4Z66A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66A00
4HGAB 3LELC 3B6GC 2NZDA 3W97A 5GT0C 5AY8D 4CAYB 3W98D 3MGSA 3MVDB 1EQZD 5CP6A 3KSYA 2FJ7D 5B40A 3REKC 3KWQC 3REHA 5B2JB 1M19A 3REJA 4R8PA 3MNNA 2BYKA 3B6FD 4XUJD 5B0YD 3AZJA 3B0DC 3WKJA 4WZSB 2PYOD 3W96A 3MGRC 3WA9B 3C1CC 4E45A 1P3MB 2AROD 1P3IA 4EO5B 4H9RB 3AZED 3AZGB 1ID3C 3X1SC 5B1MD 3AZHD 5GT3A 5CPKD 5G49A 1P3BD 1M18A 5AY8A 5B31B 2YFWB 5GSUB 5B0ZC 1EQZA 5AV6D 5AV9B 2FJ7A 4JJNB 3WTPB 3AZLB 4X23D 5AVCD 4J8XB 1TZYC 1KX4A 3AN2A 5B2IC 3LZ1D 3VH5T 4QLCB 3LELB 4ZUXB 3UT9A 3NQUB 3B6FA 5AV8C 3W97C 1P3KB 5GSUD 4YM6B 3UTBB 1P3PD 2PYOA 3RELB 3REKB 5BT1C 3KWQB 5CP6C 3UTAD 2AROA 3A6ND 3MGQC 4QLCD 3AZEA 3AZKB 3REHC 5B1MA 1JFIB 3W99B 3AZHA 3WAAA 5CPKA 1P3BA 1M19C 4YM6D 2YFVA 4NE6A 4WU8A 3UTBD 5BS7C 5AV6A 3AZIB 4X23A 5E5AB 3AZNA 3X1VB 1AOID 3B0CW 3WKJC 3C1CB 4WU9B 3W96C 3LZ1A 5B1LB 1ID3B 3W99D 4E44A 1P3OA 3LZ0A 4CSRB 3WTPE 5F99B 1P3FC 5GT3C 1M18C 5AY8C 5B0ZB 5BNXA 4YS3D 3X1VD 2F8NH 1EQZC 3UTAA 4WU9D 3AZFD 3A6NA 3MGPD 5AVBA 5B32B 5B2IB 1KX4C 3AN2C 5B33D 5BO0B 5F99D 5CPJB 5AV8B 4Z66A 1H3OA 1M1AA 3UT9C 1P3GC 2F8NA 3B6FC 4KGCB 1AOIA 4NFTA 3X1UC 2PYOC 3TU4D 4H9PB 3MGQB 4AWLC 3X1TA 2AROC 5KDMB 4J8UB 1A7WA 5DNND 2BYMB 3AYWC 5B1MC 4XZQC 3WAAC 5CPKC 1P3BC 2NQBD 2JSSA 5GXQB 4H9OB 4YS3A 4KGCD 3KXBD 4WU8C 3REIA 3NQJB 3C1BD 3AZFA 2CV5D 5C3IC 3AZNC 1HQ3D 3MGPA 5FUGB 3AV2A 1KX5A 4J8UD 5B33A 3LZ1C 5JRGD 5B24C 1P34B 4KUDB 1P3OC 3LZ0C 1P3FB 3AV1B 5GT3B 5JA4A 1P3LD 4J8WD 5B31G 5CPIA 3B0BA 3O62B 1U35C 1KX4B 5DNMB 3AN2B 3A6NC 5AVBC 4Z5TA 1P34D 1F66C 1ZLAC 4KUDD 1S32C 3MVDD 3AV1D 1P3GB 3LJAA 2NQBA 3B0CT 3AFAC 2RVQD 4Z66C 5AV5C 1M1AC 5B2JD 1KX3A 1P3AC 1BH9A 3C1BA 2CV5A 2CWEA 3X1UB 2HIOB 1F1EA 1AOIC 5DNMD 4AWLB 3AZMB 4J8VB 5JRGA 3VH6A 3X1TC 3W98A 3AYWB 4XZQB 4LD9B 3WA9D 3KUYC 4H9QB 1P3MD 1TAFB 4M6BA 4J8WA 3AZGD 4YS3C 5C3IB 3REIC 3AZNB 5BNVA 3B6GB 4UUZB 3R45B 5GT0B 4CAYA 5CHLB 5B31D 3MGPC 2NZDC 4DRBA 1ULYA 4XUJA 5B0YA 3AV2C 1KX5C 5B33C 3MVDA 5B24B 5AV9D 1P3OB 4JJND 3WTPD 3AZLD 4J8XD 3MGSC 4KHAB 5B2JA 4G91C 5B40C 3LELD 4ZUXD 3VH6W 1U35B 5GT0D 5CPIC 1BH8B 4H9NB 3REJC 1Q9CA 1P3KD 4R8PC 3MNNC 1F66B 1ZLAB 1S32B 3B0DB 5B32G 4Z5TC 3WA9A 3AZJC 3RELD 5AVCA 3REKD 3V9RB 3AFAB 4Z66B 1H3OB 5AV5B 3KWQD 3MGRB 3LJAC 1N1JB 4H9RA 3AZKD 1P3AB 3AZGA 2F8NB 1KX3C 1P3IC 2CV5C 3X1SB 5B31A 2IO5C 5GSUA 3X1TB 5AV9A 5JRGC 3WTPA 3AZID 3AZLA 4WNNB 5E5AD 1P3PA 3W98C 4J8XA 3MGRD 3KUYB 3C1CD 1TZYB 4WV4B 2FJ7C 5B1LD 4QLCA 3LELA 1ID3D 4ZUXA 4HGAC 1B67A 1P3KA 4YM6A 2NZDB 3W97B 5B0ZD 3UTBA 1WWSA 4XUJC 5B0YC 3RELA 3REKA 1TZYD 3KWQA 3MGSB 4Z2MG 1BFMA 5CP6B 3AZKA 5B32D 2RVQC 5B2ID 5B40B 5B2JC 1JFIA 3W99A 3REHB 3AZEC 5CPJD 4NE3A 5AV8D 1M19B 3REJB 3AZHC 4R8PB 3MNNB 2BYKB 3AZIA 4ZBJC 5E5AA 3X1VA 3AZJB 3C1CA 5AV6C 4WU9A 3WKJB 5B1LA 4X23C 3MGQD 5AVCC 1ID3A 3W96B 3REHD 4EO5C 1BH9B 3AZGC 1P3IB 2HUEC 1M19D 5F99A 2IO5B 5B0ZA 5GXQD 5G49B 1M18B 5AY8B 5GSUC 3WKJD 1P3PC 1EQZB 3VH6T 4J8XC 5B32A 5B2IA 3TU4A 2FJ7B 3UTAC 5DNNA 4QLCC 5CPJA 4ZUXC 5AV8A 1P3FD 5BNVB 5GT3D 3UT9B 1M18D 1P3KC 4YM6C 3B6FB 4KGCA 4XUJB 5B0YB 3KXBA 3UTBC 3O62D 4H9PA 3RELC 2PYOB 3MGQA 1HQ3A 4DRAA 4G92C 1KX4D 4J8UA 5KDMA 3AN2D 3AZKC 2AROB 2BYMA 3AZEB 3W99C 4Z2MH 3UT9D 5B1MB 1P3GD 5GXQA 3AZHB 3WAAB 4H9OA 5BS7A 5CPKB 1P3BB 4ZBJB 1P3LA 2YFVB 4WU8B 3NQJA 2F8NK 3X1UD 3AZIC 2HIOD 5E5AC 5AV6B 3X1VC 5FUGA 1R4VA 4X23B 5AVCB 3AZMD 3AZFC 4WU9C 5B1LC 4J8VD 3LZ1B 1P34A 4KUDA 2HUEB 3AYWD 1P3FA 4XZQD 3AV1A 4LD9D 2F8NG 3WAAD 3LZ0B 5F99C 2LY8A 4WU8D 1KU5A 3O62A 1WWIA 1P3PB 5BNXB 3AZND 3B6GD 5DNMA 1B6WA 3UTAB 5B32C 3TU4C 3A6NB 5AVBB 5B24D 1P3OD 3LZ0D 5DNNC 1P3GA 5CPJC 4NE5A 1P3MA 1M1AB 2NQBC 3X1UA 2HIOA 4KGCC 3KXBC 1U35D 4G92B 3AZMA 1AOIB 3C1BC 4J8VA 1HQ3C 5AVBD 2YFWA 4J8UC 1F66D 1ZLAD 3AYWA 1S32D 4XZQA 4LD9A 4JJNA 4H9QA 3AFAD 4H9SA 1TAFA 3VH5A 5AV5D 4Z66D 1M1AD 5GXQC 1P3AD 2F8ND 4YS3B 1P3LC 3B6GA 4J8WC 4UUZA 3R45A 3X1SD 3REIB 5GT0A 3NQUA 3AZFB 3X1TD 3MGPB 3AV2B 1KX5B 5B24A 5B33B 1P34C 4KUDC 3KUYD 3MVDC 3AV1C 4KHAA 4G91B 5JA4B 1U35A 3REID 1BH8A 4H9NA 3O62C 2L5AA 5CPIB 2NZDD 3TU4B 3W97D 3AV2D 1KX5D 5DNMC 1F66A 1ZLAA 3VH5W 1S32A 5DNNB 4Z5TB 3V9RA 3AFAA 3MGSD 5AV5A 3MGRA 1N1JA 5BT1D 5CP6D 1P3AA 3WA9C 3LJAB 2NQBB 5B40D 1P3MC 3KXBB 3X1SA 1KX3B 5CPID 2HIOC 4CSRA 3C1BB 2CV5B 3REJD 1HQ3B 3AZMC 4R8PD 3MNND 4J8VC 5B31C 4WNNA 4Z5TD 5JRGB 3KUYA 3AZJD 3W98B 4LD9C 1TZYA 5AV9C 4JJNC 3WTPC 3LJAD 3AZLC 3W96D 4H9SC 1HTAA 1KX3D 1P3LB 1P3ID 4J8WB 5BO0A
