  3W99 C;  3AZK C;  2F8N A;  1M18 D;  1P3P B;  3MGQ B;  5C3I C;  5AVC A;  4X23 C;  5B1M A;  1P3L C;  4Z66 B;  5DNM C;  2IO5 B;  4J8W B;  3KWQ C;  4WU8 D;  3W97 A;  4EO5 B;  3UTA C;  3VH6 W;  3B6F B;  3AZG C;  3AZN A;  3AZL C;  3LZ0 A;  2F8N B;  1AOI A;  3TU4 B;  3V9R A;  4XZQ A;  1P3K D;  1P3F D;  3W98 D;  2L5A A;  3C1B A;  1P34 D;  5AVC B;  1P3I B;  4KUD A;  5B2J D;  3A6N D;  5GSU D;  1P3M C;  5AV5 A;  5B2I D;  4ZBJ B;  4QLC D;  2F8N K;  3AZN B;  3KXB B;  3WTP C;  3LZ0 B;  3AFA C;  3KUY C;  3LZ1 D;  1AOI B;  5AV9 A;  4XZQ B;  1P3B A;  5DNN A;  3WAA D;  3MNN C;  3C1B B;  4LD9 C;  4KUD B;  3AZJ D;  5B24 C;  5B2I A;  3REJ C;  1JFI B;  2CV5 C;  4R8P D;  5AV5 B;  3REH D;  5JRG A;  3B6G C;  3KSY A;  5AV9 B;  3REL A;  1M18 C;  1P3B B;  5CPI D;  1ULY A;  3AN2 A;  1S32 C;  1P3G A;  5GT0 C;  4YM6 C;  1EQZ D;  3O62 A;  2FJ7 A;  3B0C T;  5JRG B;  4WU9 D;  4WU8 C;  4WNN A;  4Z5T B;  4JJN B;  3W99 D;  4KGC C;  4H9S A;  1KX5 C;  3AZK D;  3AV2 D;  3W96 C;  3REL B;  1P3K C;  1P3F C;  3AN2 B;  3W98 C;  2HIO A;  3AZI A;  1P3G B;  1P3O B;  5B2J C;  4NFT A;  3O62 B;  5DNM D;  4E45 A;  1ZLA A;  1M19 B;  3KWQ D;  2PYO B;  2YFW B;  4J8V D;  4Z2M G;  1KX4 D;  3AZK A;  5B40 B;  3MGS B;  4J8U D;  3AZG D;  1U35 B;  5GT3 C;  4YS3 A;  4ZUX A;  1ID3 C;  3MGR C;  3LZ1 C;  5B1L B;  4X23 A;  2HIO B;  3AZI B;  3X1U B;  5AY8 D;  5BO0 A;  1P3L A;  5DNM A;  2YFV B;  3KWQ A;  1P3M D;  3AZM C;  2ARO B;  3UTA A;  1ZLA B;  4J8X C;  3REH C;  3AZG A;  3AZL A;  5F99 B;  3WTP D;  3AFA D;  3REK B;  4UUZ B;  4YS3 B;  1N1J A;  4ZUX B;  3X1T D;  5AV8 A;  4HGA B;  5B0Y A;  3MNN D;  4X23 B;  3VH5 A;  1P3A B;  5BO0 B;  5B24 D;  1P3L B;  5AVB C;  3LJA A;  3REJ D;  5B33 C;  2CV5 D;  1EQZ C;  3WKJ B;  3NQJ A;  3UTA B;  3UTB C;  3WA9 A;  5GXQ B;  5FUG B;  3WTP A;  3AZL B;  4WU9 C;  5CPK C;  5BNX A;  5B0Z C;  3AZE D;  3KUY A;  1WWS A;  3AYW A;  3AV2 C;  1N1J B;  3B0D C;  4KHA A;  5AV8 B;  4LD9 A;  3X1V B;  5B0Y B;  2NZD A;  4Z2M H;  1S32 D;  5GT0 D;  4YM6 D;  4H9O A;  3LJA B;  5BT1 C;  3B6G A; 
