4Z66A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 97
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66A00
4J8WB 3WA9D 3AZLD 3KWQA 4G92C 4E44A 5B2JA 3MGPB 1P3GA 3AZHC 5AV6B 3RELC 5E5AC 5AY8D 3AZNA 1P3LB 1KX3A 1P3KB 5CPKB 3X1TA 4ZUXA 4WU9B 5AV9A 3LZ0C 5B32B 3WTPC 1WWSA 1P3AA 3WKJD 3KXBD 3KSYA 2CWEA 2F8NK 3WAAC 4H9PA 4JJNC 2PYOD 3W96D 4WU8A 5GT0A 3LELD 3MGSA 3AV2B 1TZYA 4LD9C 2NQBD 3REJD 4R8PD 1H3OA 1M18A 3W99D 5AVBD 4J8XB 5GSUD 5B1MB 3B0CT 1ZLAB 3KWQD 4XUJC 5B1LA 1TAFA 5G49A 1P3MC 3B6GA 5B2JB 3C1CC 1P3GB 3REIA 3AZJC 3AZFA 5B0ZD 3AZNB 3AV1A 1KX3B 3TU4C 3AZEA 3UT9A 4QLCC 3VH6W 1P3IC 2FJ7C 5F99D 4ZUXB 3X1TB 3V9RA 3KUYA 5AV9B 1M19C 4Z66D 4G91B 3WTPB 3AZKD 2CV5A 1P3AB 2HUEB 1EQZC 3AZMA 5CPIA 3X1VA 5BT1C 3AYWD 5DNNA 3X1UA 3C1BA 4WU8B 3AFAD 5GT0B 1P3OD 3MGSB 4LD9B 1TZYB 1HQ3D 5AVCC 1H3OB 1S32C 3MGRA 4J8UC 1P3BD 1M18B 5B33D 5JRGD 3LZ1C 4J8VC 3W98A 5AV8D 4KGCD 1KX5C 5B1LB 1TAFB 5G49B 3B6GB 3REIB 3AZFB 1U35A 4WV4B 3AZGD 4CSRB 3MGQD 3AZEB 3AV1B 5FUGA 3A6NC 3UT9B 2NZDA 1P34C 3O62A 3V9RB 3KUYB 2HIOC 5KDMA 3B6FA 4KUDC 4Z5TC 3REHC 2CV5B 3AZMB 5CPIB 3W97A 3X1VB 2LY8A 3C1BB 5GT3A 5CPJD 5B0YD 5AV5D 3AZID 1F66D 1BH9A 3WA9A 3AZLA 3MGPC 2IO5B 3VH6T 3MGRB 1P3FD 5AV6C 1P3LC 5C3IB 1P3KC 5AY8A 5CPKC 1HTAA 5GXQD 3W98B 5B31D 4XZQD 4H9SA 3MVDD 4WU9C 5B32C 5CP6D 3B0CW 3WKJA 3KXBA 1N1JA 1U35B 5B31G 3A6NB 3W96A 5FUGB 2PYOA 3LELA 3AV2C 2NZDB 1ULYA 3O62B 3UTBD 1AOID 5KDMB 2NQBA 4H9RA 3REJA 3B6FB 4R8PA 4J8XC 1F1EA 3W97B 3B0BA 5AVBA 5B1MC 3W99A 1P3PD 5GT3B 5GSUA 1ZLAC 2AROD 1BH9B 2L5AA 3KWQC 3WA9B 2BYMA 5B2JC 1P3GC 4WZSB 5BNXA 3AN2D 5B0ZA 3AZNC 1KX3C 5B2ID 5AY8B 3UTAD 3X1TC 4ZUXC 5AV9C 5F99A 4G91C 5B40D 1KX4D 1P3AC 2HUEC 4Z66A 4YM6D 3AZKA 3NQUA 3WKJB 4HGAB 3KXBB 1N1JB 2F8NH 3AYWA 4X23D 4YS3D 4WU8C 5GT0C 3W96B 