chains in the Genus database with same CATH superfamily
4HGAB 3LELC 3B6GC 2NZDA 3W97A 5GT0C 3A1IA 5AY8D 4CAYB 3W98D 3MGSA 3MVDB 1EQZD 5CP6A 3KSYA 2FJ7D 5B40A 3H0LC 3KWQC 4DQYB 3REKC 3REHA 5B2JB 1M19A 3REJA 4R8PA 3MNNA 2BYKA 3B6FD 4XUJD 5B0YD 3AZJA 3B0DC 3WKJA 4WZSB 2PYOD 2Y2MA 3W96A 3MGRC 3WA9B 3C1CC 4E45A 1P3MB 2AROD 1P3IA 4EO5B 4H9RB 3AZED 3AZGB 1ID3C 3X1SC 5B1MD 3AZHD 5GT3A 5CPKD 5G49A 1P3BD 3AL0C 1M18A 5AY8A 5B31B 2YFWB 5GSUB 5B0ZC 1EQZA 5AV6D 5AV9B 2FJ7A 4JJNB 3WTPB 3AZLB 4X23D 2DQNC 3H0RC 5AVCD 4J8XB 1TZYC 1KX4A 3AN2A 5B2IC 3LZ1D 3VH5T 4QLCB 3LELB 4ZUXB 4WJ3C 3H0MC 3UT9A 3NQUB 3B6FA 5AV8C 3W97C 1P3KB 5GSUD 4YM6B 3UTBB 1P3PD 2PYOA 3RELB 3REKB 5BT1C 3KWQB 5CP6C 3UTAD 2AROA 3A6ND 3MGQC 4QLCD 3AZEA 3AZKB 3REHC 5B1MA 1JFIB 3W99B 3AZHA 3WAAA 5CPKA 2XD1A 1P3BA 1M19C 4YM6D 2YFVA 4NE6A 4WU8A 3UTBD 5BS7C 5AV6A 3AZIB 4X23A 5E5AB 3AZNA 3X1VB 1AOID 3B0CW 3WKJC 3KFUG 3C1CB 4WU9B 3FDDA 3W96C 3LZ1A 5B1LB 1ID3B 2Y2NA 3W99D 4E44A 1P3OA 3LZ0A 3F6TA 4CSRB 1W2EA 5F99B 3WTPE 1P3FC 5GT3C 1M18C 5AY8C 5B0ZB 5BNXA 4YS3D 3X1VD 2F8NH 1EQZC 3UTAA 4WU9D 3AZFD 2RIQA 3A6NA 3MGPD 5AVBA 5B32B 5B2IB 1KX4C 3AN2C 5B33D 5BO0B 5F99D 5CPJB 5AV8B 4Z66A 1H3OA 1M1AA 3UT9C 1P3GC 2F8NA 3B6FC 4KGCB 1AOIA 4NFTA 3X1UC 2PYOC 3TU4D 4H9PB 3MGQB 3EPLA 4AWLC 3X1TA 2AROC 5KDMB 4J8UB 1A7WA 5DNND 2BYMB 3AYWC 5B1MC 4XZQC 3WAAC 5CPKC 1P3BC 2NQBD 2JSSA 5GXQB 4H9OB 4YS3A 4KGCD 3KXBD 4WU8C 3REIA 3NQJB 3C1BD 3AZFA 2CV5D 5C3IC 3AZNC 1HQ3D 3MGPA 5FUGB 3AV2A 1KX5A 4J8UD 5B33A 3LZ1C 5JRGD 3EG5B 5B24C 1P34B 4KUDB 1P3OC 3LZ0C 1P3FB 3AV1B 2ZY3A 5GT3B 5JA4A 1P3LD 4J8WD 2Y2HA 5B31G 5CPIA 3B0BA 2VQRA 3O62B 1U35C 1KX4B 5DNMB 3AN2B 3A6NC 5AVBC 4Z5TA 1P34D 1F66C 1ZLAC 4KUDD 1S32C 3MVDD 3AV1D 1P3GB 3LJAA 2NQBA 3B0CT 3AFAC 2RVQD 4Z66C 5AV5C 1M1AC 5B2JD 1KX3A 1P3AC 1BH9A 3C1BA 2CV5A 2CWEA 2ZY2A 3X1UB 2HIOB 1F1EA 1AOIC 1T3UA 5DNMD 4AWLB 3AZMB 4J8VB 5JRGA 3VH6A 3X1TC 3W98A 3AYWB 4XZQB 4LD9B 2Y2PA 3WA9D 3KUYC 4H9QB 1P3MD 1TAFB 4M6BA 4J8WA 3AZGD 4YS3C 5C3IB 3REIC 3AZNB 5BNVA 3B6GB 4UUZB 3R45B 5GT0B 4CAYA 5CHLB 5B31D 3MGPC 2NZDC 4DRBA 1ULYA 4XUJA 5B0YA 3AV2C 1KX5C 5B33C 3MVDA 5B24B 5AV9D 1P3OB 4JJND 3WTPD 3AZLD 4J8XD 3MGSC 4KHAB 5B2JA 4G91C 2Y2KA 5B40C 3LELD 4ZUXD 3VH6W 1U35B 5GT0D 5CPIC 1BH8B 2ZY4A 4H9NB 3REJC 1Q9CA 2Y2GA 1P3KD 4R8PC 3MNNC 1F66B 1ZLAB 2F2AC 1S32B 3B0DB 5B32G 4Z5TC 3WA9A 3AZJC 3RELD 5AVCA 3REKD 3V9RB 3AFAB 4Z66B 1H3OB 2ZY5A 5AV5B 3KWQD 3LJAC 3MGRB 1N1JB 4H9RA 3AZKD 1P3AB 3AZGA 2F8NB 1KX3C 1P3IC 2CV5C 3X1SB 5B31A 2IO5C 5GSUA 3X1TB 5AV9A 5JRGC 3WTPA 3AZID 3AZLA 4WNNB 5E5AD 1P3PA 3W98C 4J8XA 3MGRD 3KUYB 3C1CD 1TZYB 4WV4B 2XD5A 2FJ7C 5B1LD 4QLCA 3LELA 1ID3D 2BG1A 4ZUXA 3EPJA 4HGAC 1B67A 1P3KA 4YM6A 2NZDB 3W97B 5B0ZD 3UTBA 1WWSA 4XUJC 5B0YC 2Y2JA 3RELA 3REKA 1TZYD 3KWQA 3MGSB 4Z2MG 1BFMA 5CP6B 3AZKA 5B32D 2RVQC 5B2ID 5B40B 5B2JC 1JFIA 3W99A 3REHB 3AZEC 5CPJD 4NE3A 5AV8D 1M19B 3REJB 3AZHC 4R8PB 3MNNB 2BYKB 3AZIA 4ZBJC 5E5AA 3X1VA 3AZJB 3C1CA 5AV6C 4WU9A 3WKJB 5B1LA 4X23C 3MGQD 5AVCC 1ID3A 3W96B 3REHD 4EO5C 4UPKA 1BH9B 3AZGC 1P3IB 2HUEC 1M19D 5F99A 2IO5B 5B0ZA 5GXQD 5G49B 1M18B 5AY8B 5GSUC 3WKJD 1P3PC 1EQZB 3VH6T 4J8XC 5B32A 5B2IA 3TU4A 2FJ7B 3UTAC 5DNNA 4QLCC 5CPJA 2UWXA 4ZUXC 5AV8A 1P3FD 5BNVB 5GT3D 3UT9B 1M18D 1P3KC 4YM6C 3B6FB 4KGCA 4XUJB 2W8SA 5B0YB 3KXBA 3UTBC 3A1KA 2FFFB 3O62D 4H9PA 3RELC 2PYOB 3MGQA 1HQ3A 4DRAA 4G92C 1KX4D 4J8UA 5KDMA 3AN2D 3AZKC 2AROB 2BYMA 3AZEB 3W99C 4Z2MH 3UT9D 5B1MB 1P3GD 5GXQA 3P5JB 3AZHB 3WAAB 4H9OA 5BS7A 5CPKB 1P3BB 4ZBJB 1P3LA 2YFVB 3NQJA 4WU8B 2F8NK 3X1UD 3AZIC 2HIOD 5E5AC 5AV6B 3X1VC 5FUGA 1R4VA 2Y2LA 4X23B 5AVCB 3AZMD 2DF4C 3AZFC 4WU9C 5B1LC 4J8VD 3LZ1B 1P34A 4KUDA 2HUEB 2G5HC 3AYWD 1P3FA 4XZQD 3AV1A 4LD9D 2F8NG 1PZRA 3WAAD 3LZ0B 5F99C 2LY8A 2ZM5A 4WU8D 1KU5A 3O62A 1WWIA 1P3PB 5BNXB 3AZND 3B6GD 5DNMA 1Z2CB 1B6WA 3UTAB 5B32C 3TU4C 3A6NB 5AVBB 5B24D 1P3OD 3LZ0D 5DNNC 1P3GA 5CPJC 4NE5A 1P3MA 1M1AB 2NQBC 3X1UA 2HIOA 4KGCC 3KXBC 2Y2QA 1U35D 4G92B 3AZMA 1AOIB 3C1BC 4J8VA 1HQ3C 5AVBD 2YFWA 4J8UC 1F66D 1ZLAD 3AYWA 1S32D 4XZQA 4LD9A 2G5IC 4JJNA 2JCHA 4H9QA 3AFAD 4H9SA 1TAFA 3VH5A 5AV5D 4Z66D 1M1AD 5GXQC 1P3AD 2F8ND 4YS3B 1P3LC 3B6GA 4J8WC 4UUZA 3R45A 3X1SD 3REIB 5GT0A 3IP4C 3NQUA 3AZFB 3X1TD 3MGPB 3EPHA 3AV2B 1KX5B 5B24A 5B33B 1P34C 4KUDC 3KUYD 3MVDC 3AV1C 4KHAA 4G91B 5JA4B 1U35A 3REID 1BH8A 4H9NA 3O62C 2L5AA 5CPIB 2NZDD 3TU4B 3W97D 3AV2D 1KX5D 5DNMC 1F66A 1ZLAA 3VH5W 1S32A 2JE5A 5DNNB 4Z5TB 3V9RA 2Y2IA 3AFAA 5AV5A 3MGSD 3MGRA 1N1JA 5BT1D 5CP6D 1P3AA 3WA9C 3LJAB 2NQBB 5B40D 1P3MC 3KXBB 3X1SA 1KX3B 5CPID 2HIOC 4CSRA 3C1BB 2CV5B 3REJD 1HQ3B 3AZMC 4R8PD 3MNND 4J8VC 5B31C 4WNNA 2Y2OA 4Z5TD 5JRGB 3KUYA 3AZJD 3W98B 4LD9C 1TZYA 5AV9C 4JJNC 3WTPC 3LJAD 3AZLC 3W96D 4H9SC 1HTAA 3EPKA 1KX3D 1P3LB 1P3ID 4J8WB 5BO0A 2J8PA