#chains in the Genus database with same CATH topology
 5AV6 A;  2FFF B;  2DQN C;  1P3I D;  3C1C A;  3WA9 B;  4J8V C;  1M1A B;  5BNV A;  1KX3 C;  5BNX B;  3MVD D;  1KX4 C;  3KUY B;  4KGC D;  1PZR A;  3A1I A;  4J8U C;  4DRB A;  4H9R A;  5CP6 C;  4XUJ C;  3AYW B;  1M18 A;  1KX5 D;  3W96 D;  4KHA B;  3AL0 C;  2HUE C;  3AZH C;  2NZD B;  1S32 A;  4YM6 A;  2RVQ C;  3REI C;  5B1M B;  5AY8 C;  3H0L C;  3VH5 W;  1F66 C;  5AV6 B;  3B6G B;  4WU8 A;  2Y2N A;  3C1C B;  3W97 B;  1KX5 A;  3W96 A;  1HQ3 D;  5GT3 D;  3B0C W;  4H9R B;  1M18 B;  1P3K A;  5B31 C;  1P3F A;  1ID3 D;  3MGR D;  3W98 A;  3X1T C;  5B32 C;  2Y2L A;  3V9R B;  1F1E A;  1P34 A;  5B2J A;  3A6N A;  2Y2Q A;  3AV1 D;  5GSU A;  1Z2C B;  1BH9 A;  5CPJ D;  4WU8 B;  3AZM D;  1P3P C;  4J8X D;  2CWE A;  4QLC A;  5B31 G;  4H9N A;  5B32 G;  5BS7 C;  3X1S D;  3R45 A;  3AZE C;  1ID3 A;  3NQU A;  2BG1 A;  4Z66 C;  4G91 B;  4WZS B;  3LZ1 A;  2IO5 C;  4J8W C;  1P3K B;  1P3F B;  3W98 B;  3WAA A;  1TZY D;  3B6F C;  3AZF D;  3MGP D;  3VH5 T;  5DNN B;  1P34 B;  3A6N B;  3AZJ A;  4AWL B;  5AVB D;  5GSU B;  5B33 D;  4R8P A;  3TU4 C;  3REH A;  5B2I B;  1T3U A;  5E5A D;  4QLC B;  3UTB D;  4H9N B;  5AVC C;  5CPK D;  1A7W A;  4DQY B;  4CAY A;  1P3I C;  1P3O D;  5B0Z D;  3R45 B;  4CSR A;  3MVD C;  3LZ1 B;  5G49 A;  3WAA B;  5CPI A;  2F8N G;  3LEL D;  4ZBJ C;  1U35 D;  1B6W A;  5AVB A;  3KXB C;  1WWI A;  3AZJ B;  3LZ0 C;  5B33 A;  1EQZ A;  5BT1 D;  4R8P B;  1AOI C;  3REH B;  2FJ7 B;  4NE5 A;  4WU9 A;  5JA4 A;  5CPK A;  2LY8 A;  2BYK A;  3X1U D;  1W2E A;  3W99 A;  1KX3 D;  4WNN B;  3AV2 A;  1HQ3 C;  4CSR B;  5CP6 D;  4XUJ D;  5AV5 C;  5KDM A;  4G92 B;  5CPI B;  3AZH D;  5F99 D;  4M6B A;  2RVQ D;  3REI D;  3AV1 C;  2Y2O A;  1F66 D;  5JA4 B;  4J8V A;  5CPJ C;  3UT9 D;  1P3A D;  1KX4 A;  4J8U A;  3W99 B;  3AZK B;  3AV2 B;  3X1S C;  2NQB D;  5B31 D;  5KDM B;  5JRG C;  5B32 D;  1B67 A;  4WJ3 C;  1TZY C;  5C3I B;  4Z5T C;  4JJN C;  3AZF C;  3MGP C;  5AY8 A;  1F66 A;  1P3M A;  5DNM B;  