3MGSC 3AFAA 3LELB 1TZYC 3LJAD 1P3OA 1M18C 1HQ3A 2YFVB 4H9RB 3REJB 4R8PB 2NQBB 1P3BA 5B33A 5JRGA 5AVBB 5BS7A 3W99B 3MNND 3REKD 5GSUB 1B6WA 3KWQB 4WNNA 5AV8A 4KGCA 5B1LC 2BYMB 3B6GC 3REIC 3AZFC 5BNXB 1M1AA 5DNMD 1ID3D 5B0ZB 5CHLB 3AV1C 3AZEC 3UT9C 3AZGA 3MGQA 3KUYC 5F99B 5B24D 2CV5C 3X1SA 4Z66B 4UUZA 3AZMC 5CPIC 3AZKB 3NQUB 3X1VC 4H9PB 5DNNC 3X1UC 3C1BC 2JSSA 3AYWB 5B0YA 3AZIA 5CPJA 5AV5A 1F66A 3AZHD 3RELD 5E5AD 3AFAB 1P3OB 2YFWA 2IO5C 3MGRC 1HQ3B 1P3BB 1P3FA 3WTPE 5C3IC 3LZ0D 5B33B 5JRGB 3B0DC 3W98C 5GXQA 4NFTA 3WAAD 5B31A 4XZQA 3MVDA 5AV8B 4JJND 4KGCB 5CP6A 1M1AD 1BH8A 4DRAA 1U35C 1B67A 1R4VA 3AZGB 4H9NA 3MGQB 2NZDC 3O62C 3X1SD 3B6FC 3UTBA 1AOIA 4AWLB 4UUZB 3W97C 4XUJD 5DNNB 3X1UB 1WWIA 5GT3C 1P3MD 2RVQC 3C1CD 3AZJD 5B0YB 3AZIB 5CPJB 5AV5B 1P3PA 1F66B 2AROA 3WA9C 3AZLC 3TU4D 4QLCD 2YFWB 1P3ID 2FJ7D 5JA4A 1P3FB 1M19D 3AN2A 3R45A 3B0DB 5AY8C 4KHAA 1EQZD 5B2IA 3UTAA 4H9SC 5GXQB 5BT1D 4XZQB 5B31B 3MVDB 4M6BA 4H9OA 5CP6B 5B40A 1KX4A 3WKJC 4YM6A 1BH8B 4HGAC 3KXBC 4J8WA 5AVCD 3VH5A 1S32D 4J8UD 3W96C 4X23A 4YS3A 2PYOC 3LELC 4H9NB 3LJAA 3LZ1D 4J8VD 3REJC 3UTBB 4R8PC 1AOIB 2NQBC 4H9QA 1JFIA 1KX5D 3W99C 5AVBC 4NE6A 5GSUC 3MNNA 3REKA 1P3PB 2AROB 3AZLB 3A6ND 1P34D 5JA4B 2BYKA 5B0ZC 2HIOD 4KUDD 1Q9CA 3AN2B 4Z5TD 5DNMA 1ID3A 3REHD 3R45B 5B2IB 2F8ND 3UTAB 5F99C 4H9OB 4Z66C 5B24A 4J8WD 1BFMA 3AZKC 5B40B 1KX4B 4YM6B 3MGPD 3AYWC 2F8NG 2PYOB 5AV6D 4X23B 4YS3B 3AFAC 1P3LD 3AZHA 1P3OC 3RELA 1P3KD 5E5AA 5CPKD 3LJAB 4ZBJC 1HQ3C 4WU9D 1P3BC 4CAYA 4H9QB 5B32D 5B33C 1JFIB 5JRGC 5BS7C 3LZ0A 5BO0A 3WTPA 3MNNB 3REKB 5AV8C 4KGCC 3WAAA 3VH5W 4JJNA 5B32G 3AV2D 1M1AC 2BYKB 4LD9A 4DRBA 5DNMB 1ID3B 4EO5C 3AZGC 3MGQC 4J8XD 5B1MD 1ZLAD 4AWLC 3X1SC 5B24B 4Z2MH 4XUJA 5B2JD 4G92B 1P3GD 5B0YC 3AZIC 5CPJC 5AV5C 1P3MA 4Z2MG 3C1CA 