chains in the Genus database with same CATH topology
4HGAB 3LELC 3B6GC 2NZDA 3W97A 5GT0C 3A1IA 5AY8D 4CAYB 3W98D 3MGSA 3MVDB 1EQZD 5CP6A 3KSYA 2FJ7D 5B40A 3H0LC 3KWQC 4DQYB 3REKC 3REHA 5B2JB 1M19A 3REJA 4R8PA 3MNNA 2BYKA 3B6FD 4XUJD 5B0YD 3AZJA 3B0DC 3WKJA 4WZSB 2PYOD 2Y2MA 3W96A 3MGRC 3WA9B 3C1CC 4E45A 1P3MB 2AROD 1P3IA 4EO5B 4H9RB 3AZED 3AZGB 1ID3C 3X1SC 5B1MD 3AZHD 5GT3A 5CPKD 5G49A 1P3BD 3AL0C 1M18A 5AY8A 5B31B 2YFWB 5GSUB 5B0ZC 1EQZA 5AV6D 5AV9B 2FJ7A 4JJNB 3WTPB 3AZLB 4X23D 2DQNC 3H0RC 5AVCD 4J8XB 1TZYC 1KX4A 3AN2A 5B2IC 3LZ1D 3VH5T 4QLCB 3LELB 4ZUXB 4WJ3C 3H0MC 3UT9A 3NQUB 3B6FA 5AV8C 3W97C 1P3KB 5GSUD 4YM6B 3UTBB 1P3PD 2PYOA 3RELB 3REKB 5BT1C 3KWQB 5CP6C 3UTAD 2AROA 3A6ND 3MGQC 4QLCD 3AZEA 3AZKB 3REHC 5B1MA 1JFIB 3W99B 3AZHA 3WAAA 5CPKA 2XD1A 1P3BA 1M19C 4YM6D 2YFVA 4NE6A 4WU8A 3UTBD 5BS7C 5AV6A 3AZIB 4X23A 5E5AB 3AZNA 3X1VB 1AOID 3B0CW 3WKJC 3KFUG 3C1CB 4WU9B 3FDDA 3W96C 3LZ1A 5B1LB 1ID3B 2Y2NA 3W99D 4E44A 1P3OA 3LZ0A 3F6TA 4CSRB 1W2EA 5F99B 3WTPE 1P3FC 5GT3C 1M18C 5AY8C 5B0ZB 5BNXA 4YS3D 3X1VD 2F8NH 1EQZC 3UTAA 4WU9D 3AZFD 2RIQA 3A6NA 3MGPD 5AVBA 5B32B 5B2IB 1KX4C 3AN2C 5B33D 5BO0B 5F99D 5CPJB 5AV8B 4Z66A 1H3OA 1M1AA 3UT9C 1P3GC 2F8NA 3B6FC 4KGCB 1AOIA 4NFTA 3X1UC 2PYOC 3TU4D 4H9PB 3MGQB 3EPLA 4AWLC 3X1TA 2AROC 5KDMB 4J8UB 1A7WA 5DNND 2BYMB 3AYWC 5B1MC 4XZQC 3WAAC 5CPKC 1P3BC 2NQBD 2JSSA 5GXQB 4H9OB 4YS3A 4KGCD 3KXBD 4WU8C 3REIA 3NQJB 3C1BD 3AZFA 2CV5D 5C3IC 3AZNC 1HQ3D 3MGPA 5FUGB 3AV2A 1KX5A 4J8UD 5B33A 3LZ1C 5JRGD 3EG5B 5B24C 1P34B 4KUDB 1P3OC 3LZ0C 1P3FB 3AV1B 2ZY3A 5GT3B 5JA4A 1P3LD 4J8WD 2Y2HA 5B31G 5CPIA 3B0BA 2VQRA 3O62B 1U35C 1KX4B 5DNMB 3AN2B 3A6NC 5AVBC 4Z5TA 1P34D 1F66C 1ZLAC 4KUDD 1S32C 3MVDD 3AV1D 1P3GB 3LJAA 2NQBA 3B0CT 3AFAC 2RVQD 4Z66C 5AV5C 1M1AC 5B2JD 1KX3A 1P3AC 1BH9A 3C1BA 2CV5A 2CWEA 2ZY2A 3X1UB 2HIOB 1F1EA 1AOIC 1T3UA 5DNMD 4AWLB 3AZMB 4J8VB 5JRGA 3VH6A 3X1TC 3W98A 3AYWB 4XZQB 4LD9B 2Y2PA 3WA9D 3KUYC 4H9QB 1P3MD 1TAFB 4M6BA 4J8WA 3AZGD 4YS3C 5C3IB 3REIC 3AZNB 5BNVA 3B6GB 4UUZB 3R45B 5GT0B 4CAYA 5CHLB 5B31D 3MGPC 2NZDC 4DRBA 1ULYA 4XUJA 5B0YA 3AV2C 1KX5C 5B33C 3MVDA 5B24B 5AV9D 1P3OB 4JJND 3WTPD 3AZLD 4J8XD 3MGSC 4KHAB 5B2JA 4G91C 2Y2KA 5B40C 3LELD 4ZUXD 3VH6W 1U35B 5GT0D 5CPIC 1BH8B 2ZY4A 4H9NB 3REJC 1Q9CA 2Y2GA 1P3KD 4R8PC 3MNNC 1F66B 1ZLAB 2F2AC 1S32B 3B0DB 5B32G 4Z5TC 3WA9A 3AZJC 3RELD 5AVCA 3REKD 3V9RB 3AFAB 4Z66B 1H3OB 2ZY5A 5AV5B 3KWQD 3LJAC 3MGRB 1N1JB 4H9RA 3AZKD 1P3AB 3AZGA 2F8NB 1KX3C 1P3IC 2CV5C 3X1SB 5B31A 2IO5C 5GSUA 3X1TB 5AV9A 5JRGC 3WTPA 3AZID 3AZLA 4WNNB 5E5AD 1P3PA 3W98C 4J8XA 3MGRD 3KUYB 3C1CD 1TZYB 4WV4B 2XD5A 2FJ7C 5B1LD 4QLCA 3LELA 1ID3D 2BG1A 4ZUXA 3EPJA 4HGAC 1B67A 1P3KA 4YM6A 2NZDB 3W97B 5B0ZD 3UTBA 1WWSA 4XUJC 5B0YC 2Y2JA 3RELA 3REKA 1TZYD 3KWQA 3MGSB 4Z2MG 1BFMA 5CP6B 3AZKA 5B32D 2RVQC 5B2ID 5B40B 5B2JC 1JFIA 3W99A 3REHB 3AZEC 5CPJD 4NE3A 5AV8D 1M19B 3REJB 3AZHC 4R8PB 3MNNB 2BYKB 3AZIA 4ZBJC 5E5AA 3X1VA 3AZJB 3C1CA 5AV6C 4WU9A 3WKJB 5B1LA 4X23C 3MGQD 5AVCC 1ID3A 3W96B 3REHD 4EO5C 4UPKA 1BH9B 3AZGC 1P3IB 2HUEC 1M19D 5F99A 2IO5B 5B0ZA 5GXQD 5G49B 1M18B 5AY8B 5GSUC 3WKJD 1P3PC 1EQZB 3VH6T 4J8XC 5B32A 5B2IA 3TU4A 2FJ7B 3UTAC 5DNNA 4QLCC 5CPJA 2UWXA 4ZUXC 5AV8A 1P3FD 5BNVB 5GT3D 3UT9B 1M18D 1P3KC 4YM6C 3B6FB 4KGCA 4XUJB 2W8SA 5B0YB 3KXBA 3UTBC 3A1KA 2FFFB 3O62D 4H9PA 3RELC 2PYOB 3MGQA 1HQ3A 4DRAA 4G92C 1KX4D 4J8UA 5KDMA 3AN2D 3AZKC 2AROB 2BYMA 3AZEB 3W99C 4Z2MH 3UT9D 5B1MB 1P3GD 5GXQA 3P5JB 3AZHB 3WAAB 4H9OA 5BS7A 5CPKB 1P3BB 4ZBJB 1P3LA 2YFVB 3NQJA 4WU8B 2F8NK 3X1UD 3AZIC 2HIOD 5E5AC 5AV6B 3X1VC 5FUGA 1R4VA 2Y2LA 4X23B 5AVCB 3AZMD 2DF4C 3AZFC 4WU9C 5B1LC 4J8VD 3LZ1B 1P34A 4KUDA 2HUEB 2G5HC 3AYWD 1P3FA 4XZQD 3AV1A 4LD9D 2F8NG 1PZRA 3WAAD 3LZ0B 5F99C 2LY8A 2ZM5A 4WU8D 1KU5A 3O62A 1WWIA 1P3PB 5BNXB 3AZND 3B6GD 5DNMA 1Z2CB 1B6WA 3UTAB 5B32C 3TU4C 3A6NB 5AVBB 5B24D 1P3OD 3LZ0D 5DNNC 