3X1V D;  3REL C;  3KWQ B;  1P3P D;  2BYM A;  4J8V B;  3MGQ D;  3KFU G;  1KX4 B;  5E5A C;  3AZG B;  1P3G C;  1P3O C;  3AFA A;  5B31 A;  3X1T A;  4Z66 D;  1BFM A;  4J8W D;  1M19 C;  2PYO C;  3MNN A;  3EPH A;  1M1A D;  3B6F D;  3LEL C;  3H0R C;  3MGS C;  5B40 C;  1U35 C;  5B24 A;  4H9S C;  3REJ A;  2F8N D;  2UWX A;  2CV5 A;  1P3M B;  1P3P A;  3TU4 D;  5B1L C;  3NQJ B;  2HIO C;  5AVC D;  3AZE A;  3X1U C;  3WTP B;  3AFA B;  4NE6 A;  4J8W A;  2ARO C;  1ZLA C;  3MNN B;  3WTP E;  4LD9 B;  3AZN D;  5F99 C;  3F6T A;  5GT0 A;  5B24 B;  3KXB D;  3LZ0 D;  3TU4 A;  3REK C;  4YS3 C;  3REJ B;  2CV5 B;  4ZUX C;  1AOI D;  4H9O B;  4XZQ D;  4HGA C;  1P3I A;  3C1B D;  4KUD D;  3MVD A;  3UT9 C;  3AZE B;  1P3A C;  4KGC A;  5BNV B;  3WKJ C;  5AV5 D;  2NQB C;  1BH8 A;  5GXQ C;  3KXB A;  2XD5 A;  1S32 B;  5GT0 B;  4YM6 B;  2Y2M A;  1H3O A;  2W8S A;  5AV9 D;  2Y2H A;  5AV8 C;  3X1V C;  5DNN D;  5B0Y C;  1P3B D;  1KU5 A;  3MGQ C;  1HQ3 A;  3MVD B;  1JFI A;  5GT3 A;  4KGC B;  2Y2P A;  1KX5 B;  3LJA C;  3W96 B;  3MGR A;  2ZY3 A;  5JRG D;  1BH8 B;  3WA9 C;  4NE3 A;  4Z5T D;  4EO5 C;  4JJN D;  1M1A C;  3AV1 A;  5B2J B;  1H3O B;  3AYW C;  3AZM A;  3REL D;  5CPJ A;  4J8X A;  2NZD C;  3AN2 D;  1BH9 B;  1HQ3 B;  1P3G D;  5GT3 B;  3X1S A;  3VH6 T;  4E44 A;  5B1M C;  4WV4 B;  3O62 D;  2FJ7 D;  1ID3 B;  5AV6 C;  3MGR B;  3NQU B;  1HTA A;  1TZY A;  1M19 D;  4Z5T A;  2PYO D;  4JJN A;  3C1C C;  3AZF A;  3MGP A;  3A1K A;  3W97 C;  5B40 D;  3MGS D;  3AV1 B;  3FDD A;  3AZN C;  3EG5 B;  3AZM B;  5CPJ B;  5B1L D;  1TAF A;  5E5A A;  2JSS A;  4XZQ C;  3EPJ A;  4J8X B;  3UTB A;  1P3O A;  3C1B C;  2HIO D;  5B0Z A;  3AZI D;  3X1S B;  4KUD C;  1R4V A;  4CAY B;  1M19 A;  4H9Q A;  2PYO A;  2YFW A;  2ARO D;  1ZLA D;  1TZY B;  3LEL A;  5B40 A;  3MGS A;  5G49 B;  3MGP B;  5CHL B;  3AZF B;  1U35 A;  2RIQ A;  5AVB B;  3REK D;  4YS3 D;  4H9P A;  4G91 C;  5B1L A;  5B33 B;  4ZUX D;  1EQZ B;  5AV9 C;  1TAF B;  5E5A B;  4X23 D;  3UTB B;  3X1U A;  5DNN C;  4WU9 B;  5CPK B;  1P34 C;  