1F66C 3AZJA 3AZND 1KX3D 3AZHB 3RELB 5E5AB 4ZBJB 3TU4A 3X1TD 4CSRA 4QLCA 4ZUXD 1P3IA 2FJ7A 5AV9D 4CAYB 1P3FC 3WTPD 1P3AD 1M19A 3LZ0B 5BO0B 1EQZA 5GXQC 4WNNB 4XZQC 5B31C 3MVDC 3WAAB 1KU5A 5CP6C 5GT0D 4WU8D 4JJNB 3MGSD 1M1AB 4LD9D 1TZYD 1M18D 5AVCA 4EO5B 1S32A 4J8UA 3UTBC 1AOIC 3X1SB 3LZ1A 4J8VA 1A7WA 3NQJA 5B1LD 1KX5A 3B6GD 4XUJB 3VH5T 3REID 3AZFD 1P3MB 1P3PC 3C1CB 2AROC 3AZJB 3AV1D 3AZED 4NE5A 3UT9D 3TU4B 4QLCB 3A6NA 1P3IB 3KUYD 2FJ7B 1P34A 3AN2C 2CV5D 2HIOA 5BNVA 1M19B 4KUDA 3AZMD 4Z5TA 5CPID 3REHA 5B2IC 3UTAC 3X1VD 1EQZB 5DNND 3X1UD 3C1BD 2F8NA 4NE3A 5B40C 1KX4C 4YM6C 4J8WC 3MGRD 5AVCB 3MGPA 4X23C 1S32B 4YS3C 4J8UB 5AV6A 1P3LA 3LJAC 1P3KA 3W98D 5CPKA 3LZ1B 4J8VB 4WU9A 3NQJB 5B32A 1KX5B 3MNNC 3REKC 1U35D 2NZDD 3O62D 3AV2A 1P34B 3B6FD 5DNMC 1ID3C 4KHAB 2HIOB 5BNVB 4KUDB 4E45A 4Z5TB 2YFVA 3VH6A 3REHB 3W97D 4J8XA 5GT3D 2F8NB 5B1MA 2RVQD 5B24C 1ZLAA
chains in the Genus database with same CATH superfamily
4J8WB 3WA9D 3AZLD 3KWQA 4G92C 2DQNC 4E44A 5B2JA 3MGPB 1P3GA 2ZY4A 3AZHC 5AV6B 3RELC 5E5AC 5AY8D 3EPJA 3AZNA 1P3LB 1KX3A 1P3KB 5CPKB 3X1TA 4ZUXA 4WU9B 5AV9A 2J8PA 3LZ0C 5B32B 3WTPC 1WWSA 1P3AA 3WKJD 3KXBD 2Y2QA 3KSYA 2CWEA 2F8NK 3WAAC 4H9PA 4JJNC 2PYOD 3W96D 4WU8A 5GT0A 3LELD 3MGSA 3AV2B 1TZYA 4LD9C 2NQBD 3REJD 4R8PD 1H3OA 1M18A 3W99D 5AVBD 4J8XB 5GSUD 5B1MB 3B0CT 1ZLAB 3KWQD 4XUJC 5B1LA 1TAFA 5G49A 1P3MC 3B6GA 5B2JB 3C1CC 1P3GB 3REIA 3AZJC 3AZFA 5B0ZD 3AZNB 3AV1A 1KX3B 3TU4C 3AZEA 3UT9A 4QLCC 3VH6W 1P3IC 2FJ7C 5F99D 4ZUXB 3X1TB 3V9RA 3KUYA 5AV9B 1M19C 4Z66D 4G91B 3WTPB 3AZKD 2CV5A 1P3AB 2HUEB 1EQZC 3AZMA 5CPIA 3X1VA 5BT1C 3AYWD 5DNNA 3X1UA 3C1BA 4WU8B 3AFAD 5GT0B 1P3OD 3MGSB 4LD9B 1TZYB 1HQ3D 5AVCC 1H3OB 1S32C 3MGRA 4J8UC 1P3BD 1M18B 5B33D 5JRGD 3LZ1C 4J8VC 3W98A 5AV8D 4KGCD 1KX5C 4UPKA 5B1LB 