1P3GA 5CPJC 4NE5A 1P3MA 1M1AB 2NQBC 3X1UA 2HIOA 4KGCC 3KXBC 2Y2QA 1U35D 4G92B 3AZMA 1AOIB 3C1BC 4J8VA 1HQ3C 5AVBD 2YFWA 4J8UC 1F66D 1ZLAD 3AYWA 1S32D 4XZQA 4LD9A 2G5IC 4JJNA 2JCHA 4H9QA 3AFAD 4H9SA 1TAFA 3VH5A 5AV5D 4Z66D 1M1AD 5GXQC 1P3AD 2F8ND 4YS3B 1P3LC 3B6GA 4J8WC 4UUZA 3R45A 3X1SD 3REIB 5GT0A 3IP4C 3NQUA 3AZFB 3X1TD 3MGPB 3EPHA 3AV2B 1KX5B 5B24A 5B33B 1P34C 4KUDC 3KUYD 3MVDC 3AV1C 4KHAA 4G91B 5JA4B 1U35A 3REID 1BH8A 4H9NA 3O62C 2L5AA 5CPIB 2NZDD 3TU4B 3W97D 3AV2D 1KX5D 5DNMC 1F66A 1ZLAA 3VH5W 1S32A 2JE5A 5DNNB 4Z5TB 3V9RA 2Y2IA 3AFAA 5AV5A 3MGSD 3MGRA 1N1JA 5BT1D 5CP6D 1P3AA 3WA9C 3LJAB 2NQBB 5B40D 1P3MC 3KXBB 3X1SA 1KX3B 5CPID 2HIOC 4CSRA 3C1BB 2CV5B 3REJD 1HQ3B 3AZMC 4R8PD 3MNND 4J8VC 5B31C 4WNNA 2Y2OA 4Z5TD 5JRGB 3KUYA 3AZJD 3W98B 4LD9C 1TZYA 5AV9C 4JJNC 3WTPC 3LJAD 3AZLC 3W96D 4H9SC 1HTAA 3EPKA 1KX3D 1P3LB 1P3ID 4J8WB 5BO0A 2J8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA B;  3LEL C;  3B6G C;  2NZD A;  3W97 A;  5GT0 C;  5AY8 D;  4CAY B;  3W98 D;  3MGS A;  3MVD B;  1EQZ D;  5CP6 A;  3KSY A;  2FJ7 D;  5B40 A;  3REK C;  3KWQ C;  3REH A;  5B2J B;  1M19 A;  3REJ A;  4R8P A;  3MNN A;  2BYK A;  3B6F D;  4XUJ D;  5B0Y D;  3AZJ A;  3B0D C;  3WKJ A;  4WZS B;  2PYO D;  3W96 A;  3MGR C;  3WA9 B;  3C1C C;  4E45 A;  1P3M B;  2ARO D;  1P3I A;  4EO5 B;  4H9R B;  3AZE D;  3AZG B;  1ID3 C;  3X1S C;  5B1M D;  3AZH D;  5GT3 A;  5CPK D;  5G49 A;  1P3B D;  1M18 A;  5AY8 A;  5B31 B;  2YFW B;  5GSU B;  5B0Z C;  1EQZ A;  5AV6 D;  5AV9 B;  2FJ7 A;  4JJN B;  3WTP B;  3AZL B;  4X23 D;  5AVC D;  4J8X B;  1TZY C;  1KX4 A;  3AN2 A;  5B2I C;  3LZ1 D;  3VH5 T;  4QLC B;  3LEL B;  4ZUX B;  3UT9 A;  3NQU B;  3B6F A;  5AV8 C;  3W97 C;  1P3K B;  5GSU D;  4YM6 B;  3UTB B;  1P3P D;  2PYO A;  3REL B;  3REK B;  5BT1 C;  3KWQ B;  5CP6 C;  3UTA D;  2ARO A;  3A6N D;  3MGQ C;  4QLC D;  3AZE A;  3AZK B;  3REH C;  5B1M A;  1JFI B;  3W99 B;  3AZH A;  3WAA A;  5CPK A;  1P3B A;  1M19 C;  4YM6 D;  2YFV A;  4NE6 A;  4WU8 A;  3UTB D;  5BS7 C;  5AV6 A;  3AZI B;  4X23 A;  5E5A B;  3AZN A;  3X1V B;  1AOI D;  3B0C W;  3WKJ C;  3C1C B;  4WU9 B;  3W96 C;  3LZ1 A;  5B1L B;  1ID3 B;  3W99 D;  4E44 A;  1P3O A;  3LZ0 A;  4CSR B;  3WTP E;  5F99 B;  1P3F C;  5GT3 C;  1M18 C;  5AY8 C;  5B0Z B;  5BNX A;  4YS3 D;  3X1V D;  2F8N H;  1EQZ C;  3UTA A;  4WU9 D;  3AZF D;  3A6N A;  3MGP D;  5AVB A;  5B32 B;  5B2I B;  1KX4 C;  3AN2 C;  5B33 D;  5BO0 B;  5F99 D;  5CPJ B;  5AV8 B;  4Z66 A;  1H3O A;  1M1A A;  3UT9 C;  1P3G C;  2F8N A;  3B6F C;  4KGC B;  1AOI A;  4NFT A;  3X1U C;  2PYO C;  3TU4 D;  4H9P B;  3MGQ B;  4AWL C;  3X1T A;  2ARO C;  5KDM B;  4J8U B;  1A7W A;  5DNN D;  2BYM B;  3AYW C;  5B1M C;  4XZQ C;  3WAA C;  5CPK C;  1P3B C;  2NQB D;  2JSS A;  5GXQ B;  4H9O B;  4YS3 A;  4KGC D;  3KXB D;  4WU8 C;  3REI A;  3NQJ B;  3C1B D;  3AZF A;  2CV5 D;  5C3I C;  3AZN C;  1HQ3 D;  3MGP A;  5FUG B;  3AV2 A;  1KX5 A;  4J8U D;  5B33 A;  3LZ1 C;  5JRG D;  5B24 C;  1P34 B;  4KUD B;  1P3O C;  3LZ0 C;  1P3F B;  3AV1 B;  5GT3 B;  5JA4 A;  1P3L D;  4J8W D;  5B31 G;  5CPI A;  3B0B A;  3O62 B;  1U35 C;  1KX4 B;  5DNM B;  3AN2 B;  3A6N C;  5AVB C;  4Z5T A;  1P34 D;  1F66 C;  1ZLA C;  4KUD D;  1S32 C;  3MVD D;  3AV1 D;  1P3G B;  3LJA A;  2NQB A;  3B0C T;  3AFA C;  2RVQ D;  4Z66 C;  5AV5 C;  1M1A C;  5B2J D;  1KX3 A;  1P3A C;  1BH9 A;  3C1B A;  2CV5 A;  2CWE A;  3X1U B;  2HIO B;  1F1E A;  1AOI C;  5DNM D;  4AWL B;  3AZM B;  4J8V B;  5JRG A;  3VH6 A;  3X1T C;  3W98 A;  3AYW B;  4XZQ B;  4LD9 B;  3WA9 D;  3KUY C;  4H9Q B;  1P3M D;  1TAF B;  4M6B A;  4J8W A;  3AZG D;  4YS3 C;  5C3I B;  3REI C;  3AZN B;  5BNV A;  3B6G B;  4UUZ B;  3R45 B;  5GT0 B;  4CAY A;  5CHL B;  5B31 D;  3MGP C;  2NZD C;  4DRB A;  1ULY A;  4XUJ A;  5B0Y A;  3AV2 C;  1KX5 C;  5B33 C;  3MVD A;  5B24 B;  5AV9 D;  1P3O B;  4JJN D;  3WTP D;  3AZL D;  4J8X D;  3MGS C;  4KHA B;  5B2J A;  4G91 C;  5B40 C;  3LEL D;  4ZUX D;  3VH6 W;  1U35 B;  5GT0 D;  5CPI C;  1BH8 B;  4H9N B;  3REJ C;  1Q9C A;  1P3K D;  4R8P C;  3MNN C;  1F66 B;  1ZLA B;  1S32 B;  3B0D B;  5B32 G;  4Z5T C;  3WA9 A;  3AZJ C;  3REL D;  5AVC A;  3REK D;  3V9R B;  3AFA B;  4Z66 B;  1H3O B;  5AV5 B;  3KWQ D;  3MGR B;  3LJA C;  1N1J B;  4H9R A;  3AZK D;  1P3A B;  3AZG A;  2F8N B;  1KX3 C;  1P3I C;  2CV5 C;  3X1S B;  5B31 A;  2IO5 C;  5GSU