3A6N C;  1P3B C;  2YFV A;  2BYK B;  1KX3 A;  5B0Z B;  1P3L D;  4AWL C;  5GSU C;  2ARO A;  4XUJ A;  5CP6 A;  4H9Q B;  2ZY5 A;  3B0D B;  5B2I C;  3WKJ D;  2ZY2 A;  3UTA D;  3AZH A;  3LEL B;  4QLC C;  5F99 A;  5GXQ D;  3AZL D;  3REI A;  3REK A;  4UUZ A;  3B0B A;  4H9P B;  3WAA C;  5AV8 D;  5B0Y D;  3UT9 A;  1P3A A;  2ZY4 A;  3AN2 C;  3AZJ C;  2F8N H;  1KX3 B;  1Q9C A;  4J8U B;  3WKJ A;  3LJA D;  3VH6 A;  5CP6 B;  4XUJ B;  2NQB A;  4R8P C;  3O62 C;  2FJ7 C;  5GXQ A;  5FUG A;  2HUE B;  5B32 A;  3AZH B;  3EPL A;  4DRA A;  3WA9 D;  3REI B;  3KUY D;  5AY8 B;  3AYW D;  3X1V A;  1F66 B;  4G92 C;  5CPI C;  4LD9 D;  3MGQ A;  2NZD D;  3UT9 B;  2BYM B;  5BS7 A;  3AZI C;  5B1M D;  2NQB B;  4Z66 A;  5B31 B;  5AV6 D;  3B6G D;  3X1T B;  5B32 B;  1M1A A;  3C1C D;  3B6F A;  3W97 D;  2Y2J A;  3W99 C;  3H0M C;  3AZK C;  2F8N A;  1M18 D;  1P3P B;  3MGQ B;  5C3I C;  5AVC A;  4X23 C;  5B1M A;  4UPK A;  1P3L C;  4Z66 B;  5DNM C;  2IO5 B;  4J8W B;  3KWQ C;  4WU8 D;  2XD1 A;  3W97 A;  4EO5 B;  3UTA C;  3VH6 W;  3B6F B;  2G5I C;  3AZG C;  3AZN A;  3AZL C;  3LZ0 A;  2F8N B;  2Y2I A;  1AOI A;  3TU4 B;  3V9R A;  4XZQ A;  1P3K D;  1P3F D;  3W98 D;  2L5A A;  3C1B A;  1P34 D;  5AVC B;  1P3I B;  4KUD A;  5B2J D;  3A6N D;  5GSU D;  1P3M C;  5AV5 A;  5B2I D;  4ZBJ B;  2G5H C;  4QLC D;  2F8N K;  3AZN B;  3KXB B;  3WTP C;  3LZ0 B;  3AFA C;  2VQR A;  3KUY C;  2JE5 A;  3LZ1 D;  1AOI B;  5AV9 A;  3EPK A;  4XZQ B;  1P3B A;  5DNN A;  3WAA D;  3MNN C;  3C1B B;  2ZM5 A;  4LD9 C;  4KUD B;  3AZJ D;  5B24 C;  5B2I A;  3REJ C;  1JFI B;  2CV5 C;  4R8P D;  5AV5 B;  3REH D;  5JRG A;  3B6G C;  3KSY A;  5AV9 B;  3REL A;  1M18 C;  1P3B B;  5CPI D;  1ULY A;  3AN2 A;  3P5J B;  1S32 C;  1P3G A;  5GT0 C;  4YM6 C;  1EQZ D;  3O62 A;  2FJ7 A;  3B0C T;  5JRG B;  4WU9 D;  4WU8 C;  4WNN A;  4Z5T B;  4JJN B;  3W99 D;  4KGC C;  4H9S A;  1KX5 C;  3AZK D;  3AV2 D;  3W96 C;  3REL B;  1P3K C;  1P3F C;  3AN2 B;  3W98 C;  2HIO A;  3AZI A;  1P3G B;  1P3O B;  5B2J C;  4NFT A;  3O62 B;  5DNM D;  