1TAFB 5G49B 3B6GB 3REIB 3AZFB 1U35A 2VQRA 4WV4B 3AZGD 4CSRB 3MGQD 3AZEB 3AV1B 5FUGA 3A6NC 3UT9B 2NZDA 1P34C 3O62A 3V9RB 3KUYB 2HIOC 5KDMA 3B6FA 4KUDC 4Z5TC 3REHC 2CV5B 3AZMB 5CPIB 3W97A 3X1VB 2LY8A 3C1BB 5GT3A 5CPJD 5B0YD 5AV5D 3AZID 1F66D 1BH9A 3WA9A 3AZLA 3MGPC 2IO5B 3VH6T 3MGRB 1P3FD 5AV6C 1P3LC 5C3IB 1P3KC 5AY8A 5CPKC 1HTAA 5GXQD 3W98B 5B31D 4XZQD 4H9SA 3MVDD 4WU9C 5B32C 5CP6D 1PZRA 3B0CW 2Y2GA 3EG5B 3WKJA 2Y2IA 3KXBA 1N1JA 1U35B 5B31G 3A6NB 3W96A 5FUGB 2PYOA 3LELA 3AV2C 2NZDB 1ULYA 3O62B 3UTBD 1AOID 5KDMB 2NQBA 4H9RA 3REJA 3B6FB 4R8PA 4J8XC 1F1EA 3W97B 3B0BA 5AVBA 5B1MC 3W99A 1P3PD 5GT3B 5GSUA 1ZLAC 2AROD 1BH9B 2L5AA 2G5HC 1T3UA 2Y2HA 3KWQC 3WA9B 2BYMA 5B2JC 3P5JB 1P3GC 4WZSB 5BNXA 3AN2D 2ZY5A 2UWXA 5B0ZA 3AZNC 1KX3C 5B2ID 5AY8B 3UTAD 3X1TC 4ZUXC 5AV9C 5F99A 4G91C 5B40D 1KX4D 1P3AC 2HUEC 4Z66A 4YM6D 3AZKA 3NQUA 3WKJB 4HGAB 3KXBB 1N1JB 2F8NH 2Y2JA 3AYWA 4X23D 4YS3D 4WU8C 5GT0C 3W96B 3MGSC 3AFAA 3LELB 1TZYC 3LJAD 1P3OA 1M18C 1HQ3A 2YFVB 4H9RB 3REJB 4R8PB 2NQBB 1P3BA 5B33A 5JRGA 5AVBB 5BS7A 3W99B 3MNND 3REKD 5GSUB 1B6WA 3KWQB 4WNNA 5AV8A 4KGCA 5B1LC 2BYMB 3B6GC 3A1IA 3REIC 3AZFC 2Y2MA 5BNXB 1M1AA 5DNMD 1ID3D 5B0ZB 5CHLB 3AV1C 3AZEC 3UT9C 3AZGA 3MGQA 3KUYC 5F99B 5B24D 3IP4C 2CV5C 3X1SA 4Z66B 4UUZA 3AZMC 5CPIC 3AZKB 3NQUB 3H0LC 3X1VC 4H9PB 5DNNC 3X1UC 3C1BC 2JSSA 3AYWB 5B0YA 3AZIA 5CPJA 5AV5A 1F66A 3AZHD 3RELD 5E5AD 3AFAB 2ZY2A 2ZM5A 1P3OB 2YFWA 2IO5C 3MGRC 1HQ3B 4DQYB 1P3BB 1P3FA 3WTPE 5C3IC 3LZ0D 2Y2PA 5B33B 5JRGB 3B0DC 3W98C 5GXQA 4NFTA 3WAAD 5B31A 4XZQA 3MVDA 5AV8B 4JJND 4KGCB 5CP6A 1M1AD 1BH8A 4DRAA 1U35C 2G5IC 1B67A 1R4VA 3AZGB 4H9NA 3MGQB 2NZDC 3O62C 3X1SD 2Y2LA 3B6FC 3UTBA 1AOIA 4AWLB 4UUZB 3W97C 4XUJD 5DNNB 3X1UB 1WWIA 2Y2OA 5GT3C 1P3MD 2RVQC 3C1CD 3AZJD 5B0YB 3AZIB 5CPJB 5AV5B 