A;  3X1T B;  5AV9 A;  5JRG C;  3WTP A;  3AZI D;  3AZL A;  4WNN B;  5E5A D;  1P3P A;  3W98 C;  4J8X A;  3MGR D;  3KUY B;  3C1C D;  1TZY B;  4WV4 B;  2FJ7 C;  5B1L D;  4QLC A;  3LEL A;  1ID3 D;  4ZUX A;  4HGA C;  1B67 A;  1P3K A;  4YM6 A;  2NZD B;  3W97 B;  5B0Z D;  3UTB A;  1WWS A;  4XUJ C;  5B0Y C;  3REL A;  3REK A;  1TZY D;  3KWQ A;  3MGS B;  4Z2M G;  1BFM A;  5CP6 B;  3AZK A;  5B32 D;  2RVQ C;  5B2I D;  5B40 B;  5B2J C;  1JFI A;  3W99 A;  3REH B;  3AZE C;  5CPJ D;  4NE3 A;  5AV8 D;  1M19 B;  3REJ B;  3AZH C;  4R8P B;  3MNN B;  2BYK B;  3AZI A;  4ZBJ C;  5E5A A;  3X1V A;  3AZJ B;  3C1C A;  5AV6 C;  4WU9 A;  3WKJ B;  5B1L A;  4X23 C;  3MGQ D;  5AVC C;  1ID3 A;  3W96 B;  3REH D;  4EO5 C;  1BH9 B;  3AZG C;  1P3I B;  2HUE C;  1M19 D;  5F99 A;  2IO5 B;  5B0Z A;  5GXQ D;  5G49 B;  1M18 B;  5AY8 B;  5GSU C;  3WKJ D;  1P3P C;  1EQZ B;  3VH6 T;  4J8X C;  5B32 A;  5B2I A;  3TU4 A;  2FJ7 B;  3UTA C;  5DNN A;  4QLC C;  5CPJ A;  4ZUX C;  5AV8 A;  1P3F D;  5BNV B;  5GT3 D;  3UT9 B;  1M18 D;  1P3K C;  4YM6 C;  3B6F B;  4KGC A;  4XUJ B;  5B0Y B;  3KXB A;  3UTB C;  3O62 D;  4H9P A;  3REL C;  2PYO B;  3MGQ A;  1HQ3 A;  4DRA A;  4G92 C;  1KX4 D;  4J8U A;  5KDM A;  3AN2 D;  3AZK C;  2ARO B;  2BYM A;  3AZE B;  3W99 C;  4Z2M H;  3UT9 D;  5B1M B;  1P3G D;  5GXQ A;  3AZH B;  3WAA B;  4H9O A;  5BS7 A;  5CPK B;  1P3B B;  4ZBJ B;  1P3L A;  2YFV B;  4WU8 B;  3NQJ A;  2F8N K;  3X1U D;  3AZI C;  2HIO D;  5E5A C;  5AV6 B;  3X1V C;  5FUG A;  1R4V A;  4X23 B;  5AVC B;  3AZM D;  3AZF C;  4WU9 C;  5B1L C;  4J8V D;  3LZ1 B;  1P34 A;  4KUD A;  2HUE B;  3AYW D;  1P3F A;  4XZQ D;  3AV1 A;  4LD9 D;  2F8N G;  3WAA D;  3LZ0 B;  5F99 C;  2LY8 A;  4WU8 D;  1KU5 A;  3O62 A;  1WWI A;  1P3P B;  5BNX B;  3AZN D;  3B6G D;  5DNM A;  1B6W A;  3UTA B;  5B32 C;  3TU4 C;  3A6N B;  5AVB B;  5B24 D;  1P3O D;  3LZ0 D;  5DNN C;  1P3G A;  5CPJ C;  4NE5 A;  1P3M A;  1M1A B;  2NQB C;  3X1U A;  2HIO A;  4KGC C;  3KXB C;  1U35 D;  4G92 B;  3AZM A;  1AOI B;  3C1B C;  4J8V A;  1HQ3 C;  5AVB D;  2YFW A;  4J8U C;  1F66 D;  1ZLA D;  3AYW A;  1S32 D;  4XZQ A;  4LD9 A;  4JJN A;  4H9Q A;  3AFA D;  4H9S A;  1TAF A;  3VH5 A;  5AV5 D;  4Z66 D;  1M1A D;  5GXQ C;  1P3A D;  2F8N D;  4YS3 B;  1P3L C;  3B6G A;  4J8W C;  4UUZ A;  3R45 A;  3X1S D;  3REI B;  5GT0 A;  3NQU A;  3AZF B;  3X1T D;  3MGP B;  3AV2 B;  1KX5 B;  5B24 A;  5B33 B;  1P34 C;  4KUD C;  3KUY D;  3MVD C;  3AV1 C;  4KHA A;  4G91 B;  5JA4 B;  1U35 A;  3REI D;  1BH8 A;  4H9N A;  3O62 C;  2L5A A;  5CPI B;  2NZD D;  3TU4 B;  3W97 D;  3AV2 D;  1KX5 D;  5DNM C;  1F66 A;  1ZLA A;  3VH5 W;  1S32 A;  5DNN B;  4Z5T B;  3V9R A;  3AFA A;  3MGS D;  5AV5 A;  3MGR A;  1N1J A;  5BT1 D;  5CP6 D;  1P3A A;  3WA9 C;  3LJA B;  2NQB B;  5B40 D;  1P3M C;  3KXB B;  3X1S A;  1KX3 B;  5CPI D;  2HIO C;  4CSR A;  3C1B B;  2CV5 B;  3REJ D;  1HQ3 B;  3AZM C;  4R8P D;  3MNN D;  4J8V C;  5B31 C;  4WNN A;  4Z5T D;  5JRG B;  3KUY A;  3AZJ D;  3W98 B;  4LD9 C;  1TZY A;  5AV9 C;  4JJN C;  3WTP C;  3LJA D;  3AZL C;  3W96 D;  4H9S C;  1HTA A;  1KX3 D;  1P3L B;  1P3I D;  4J8W B;  5BO0 A; 
#chains in the Genus database with same CATH topology
 4HGA B;  3LEL C;  3B6G C;  2NZD A;  3W97 A;  5GT0 C;  3A1I A;  5AY8 D;  4CAY B;  3W98 D;  3MGS A;  3MVD B;  1EQZ D;  5CP6 A;  3KSY A;  2FJ7 D;  5B40 A;  3H0L C;  3KWQ C;  4DQY B;  3REK C;  3REH A;  5B2J B;  1M19 A;  3REJ A;  4R8P A;  3MNN A;  2BYK A;  3B6F D;  4XUJ D;  5B0Y D;  3AZJ A;  3B0D C;  3WKJ A;  4WZS B;  2PYO D;  2Y2M A;  3W96 A;  3MGR C;  3WA9 B;  3C1C C;  4E45 A;  1P3M B;  2ARO D;  1P3I A;  4EO5 B;  4H9R B;  3AZE D;  3AZG B;  1ID3 C;  3X1S C;  5B1M D;  3AZH D;  5GT3 A;  5CPK D;  5G49 A;  1P3B D;  3AL0 C;  1M18 A;  5AY8 A;  5B31 B;  2YFW B;  5GSU B;  5B0Z C;  1EQZ A;  5AV6 D;  5AV9 B;  2FJ7 A;  4JJN B;  3WTP B;  3AZL B;  4X23 D;  2DQN C;  3H0R C;  5AVC D;  4J8X B;  1TZY C;  1KX4 A;  3AN2 A;  5B2I C;  3LZ1 D;  3VH5 T;  4QLC B;  3LEL B;  4ZUX B;  4WJ3 C;  3H0M C;  3UT9 A;  3NQU B;  3B6F A;  5AV8 C;  3W97 C;  1P3K B;  5GSU D;  4YM6 B;  3UTB B;  1P3P D;  2PYO A;  3REL B;  3REK B;  5BT1 C;  3KWQ B;  5CP6 C;  3UTA D;  2ARO A;  3A6N D;  3MGQ C;  4QLC D;  3AZE A;  3AZK B;  3REH C;  5B1M A;  1JFI B;  3W99 B;  3AZH A;  3WAA A;  5CPK A;  2XD1 A;  1P3B A;  1M19 C;  4YM6 D;  2YFV A;  4NE6 A;  4WU8 A;  