4E45 A;  1ZLA A;  1M19 B;  3KWQ D;  2PYO B;  2YFW B;  4J8V D;  4Z2M G;  1KX4 D;  3AZK A;  5B40 B;  3MGS B;  4J8U D;  3AZG D;  1U35 B;  5GT3 C;  4YS3 A;  4ZUX A;  1ID3 C;  3MGR C;  3LZ1 C;  5B1L B;  4X23 A;  2HIO B;  3AZI B;  3X1U B;  5AY8 D;  5BO0 A;  1P3L A;  5DNM A;  2J8P A;  2YFV B;  3KWQ A;  1P3M D;  2F2A C;  3AZM C;  2ARO B;  3UTA A;  1ZLA B;  2Y2G A;  4J8X C;  3REH C;  3AZG A;  3AZL A;  3IP4 C;  5F99 B;  3WTP D;  3AFA D;  3REK B;  4UUZ B;  4YS3 B;  2DF4 C;  1N1J A;  4ZUX B;  3X1T D;  5AV8 A;  4HGA B;  5B0Y A;  3MNN D;  4X23 B;  3VH5 A;  1P3A B;  5BO0 B;  5B24 D;  1P3L B;  5AVB C;  3LJA A;  3REJ D;  5B33 C;  2CV5 D;  1EQZ C;  3WKJ B;  3NQJ A;  3UTA B;  2Y2K A;  3UTB C;  3WA9 A;  5GXQ B;  5FUG B;  3WTP A;  3AZL B;  4WU9 C;  5CPK C;  5BNX A;  5B0Z C;  3AZE D;  3KUY A;  1WWS A;  3AYW A;  2JCH A;  1N1J B;  3B0D C;  3AV2 C;  4KHA A;  5AV8 B;  4LD9 A;  3X1V B;  5B0Y B;  2NZD A;  4Z2M H;  1S32 D;  5GT0 D;  4YM6 D;  4H9O A;  3LJA B;  5BT1 C;  3B6G A; 
#chains in the Genus database with same CATH homology
 5AV6 A;  2FFF B;  2DQN C;  1P3I D;  3C1C A;  3WA9 B;  4J8V C;  1M1A B;  5BNV A;  1KX3 C;  5BNX B;  3MVD D;  1KX4 C;  3KUY B;  4KGC D;  1PZR A;  3A1I A;  4J8U C;  4DRB A;  4H9R A;  5CP6 C;  4XUJ C;  3AYW B;  1M18 A;  1KX5 D;  3W96 D;  4KHA B;  3AL0 C;  2HUE C;  3AZH C;  2NZD B;  1S32 A;  4YM6 A;  2RVQ C;  3REI C;  5B1M B;  5AY8 C;  3H0L C;  3VH5 W;  1F66 C;  5AV6 B;  3B6G B;  4WU8 A;  2Y2N A;  3C1C B;  3W97 B;  1KX5 A;  3W96 A;  1HQ3 D;  5GT3 D;  3B0C W;  4H9R B;  1M18 B;  1P3K A;  5B31 C;  1P3F A;  1ID3 D;  3MGR D;  3W98 A;  3X1T C;  5B32 C;  2Y2L A;  3V9R B;  1F1E A;  1P34 A;  5B2J A;  3A6N A;  2Y2Q A;  3AV1 D;  5GSU A;  1Z2C B;  1BH9 A;  5CPJ D;  4WU8 B;  3AZM D;  1P3P C;  4J8X D;  2CWE A;  4QLC A;  5B31 G;  4H9N A;  5B32 G;  5BS7 C;  3X1S D;  3R45 A;  3AZE C;  1ID3 A;  3NQU A;  2BG1 A;  4Z66 C;  4G91 B;  4WZS B;  3LZ1 A;  2IO5 C;  4J8W C;  1P3K B;  1P3F B;  3W98 B;  3WAA A;  1TZY D;  3B6F C;  3AZF D;  3MGP D;  3VH5 T;  