1P3PA 1F66B 2AROA 2BG1A 3WA9C 3AZLC 3TU4D 4QLCD 2YFWB 1P3ID 2FJ7D 2JE5A 5JA4A 3H0RC 1P3FB 1M19D 3AN2A 3R45A 3B0DB 5AY8C 4KHAA 1EQZD 5B2IA 3UTAA 4H9SC 5GXQB 5BT1D 4XZQB 5B31B 3MVDB 4M6BA 4H9OA 5CP6B 5B40A 1KX4A 3WKJC 4YM6A 1BH8B 4HGAC 3KXBC 4J8WA 5AVCD 3VH5A 1S32D 4J8UD 3W96C 4X23A 4YS3A 2PYOC 3LELC 4H9NB 3LJAA 3LZ1D 4J8VD 3REJC 3UTBB 4R8PC 1AOIB 2NQBC 4H9QA 1JFIA 1KX5D 3W99C 5AVBC 4NE6A 5GSUC 3MNNA 3REKA 2DF4C 1P3PB 2AROB 3AZLB 3A6ND 3KFUG 1P34D 5JA4B 2BYKA 5B0ZC 2HIOD 4KUDD 1Q9CA 3AN2B 4Z5TD 5DNMA 1ID3A 3REHD 3R45B 5B2IB 2F8ND 3UTAB 5F99C 4H9OB 4Z66C 5B24A 4J8WD 1BFMA 3AZKC 5B40B 1KX4B 4YM6B 3MGPD 3AYWC 2F8NG 2PYOB 5AV6D 4X23B 4YS3B 3AFAC 1P3LD 3AZHA 1P3OC 3RELA 1P3KD 5E5AA 5CPKD 3LJAB 4ZBJC 1HQ3C 4WU9D 1P3BC 4CAYA 4H9QB 5B32D 5B33C 1JFIB 5JRGC 5BS7C 3LZ0A 5BO0A 3WTPA 3MNNB 3REKB 1W2EA 3AL0C 5AV8C 4KGCC 3WAAA 3VH5W 4JJNA 5B32G 3AV2D 1M1AC 2FFFB 2BYKB 4LD9A 4DRBA 5DNMB 1ID3B 4EO5C 3AZGC 3MGQC 4J8XD 5B1MD 3F6TA 1ZLAD 2W8SA 4AWLC 3X1SC 5B24B 4Z2MH 4XUJA 5B2JD 4G92B 1P3GD 5B0YC 3AZIC 5CPJC 2XD1A 5AV5C 1P3MA 4Z2MG 3C1CA 1F66C 3AZJA 3H0MC 3AZND 1KX3D 3AZHB 3RELB 5E5AB 4ZBJB 3EPLA 3TU4A 3X1TD 4CSRA 4QLCA 4ZUXD 1P3IA 2FJ7A 5AV9D 4CAYB 1P3FC 3WTPD 1P3AD 1M19A 3LZ0B 5BO0B 1EQZA 5GXQC 4WNNB 4XZQC 5B31C 3MVDC 3WAAB 1KU5A 5CP6C 5GT0D 4WU8D 4JJNB 3EPHA 3MGSD 1M1AB 4LD9D 1TZYD 1M18D 5AVCA 4EO5B 1S32A 4J8UA 2Y2NA 2JCHA 2RIQA 3UTBC 1AOIC 3X1SB 3LZ1A 4J8VA 1A7WA 3NQJA 1Z2CB 5B1LD 1KX5A 3B6GD 4XUJB 3VH5T 3REID 3AZFD 1P3MB 1P3PC 3C1CB 2AROC 3AZJB 3AV1D 3AZED 4NE5A 3UT9D 3TU4B 4QLCB 3A6NA 1P3IB 3KUYD 2FJ7B 1P34A 3AN2C 2CV5D 2HIOA 5BNVA 1M19B 4KUDA 3AZMD 4Z5TA 5CPID 3REHA 5B2IC 3UTAC 3X1VD 1EQZB 5DNND 3X1UD 3C1BD 2F8NA 2XD5A 4NE3A 2ZY3A 5B40C 1KX4C 4YM6C 4J8WC 3MGRD 5AVCB 3MGPA 4X23C 1S32B 4YS3C 4J8UB 5AV6A 1P3LA 