3UTB D;  5BS7 C;  5AV6 A;  3AZI B;  4X23 A;  5E5A B;  3AZN A;  3X1V B;  1AOI D;  3B0C W;  3WKJ C;  3KFU G;  3C1C B;  4WU9 B;  3FDD A;  3W96 C;  3LZ1 A;  5B1L B;  1ID3 B;  2Y2N A;  3W99 D;  4E44 A;  1P3O A;  3LZ0 A;  3F6T A;  4CSR B;  1W2E A;  5F99 B;  3WTP E;  1P3F C;  5GT3 C;  1M18 C;  5AY8 C;  5B0Z B;  5BNX A;  4YS3 D;  3X1V D;  2F8N H;  1EQZ C;  3UTA A;  4WU9 D;  3AZF D;  2RIQ A;  3A6N A;  3MGP D;  5AVB A;  5B32 B;  5B2I B;  1KX4 C;  3AN2 C;  5B33 D;  5BO0 B;  5F99 D;  5CPJ B;  5AV8 B;  4Z66 A;  1H3O A;  1M1A A;  3UT9 C;  1P3G C;  2F8N A;  3B6F C;  4KGC B;  1AOI A;  4NFT A;  3X1U C;  2PYO C;  3TU4 D;  4H9P B;  3MGQ B;  3EPL A;  4AWL C;  3X1T A;  2ARO C;  5KDM B;  4J8U B;  1A7W A;  5DNN D;  2BYM B;  3AYW C;  5B1M C;  4XZQ C;  3WAA C;  5CPK C;  1P3B C;  2NQB D;  2JSS A;  5GXQ B;  4H9O B;  4YS3 A;  4KGC D;  3KXB D;  4WU8 C;  3REI A;  3NQJ B;  3C1B D;  3AZF A;  2CV5 D;  5C3I C;  3AZN C;  1HQ3 D;  3MGP A;  5FUG B;  3AV2 A;  1KX5 A;  4J8U D;  5B33 A;  3LZ1 C;  5JRG D;  3EG5 B;  5B24 C;  1P34 B;  4KUD B;  1P3O C;  3LZ0 C;  1P3F B;  3AV1 B;  2ZY3 A;  5GT3 B;  5JA4 A;  1P3L D;  4J8W D;  2Y2H A;  5B31 G;  5CPI A;  3B0B A;  2VQR A;  3O62 B;  1U35 C;  1KX4 B;  5DNM B;  3AN2 B;  3A6N C;  5AVB C;  4Z5T A;  1P34 D;  1F66 C;  1ZLA C;  4KUD D;  1S32 C;  3MVD D;  3AV1 D;  1P3G B;  3LJA A;  2NQB A;  3B0C T;  3AFA C;  2RVQ D;  4Z66 C;  5AV5 C;  1M1A C;  5B2J D;  1KX3 A;  1P3A C;  1BH9 A;  3C1B A;  2CV5 A;  2CWE A;  2ZY2 A;  3X1U B;  2HIO B;  1F1E A;  1AOI C;  1T3U A;  5DNM D;  4AWL B;  3AZM B;  4J8V B;  5JRG A;  3VH6 A;  3X1T C;  3W98 A;  3AYW B;  4XZQ B;  4LD9 B;  2Y2P A;  3WA9 D;  3KUY C;  4H9Q B;  1P3M D;  1TAF B;  4M6B A;  4J8W A;  3AZG D;  4YS3 C;  5C3I B;  3REI C;  3AZN B;  5BNV A;  3B6G B;  4UUZ B;  3R45 B;  5GT0 B;  4CAY A;  5CHL B;  5B31 D;  3MGP C;  2NZD C;  4DRB A;  1ULY A;  4XUJ A;  5B0Y A;  3AV2 C;  1KX5 C;  5B33 C;  3MVD A;  5B24 B;  5AV9 D;  1P3O B;  4JJN D;  3WTP D;  3AZL D;  4J8X D;  3MGS C;  4KHA B;  5B2J A;  4G91 C;  2Y2K A;  5B40 C;  3LEL D;  4ZUX D;  3VH6 W;  1U35 B;  5GT0 D;  5CPI C;  1BH8 B;  2ZY4 A;  4H9N B;  3REJ C;  1Q9C A;  2Y2G A;  1P3K D;  4R8P C;  3MNN C;  1F66 B;  1ZLA B;  2F2A C;  1S32 B;  3B0D B;  5B32 G;  4Z5T C;  3WA9 A;  3AZJ C;  3REL D;  5AVC A;  3REK D;  3V9R B;  3AFA B;  4Z66 B;  1H3O B;  2ZY5 A;  5AV5 B;  3KWQ D;  3LJA C;  3MGR B;  1N1J B;  4H9R A;  3AZK D;  1P3A B;  3AZG A;  2F8N B;  1KX3 C;  1P3I C;  2CV5 C;  3X1S B;  5B31 A;  2IO5 C;  5GSU A;  3X1T B;  5AV9 A;  5JRG C;  3WTP A;  3AZI D;  3AZL A;  4WNN B;  5E5A D;  1P3P A;  3W98 C;  4J8X A;  3MGR D;  3KUY B;  3C1C D;  1TZY B;  4WV4 B;  2XD5 A;  2FJ7 C;  5B1L D;  4QLC A;  3LEL A;  1ID3 D;  2BG1 A;  4ZUX A;  3EPJ A;  4HGA C;  1B67 A;  1P3K A;  4YM6 A;  2NZD B;  3W97 B;  5B0Z D;  3UTB A;  1WWS A;  4XUJ C;  5B0Y C;  2Y2J A;  3REL A;  3REK A;  1TZY D;  3KWQ A;  3MGS B;  4Z2M G;  1BFM A;  5CP6 B;  3AZK A;  5B32 D;  2RVQ C;  5B2I D;  5B40 B;  5B2J C;  1JFI A;  3W99 A;  3REH B;  3AZE C;  5CPJ D;  4NE3 A;  5AV8 D;  1M19 B;  3REJ B;  3AZH C;  4R8P B;  3MNN B;  2BYK B;  3AZI A;  4ZBJ C;  5E5A A;  3X1V A;  3AZJ B;  3C1C A;  5AV6 C;  4WU9 A;  3WKJ B;  5B1L A;  4X23 C;  3MGQ D;  5AVC C;  1ID3 A;  3W96 B;  3REH D;  4EO5 C;  4UPK A;  1BH9 B;  3AZG C;  1P3I B;  2HUE C;  1M19 D;  5F99 A;  2IO5 B;  5B0Z A;  5GXQ D;  5G49 B;  1M18 B;  5AY8 B;  5GSU C;  3WKJ D;  1P3P C;  1EQZ B;  3VH6 T;  4J8X C;  5B32 A;  5B2I A;  3TU4 A;  2FJ7 B;  3UTA C;  5DNN A;  4QLC C;  5CPJ A;  2UWX A;  4ZUX C;  5AV8 A;  1P3F D;  5BNV B;  5GT3 D;  3UT9 B;  1M18 D;  1P3K C;  4YM6 C;  3B6F B;  4KGC A;  4XUJ B;  2W8S A;  5B0Y B;  3KXB A;  3UTB C;  3A1K A;  2FFF B;  3O62 D;  4H9P A;  3REL C;  2PYO B;  3MGQ A;  1HQ3 A;  4DRA A;  4G92 C;  1KX4 D;  4J8U A;  5KDM A;  3AN2 D;  3AZK C;  2ARO B;  2BYM A;  3AZE B;  3W99 C;  4Z2M H;  3UT9 D;  5B1M B;  1P3G D;  5GXQ A;  3P5J B;  3AZH B;  3WAA B;  4H9O A;  5BS7 A;  5CPK B;  1P3B B;  4ZBJ B;  1P3L A;  2YFV B;  3NQJ A;  4WU8 B;  2F8N K;  3X1U D;  3AZI C;  2HIO D;  5E5A C;  5AV6 B;  3X1V C;  5FUG A;  1R4V A;  2Y2L A;  4X23 B;  5AVC B;  3AZM D;  2DF4 C;  3AZF C;  4WU9 C;  5B1L C;  4J8V D;  3LZ1 B;  1P34 A;  4KUD A;  2HUE B;  2G5H C;  3AYW D;  1P3F A;  4XZQ D;  3AV1 A;  4LD9 D;  2F8N G;  1PZR A;  3WAA D;  3LZ0 B;  5F99 C;  2LY8 