5DNN B;  1P34 B;  3A6N B;  3AZJ A;  4AWL B;  5AVB D;  5GSU B;  5B33 D;  4R8P A;  3TU4 C;  3REH A;  5B2I B;  1T3U A;  5E5A D;  4QLC B;  3UTB D;  4H9N B;  5AVC C;  5CPK D;  1A7W A;  4DQY B;  4CAY A;  1P3I C;  1P3O D;  5B0Z D;  3R45 B;  4CSR A;  3MVD C;  3LZ1 B;  5G49 A;  3WAA B;  5CPI A;  2F8N G;  3LEL D;  4ZBJ C;  1U35 D;  1B6W A;  5AVB A;  3KXB C;  1WWI A;  3AZJ B;  3LZ0 C;  5B33 A;  1EQZ A;  5BT1 D;  4R8P B;  1AOI C;  3REH B;  2FJ7 B;  4NE5 A;  4WU9 A;  5JA4 A;  5CPK A;  2LY8 A;  2BYK A;  3X1U D;  1W2E A;  3W99 A;  1KX3 D;  4WNN B;  3AV2 A;  1HQ3 C;  4CSR B;  5CP6 D;  4XUJ D;  5AV5 C;  5KDM A;  4G92 B;  5CPI B;  3AZH D;  5F99 D;  4M6B A;  2RVQ D;  3REI D;  3AV1 C;  2Y2O A;  1F66 D;  5JA4 B;  4J8V A;  5CPJ C;  3UT9 D;  1P3A D;  1KX4 A;  4J8U A;  3W99 B;  3AZK B;  3AV2 B;  3X1S C;  2NQB D;  5B31 D;  5KDM B;  5JRG C;  5B32 D;  1B67 A;  4WJ3 C;  1TZY C;  5C3I B;  4Z5T C;  4JJN C;  3AZF C;  3MGP C;  5AY8 A;  1F66 A;  1P3M A;  5DNM B;  3X1V D;  3REL C;  3KWQ B;  1P3P D;  2BYM A;  4J8V B;  3MGQ D;  3KFU G;  1KX4 B;  5E5A C;  3AZG B;  1P3G C;  1P3O C;  3AFA A;  5B31 A;  3X1T A;  4Z66 D;  1BFM A;  4J8W D;  1M19 C;  2PYO C;  3MNN A;  3EPH A;  1M1A D;  3B6F D;  3LEL C;  3H0R C;  3MGS C;  5B40 C;  1U35 C;  5B24 A;  4H9S C;  3REJ A;  2F8N D;  2UWX A;  2CV5 A;  1P3M B;  1P3P A;  3TU4 D;  5B1L C;  3NQJ B;  2HIO C;  5AVC D;  3AZE A;  3X1U C;  3WTP B;  3AFA B;  4NE6 A;  4J8W A;  2ARO C;  1ZLA C;  3MNN B;  3WTP E;  4LD9 B;  3AZN D;  5F99 C;  3F6T A;  5GT0 A;  5B24 B;  3KXB D;  3LZ0 D;  3TU4 A;  3REK C;  4YS3 C;  3REJ B;  2CV5 B;  4ZUX C;  1AOI D;  4H9O B;  4XZQ D;  4HGA C;  1P3I A;  3C1B D;  4KUD D;  3MVD A;  3UT9 C;  3AZE B;  1P3A C;  4KGC A;  5BNV B;  3WKJ C;  5AV5 D;  2NQB C;  1BH8 A;  5GXQ C;  3KXB A;  2XD5 A;  1S32 B;  5GT0 B;  4YM6 B;  2Y2M A;  1H3O A;  2W8S A;  5AV9 D;  2Y2H A;  5AV8 C;  3X1V C;  5DNN D;  5B0Y C;  1P3B D;  1KU5 A;  3MGQ C;  1HQ3 A;  3MVD B;  1JFI A;  5GT3 A;  4KGC B;  2Y2P A;  1KX5 B;  3LJA C;  3W96 B;  3MGR A;  2ZY3 A;  5JRG D;  1BH8 B;  3WA9 C;  4NE3 A;  4Z5T D;  4EO5 C;  4JJN D;  1M1A C;  3AV1 A;  5B2J B;  1H3O B;  3AYW C;  3AZM A;  3REL D;  5CPJ A;  4J8X A;  2NZD C;  3AN2 D;  1BH9 B;  1HQ3 B;  1P3G D;  5GT3 B;  3X1S A;  3VH6 T;  4E44 A;  5B1M C;  4WV4 B;  3O62 D;  2FJ7 D;  1ID3 B;  5AV6 C;  3MGR B;  3NQU B;  1HTA A;  1TZY A;  1M19 D;  4Z5T A;  2PYO D;  4JJN A;  3C1C C;  3AZF A;  3MGP A;  3A1K A;  3W97 C;  5B40 D;  3MGS D;  3AV1 B;  3FDD A;  3AZN C;  3EG5 B;  3AZM B;  5CPJ B;  5B1L D;  1TAF A;  5E5A A;  2JSS A;  4XZQ C;  3EPJ A;  4J8X B;  3UTB A;  1P3O A;  3C1B C;  2HIO D;  5B0Z A;  3AZI D;  3X1S B;  4KUD C;  1R4V A;  4CAY B;  1M19 A;  4H9Q A;  2PYO A;  2YFW A;  2ARO D;  1ZLA D;  1TZY B;  3LEL A;  5B40 A;  3MGS A;  5G49 B;  3MGP B;  5CHL B;  3AZF B;  1U35 A;  2RIQ A;  5AVB B;  3REK D;  4YS3 D;  4H9P A;  4G91 C;  5B1L A;  5B33 B;  4ZUX D;  1EQZ B;  5AV9 C;  1TAF B;  5E5A B;  4X23 D;  3UTB B;  3X1U A;  5DNN C;  4WU9 B;  5CPK B;  1P34 C;  3A6N C;  1P3B C;  2YFV A;  2BYK B;  1KX3 A;  5B0Z B;  1P3L D;  4AWL C;  5GSU C;  2ARO A;  4XUJ A;  5CP6 A;  4H9Q B;  2ZY5 A;  3B0D B;  5B2I C;  3WKJ D;  2ZY2 A;  3UTA D;  3AZH A;  3LEL B;  4QLC C;  5F99 A;  5GXQ D;  3AZL D;  3REI A;  3REK A;  4UUZ A;  3B0B A;  4H9P B;  3WAA C;  5AV8 D;  5B0Y D;  3UT9 A;  1P3A A;  2ZY4 A;  3AN2 C;  3AZJ C;  2F8N H;  1KX3 B;  1Q9C A;  4J8U B;  3WKJ A;  3LJA D;  3VH6 A;  5CP6 B;  4XUJ B;  2NQB A;  4R8P C;  3O62 C;  2FJ7 C;  5GXQ A;  5FUG A;  2HUE B;  5B32 A;  3AZH B;  3EPL A;  4DRA A;  3WA9 D;  3REI B;  3KUY D;  5AY8 B;  3AYW D;  3X1V A;  1F66 B;  4G92 C;  5CPI C;  4LD9 D;  3MGQ A;  2NZD D;  3UT9 B;  2BYM B;  5BS7 A;  3AZI C;  5B1M D;  2NQB B;  4Z66 A;  5B31 B;  5AV6 D;  3B6G D;  3X1T B;  5B32 B;  1M1A A;  3C1C D;  3B6F A;  3W97 D;  2Y2J A;  3W99 C;  3H0M C;  3AZK C;  2F8N A;  1M18 D;  1P3P B;  3MGQ B;  5C3I C;  5AVC A;  4X23 C;  5B1M A;  4UPK A;  1P3L C;  4Z66 B;  5DNM C;  2IO5 B;  4J8W B;  3KWQ C;  4WU8 D;  2XD1 A;  3W97 A;  4EO5 B;  3UTA C;  3VH6 W;  3B6F B;  2G5I