A;  2ZM5 A;  4WU8 D;  1KU5 A;  3O62 A;  1WWI A;  1P3P B;  5BNX B;  3AZN D;  3B6G D;  5DNM A;  1Z2C B;  1B6W A;  3UTA B;  5B32 C;  3TU4 C;  3A6N B;  5AVB B;  5B24 D;  1P3O D;  3LZ0 D;  5DNN C;  1P3G A;  5CPJ C;  4NE5 A;  1P3M A;  1M1A B;  2NQB C;  3X1U A;  2HIO A;  4KGC C;  3KXB C;  2Y2Q A;  1U35 D;  4G92 B;  3AZM A;  1AOI B;  3C1B C;  4J8V A;  1HQ3 C;  5AVB D;  2YFW A;  4J8U C;  1F66 D;  1ZLA D;  3AYW A;  1S32 D;  4XZQ A;  4LD9 A;  2G5I C;  4JJN A;  2JCH A;  4H9Q A;  3AFA D;  4H9S A;  1TAF A;  3VH5 A;  5AV5 D;  4Z66 D;  1M1A D;  5GXQ C;  1P3A D;  2F8N D;  4YS3 B;  1P3L C;  3B6G A;  4J8W C;  4UUZ A;  3R45 A;  3X1S D;  3REI B;  5GT0 A;  3IP4 C;  3NQU A;  3AZF B;  3X1T D;  3MGP B;  3EPH A;  3AV2 B;  1KX5 B;  5B24 A;  5B33 B;  1P34 C;  4KUD C;  3KUY D;  3MVD C;  3AV1 C;  4KHA A;  4G91 B;  5JA4 B;  1U35 A;  3REI D;  1BH8 A;  4H9N A;  3O62 C;  2L5A A;  5CPI B;  2NZD D;  3TU4 B;  3W97 D;  3AV2 D;  1KX5 D;  5DNM C;  1F66 A;  1ZLA A;  3VH5 W;  1S32 A;  2JE5 A;  5DNN B;  4Z5T B;  3V9R A;  2Y2I A;  3AFA A;  5AV5 A;  3MGS D;  3MGR A;  1N1J A;  5BT1 D;  5CP6 D;  1P3A A;  3WA9 C;  3LJA B;  2NQB B;  5B40 D;  1P3M C;  3KXB B;  3X1S A;  1KX3 B;  5CPI D;  2HIO C;  4CSR A;  3C1B B;  2CV5 B;  3REJ D;  1HQ3 B;  3AZM C;  4R8P D;  3MNN D;  4J8V C;  5B31 C;  4WNN A;  2Y2O A;  4Z5T D;  5JRG B;  3KUY A;  3AZJ D;  3W98 B;  4LD9 C;  1TZY A;  5AV9 C;  4JJN C;  3WTP C;  3LJA D;  3AZL C;  3W96 D;  4H9S C;  1HTA A;  3EPK A;  1KX3 D;  1P3L B;  1P3I D;  4J8W B;  5BO0 A;  2J8P A; 
#chains in the Genus database with same CATH homology
 4HGA B;  3LEL C;  3B6G C;  2NZD A;  3W97 A;  5GT0 C;  3A1I A;  5AY8 D;  4CAY B;  3W98 D;  3MGS A;  3MVD B;  1EQZ D;  5CP6 A;  3KSY A;  2FJ7 D;  5B40 A;  3H0L C;  3KWQ C;  4DQY B;  3REK C;  3REH A;  5B2J B;  1M19 A;  3REJ A;  4R8P A;  3MNN A;  2BYK A;  3B6F D;  4XUJ D;  5B0Y D;  3AZJ A;  3B0D C;  3WKJ A;  4WZS B;  2PYO D;  2Y2M A;  3W96 A;  3MGR C;  3WA9 B;  3C1C C;  4E45 A;  1P3M B;  2ARO D;  1P3I A;  4EO5 B;  4H9R B;  3AZE D;  3AZG B;  1ID3 C;  3X1S C;  5B1M D;  3AZH D;  5GT3 A;  5CPK D;  5G49 A;  1P3B D;  3AL0 C;  1M18 A;  5AY8 A;  5B31 B;  2YFW B;  5GSU B;  5B0Z C;  1EQZ A;  5AV6 D;  5AV9 B;  2FJ7 A;  4JJN B;  3WTP B;  3AZL B;  4X23 D;  2DQN C;  3H0R C;  5AVC D;  4J8X B;  1TZY C;  1KX4 A;  3AN2 A;  5B2I C;  3LZ1 D;  3VH5 T;  4QLC B;  3LEL B;  4ZUX B;  4WJ3 C;  3H0M C;  3UT9 A;  3NQU B;  3B6F A;  5AV8 C;  3W97 C;  1P3K B;  5GSU D;  4YM6 B;  3UTB B;  1P3P D;  2PYO A;  3REL B;  3REK B;  5BT1 C;  3KWQ B;  5CP6 C;  3UTA D;  2ARO A;  3A6N D;  3MGQ C;  4QLC D;  3AZE A;  3AZK B;  3REH C;  5B1M A;  1JFI B;  3W99 B;  3AZH A;  3WAA A;  5CPK A;  2XD1 A;  1P3B A;  1M19 C;  4YM6 D;  2YFV A;  4NE6 A;  4WU8 A;  3UTB D;  5BS7 C;  5AV6 A;  3AZI B;  4X23 A;  5E5A B;  3AZN A;  3X1V B;  1AOI D;  3B0C W;  3WKJ C;  3KFU G;  3C1C B;  4WU9 B;  3FDD A;  3W96 C;  3LZ1 A;  5B1L B;  1ID3 B;  2Y2N A;  3W99 D;  4E44 A;  1P3O A;  3LZ0 A;  3F6T A;  4CSR B;  1W2E A;  5F99 B;  3WTP E;  1P3F C;  5GT3 C;  1M18 C;  5AY8 C;  5B0Z B;  5BNX A;  4YS3 D;  3X1V D;  2F8N H;  1EQZ C;  3UTA A;  4WU9 D;  3AZF D;  2RIQ A;  3A6N A;  3MGP D;  5AVB A;  5B32 B;  5B2I B;  1KX4 C;  3AN2 C;  5B33 D;  5BO0 B;  5F99 D;  5CPJ B;  5AV8 B;  4Z66 A;  1H3O A;  1M1A A;  3UT9 C;  1P3G C;  2F8N A;  3B6F C;  4KGC B;  1AOI A;  4NFT A;  3X1U C;  2PYO C;  3TU4 D;  4H9P B;  3MGQ B;  3EPL A;  4AWL C;  3X1T A;  2ARO C;  5KDM B;  4J8U B;  1A7W A;  5DNN D;  2BYM B;  3AYW C;  5B1M C;  4XZQ C;  3WAA C;  5CPK C;  1P3B C;  2NQB D;  2JSS A;  5GXQ B;  4H9O B;  4YS3 A;  4KGC D;  3KXB D;  4WU8 C;  3REI A;  3NQJ B;  3C1B D;  3AZF A;  2CV5 D;  5C3I C;  3AZN C;  1HQ3 D;  3MGP A;  5FUG B;  3AV2 A;  1KX5 A;  4J8U D;  5B33 A;  3LZ1 C;  5JRG D;  3EG5 B;  5B24 C;  1P34 B;  4KUD B;  1P3O C;  3LZ0 C;  1P3F B;  3AV1 B;  2ZY3 A;  5GT3 B;  5JA4 A;  1P3L D;  4J8W D;  2Y2H A;  5B31 G;  5CPI A;  3B0B A;  2VQR A;  3O62 B;  1U35 C;  1KX4 B;  5DNM B;  3AN2 B;  3A6N C;  5AVB C;  4Z5T A;  1P34 D;  1F66 C;  1ZLA C;  4KUD D;  1S32 C;  3MVD D;  3AV1 D;  1P3G B;  3LJA A;  2NQB A;  3B0C T;  3AFA C;  2RVQ D;  4Z66 C;  5AV5 C;  1M1A C;  5B2J D;  1KX3 A;  1P3A C;  1BH9 A;  3C1B A;  2CV5 A;  2CWE A;  2ZY2 A;  3X1U B;  2HIO B;  1F1E A;  1AOI C;  1T3U A;  5DNM D;  4AWL B;  3AZM B;  4J8V B;  5JRG A;  