C;  3AZG C;  3AZN A;  3AZL C;  3LZ0 A;  2F8N B;  2Y2I A;  1AOI A;  3TU4 B;  3V9R A;  4XZQ A;  1P3K D;  1P3F D;  3W98 D;  2L5A A;  3C1B A;  1P34 D;  5AVC B;  1P3I B;  4KUD A;  5B2J D;  3A6N D;  5GSU D;  1P3M C;  5AV5 A;  5B2I D;  4ZBJ B;  2G5H C;  4QLC D;  2F8N K;  3AZN B;  3KXB B;  3WTP C;  3LZ0 B;  3AFA C;  2VQR A;  3KUY C;  2JE5 A;  3LZ1 D;  1AOI B;  5AV9 A;  3EPK A;  4XZQ B;  1P3B A;  5DNN A;  3WAA D;  3MNN C;  3C1B B;  2ZM5 A;  4LD9 C;  4KUD B;  3AZJ D;  5B24 C;  5B2I A;  3REJ C;  1JFI B;  2CV5 C;  4R8P D;  5AV5 B;  3REH D;  5JRG A;  3B6G C;  3KSY A;  5AV9 B;  3REL A;  1M18 C;  1P3B B;  5CPI D;  1ULY A;  3AN2 A;  3P5J B;  1S32 C;  1P3G A;  5GT0 C;  4YM6 C;  1EQZ D;  3O62 A;  2FJ7 A;  3B0C T;  5JRG B;  4WU9 D;  4WU8 C;  4WNN A;  4Z5T B;  4JJN B;  3W99 D;  4KGC C;  4H9S A;  1KX5 C;  3AZK D;  3AV2 D;  3W96 C;  3REL B;  1P3K C;  1P3F C;  3AN2 B;  3W98 C;  2HIO A;  3AZI A;  1P3G B;  1P3O B;  5B2J C;  4NFT A;  3O62 B;  5DNM D;  4E45 A;  1ZLA A;  1M19 B;  3KWQ D;  2PYO B;  2YFW B;  4J8V D;  4Z2M G;  1KX4 D;  3AZK A;  5B40 B;  3MGS B;  4J8U D;  3AZG D;  1U35 B;  5GT3 C;  4YS3 A;  4ZUX A;  1ID3 C;  3MGR C;  3LZ1 C;  5B1L B;  4X23 A;  2HIO B;  3AZI B;  3X1U B;  5AY8 D;  5BO0 A;  1P3L A;  5DNM A;  2J8P A;  2YFV B;  3KWQ A;  1P3M D;  2F2A C;  3AZM C;  2ARO B;  3UTA A;  1ZLA B;  2Y2G A;  4J8X C;  3REH C;  3AZG A;  3AZL A;  3IP4 C;  5F99 B;  3WTP D;  3AFA D;  3REK B;  4UUZ B;  4YS3 B;  2DF4 C;  1N1J A;  4ZUX B;  3X1T D;  5AV8 A;  4HGA B;  5B0Y A;  3MNN D;  4X23 B;  3VH5 A;  1P3A B;  5BO0 B;  5B24 D;  1P3L B;  5AVB C;  3LJA A;  3REJ D;  5B33 C;  2CV5 D;  1EQZ C;  3WKJ B;  3NQJ A;  3UTA B;  2Y2K A;  3UTB C;  3WA9 A;  5GXQ B;  5FUG B;  3WTP A;  3AZL B;  4WU9 C;  5CPK C;  5BNX A;  5B0Z C;  3AZE D;  3KUY A;  1WWS A;  3AYW A;  2JCH A;  1N1J B;  3B0D C;  3AV2 C;  4KHA A;  5AV8 B;  4LD9 A;  3X1V B;  5B0Y B;  2NZD A;  4Z2M H;  1S32 D;  5GT0 D;  4YM6 D;  4H9O A;  3LJA B;  5BT1 C;  3B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...