3VH6 A;  3X1T C;  3W98 A;  3AYW B;  4XZQ B;  4LD9 B;  2Y2P A;  3WA9 D;  3KUY C;  4H9Q B;  1P3M D;  1TAF B;  4M6B A;  4J8W A;  3AZG D;  4YS3 C;  5C3I B;  3REI C;  3AZN B;  5BNV A;  3B6G B;  4UUZ B;  3R45 B;  5GT0 B;  4CAY A;  5CHL B;  5B31 D;  3MGP C;  2NZD C;  4DRB A;  1ULY A;  4XUJ A;  5B0Y A;  3AV2 C;  1KX5 C;  5B33 C;  3MVD A;  5B24 B;  5AV9 D;  1P3O B;  4JJN D;  3WTP D;  3AZL D;  4J8X D;  3MGS C;  4KHA B;  5B2J A;  4G91 C;  2Y2K A;  5B40 C;  3LEL D;  4ZUX D;  3VH6 W;  1U35 B;  5GT0 D;  5CPI C;  1BH8 B;  2ZY4 A;  4H9N B;  3REJ C;  1Q9C A;  2Y2G A;  1P3K D;  4R8P C;  3MNN C;  1F66 B;  1ZLA B;  2F2A C;  1S32 B;  3B0D B;  5B32 G;  4Z5T C;  3WA9 A;  3AZJ C;  3REL D;  5AVC A;  3REK D;  3V9R B;  3AFA B;  4Z66 B;  1H3O B;  2ZY5 A;  5AV5 B;  3KWQ D;  3LJA C;  3MGR B;  1N1J B;  4H9R A;  3AZK D;  1P3A B;  3AZG A;  2F8N B;  1KX3 C;  1P3I C;  2CV5 C;  3X1S B;  5B31 A;  2IO5 C;  5GSU A;  3X1T B;  5AV9 A;  5JRG C;  3WTP A;  3AZI D;  3AZL A;  4WNN B;  5E5A D;  1P3P A;  3W98 C;  4J8X A;  3MGR D;  3KUY B;  3C1C D;  1TZY B;  4WV4 B;  2XD5 A;  2FJ7 C;  5B1L D;  4QLC A;  3LEL A;  1ID3 D;  2BG1 A;  4ZUX A;  3EPJ A;  4HGA C;  1B67 A;  1P3K A;  4YM6 A;  2NZD B;  3W97 B;  5B0Z D;  3UTB A;  1WWS A;  4XUJ C;  5B0Y C;  2Y2J A;  3REL A;  3REK A;  1TZY D;  3KWQ A;  3MGS B;  4Z2M G;  1BFM A;  5CP6 B;  3AZK A;  5B32 D;  2RVQ C;  5B2I D;  5B40 B;  5B2J C;  1JFI A;  3W99 A;  3REH B;  3AZE C;  5CPJ D;  4NE3 A;  5AV8 D;  1M19 B;  3REJ B;  3AZH C;  4R8P B;  3MNN B;  2BYK B;  3AZI A;  4ZBJ C;  5E5A A;  3X1V A;  3AZJ B;  3C1C A;  5AV6 C;  4WU9 A;  3WKJ B;  5B1L A;  4X23 C;  3MGQ D;  5AVC C;  1ID3 A;  3W96 B;  3REH D;  4EO5 C;  4UPK A;  1BH9 B;  3AZG C;  1P3I B;  2HUE C;  1M19 D;  5F99 A;  2IO5 B;  5B0Z A;  5GXQ D;  5G49 B;  1M18 B;  5AY8 B;  5GSU C;  3WKJ D;  1P3P C;  1EQZ B;  3VH6 T;  4J8X C;  5B32 A;  5B2I A;  3TU4 A;  2FJ7 B;  3UTA C;  5DNN A;  4QLC C;  5CPJ A;  2UWX A;  4ZUX C;  5AV8 A;  1P3F D;  5BNV B;  5GT3 D;  3UT9 B;  1M18 D;  1P3K C;  4YM6 C;  3B6F B;  4KGC A;  4XUJ B;  2W8S A;  5B0Y B;  3KXB A;  3UTB C;  3A1K A;  2FFF B;  3O62 D;  4H9P A;  3REL C;  2PYO B;  3MGQ A;  1HQ3 A;  4DRA A;  4G92 C;  1KX4 D;  4J8U A;  5KDM A;  3AN2 D;  3AZK C;  2ARO B;  2BYM A;  3AZE B;  3W99 C;  4Z2M H;  3UT9 D;  5B1M B;  1P3G D;  5GXQ A;  3P5J B;  3AZH B;  3WAA B;  4H9O A;  5BS7 A;  5CPK B;  1P3B B;  4ZBJ B;  1P3L A;  2YFV B;  3NQJ A;  4WU8 B;  2F8N K;  3X1U D;  3AZI C;  2HIO D;  5E5A C;  5AV6 B;  3X1V C;  5FUG A;  1R4V A;  2Y2L A;  4X23 B;  5AVC B;  3AZM D;  2DF4 C;  3AZF C;  4WU9 C;  5B1L C;  4J8V D;  3LZ1 B;  1P34 A;  4KUD A;  2HUE B;  2G5H C;  3AYW D;  1P3F A;  4XZQ D;  3AV1 A;  4LD9 D;  2F8N G;  1PZR A;  3WAA D;  3LZ0 B;  5F99 C;  2LY8 A;  2ZM5 A;  4WU8 D;  1KU5 A;  3O62 A;  1WWI A;  1P3P B;  5BNX B;  3AZN D;  3B6G D;  5DNM A;  1Z2C B;  1B6W A;  3UTA B;  5B32 C;  3TU4 C;  3A6N B;  5AVB B;  5B24 D;  1P3O D;  3LZ0 D;  5DNN C;  1P3G A;  5CPJ C;  4NE5 A;  1P3M A;  1M1A B;  2NQB C;  3X1U A;  2HIO A;  4KGC C;  3KXB C;  2Y2Q A;  1U35 D;  4G92 B;  3AZM A;  1AOI B;  3C1B C;  4J8V A;  1HQ3 C;  5AVB D;  2YFW A;  4J8U C;  1F66 D;  1ZLA D;  3AYW A;  1S32 D;  4XZQ A;  4LD9 A;  2G5I C;  4JJN A;  2JCH A;  4H9Q A;  3AFA D;  4H9S A;  1TAF A;  3VH5 A;  5AV5 D;  4Z66 D;  1M1A D;  5GXQ C;  1P3A D;  2F8N D;  4YS3 B;  1P3L C;  3B6G A;  4J8W C;  4UUZ A;  3R45 A;  3X1S D;  3REI B;  5GT0 A;  3IP4 C;  3NQU A;  3AZF B;  3X1T D;  3MGP B;  3EPH A;  3AV2 B;  1KX5 B;  5B24 A;  5B33 B;  1P34 C;  4KUD C;  3KUY D;  3MVD C;  3AV1 C;  4KHA A;  4G91 B;  5JA4 B;  1U35 A;  3REI D;  1BH8 A;  4H9N A;  3O62 C;  2L5A A;  5CPI B;  2NZD D;  3TU4 B;  3W97 D;  3AV2 D;  1KX5 D;  5DNM C;  1F66 A;  1ZLA A;  3VH5 W;  1S32 A;  2JE5 A;  5DNN B;  4Z5T B;  3V9R A;  2Y2I A;  3AFA A;  5AV5 A;  3MGS D;  3MGR A;  1N1J A;  5BT1 D;  5CP6 D;  1P3A A;  3WA9 C;  3LJA B;  2NQB B;  5B40 D;  1P3M C;  3KXB B;  3X1S A;  1KX3 B;  5CPI D;  2HIO C;  4CSR A;  3C1B B;  2CV5 B;  3REJ D;  1HQ3 B;  3AZM C;  4R8P D;  3MNN D;  4J8V C;  5B31 C;  4WNN A;  2Y2O A;  4Z5T D;  5JRG B;  3KUY A;  3AZJ D;  3W98 B;  4LD9 C;  1TZY A;  5AV9 C;  4JJN C;  3WTP C;  3LJA D;  3AZL C;  3W96 D;  4H9S C;  1HTA A;  3EPK A;  1KX3 D;  1P3L B;  1P3I D;  4J8W B;  5BO0 A;  2J8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...