3LJAC 2Y2KA 1P3KA 3W98D 5CPKA 3LZ1B 4J8VB 4WU9A 3NQJB 5B32A 3FDDA 1KX5B 3MNNC 3REKC 1U35D 3EPKA 2NZDD 3O62D 3AV2A 1P34B 3B6FD 4WJ3C 5DNMC 1ID3C 4KHAB 2HIOB 5BNVB 4KUDB 4E45A 4Z5TB 2F2AC 2YFVA 3VH6A 3REHB 3W97D 3A1KA 4J8XA 5GT3D 2F8NB 5B1MA 2RVQD 5B24C 1ZLAA
chains in the Genus database with same CATH topology
4J8WB 3WA9D 3AZLD 3KWQA 4G92C 2DQNC 4E44A 5B2JA 3MGPB 1P3GA 2ZY4A 3AZHC 5AV6B 3RELC 5E5AC 5AY8D 3EPJA 3AZNA 1P3LB 1KX3A 1P3KB 5CPKB 3X1TA 4ZUXA 4WU9B 5AV9A 2J8PA 3LZ0C 5B32B 3WTPC 1WWSA 1P3AA 3WKJD 3KXBD 2Y2QA 3KSYA 2CWEA 2F8NK 3WAAC 4H9PA 4JJNC 2PYOD 3W96D 4WU8A 5GT0A 3LELD 3MGSA 3AV2B 1TZYA 4LD9C 2NQBD 3REJD 4R8PD 1H3OA 1M18A 3W99D 5AVBD 4J8XB 5GSUD 5B1MB 3B0CT 1ZLAB 3KWQD 4XUJC 5B1LA 1TAFA 5G49A 1P3MC 3B6GA 5B2JB 3C1CC 1P3GB 3REIA 3AZJC 3AZFA 5B0ZD 3AZNB 3AV1A 1KX3B 3TU4C 3AZEA 3UT9A 4QLCC 3VH6W 1P3IC 2FJ7C 5F99D 4ZUXB 3X1TB 3V9RA 3KUYA 5AV9B 1M19C 4Z66D 4G91B 3WTPB 3AZKD 2CV5A 1P3AB 2HUEB 1EQZC 3AZMA 5CPIA 3X1VA 5BT1C 3AYWD 5DNNA 3X1UA 3C1BA 4WU8B 3AFAD 5GT0B 1P3OD 3MGSB 4LD9B 1TZYB 1HQ3D 5AVCC 1H3OB 1S32C 3MGRA 4J8UC 1P3BD 1M18B 5B33D 5JRGD 3LZ1C 4J8VC 3W98A 5AV8D 4KGCD 1KX5C 4UPKA 5B1LB 1TAFB 5G49B 3B6GB 3REIB 3AZFB 1U35A 2VQRA 4WV4B 3AZGD 4CSRB 3MGQD 3AZEB 3AV1B 5FUGA 3A6NC 3UT9B 2NZDA 1P34C 3O62A 3V9RB 3KUYB 2HIOC 5KDMA 3B6FA 4KUDC 4Z5TC 3REHC 2CV5B 3AZMB 5CPIB 3W97A 3X1VB 2LY8A 3C1BB 5GT3A 5CPJD 5B0YD 5AV5D 3AZID 1F66D 1BH9A 3WA9A 3AZLA 3MGPC 2IO5B 3VH6T 3MGRB 1P3FD 5AV6C 1P3LC 5C3IB 1P3KC 5AY8A 5CPKC 1HTAA 5GXQD 3W98B 5B31D 4XZQD 4H9SA 3MVDD 4WU9C 5B32C 5CP6D 1PZRA 3B0CW 2Y2GA 3EG5B 3WKJA 2Y2IA 3KXBA 1N1JA 1U35B 5B31G 3A6NB 3W96A 5FUGB 2PYOA 3LELA 3AV2C 2NZDB 1ULYA 3O62B 3UTBD 1AOID 5KDMB 2NQBA 4H9RA 3REJA 3B6FB 4R8PA 4J8XC 1F1EA 3W97B 3B0BA 5AVBA 5B1MC 3W99A 1P3PD 5GT3B 5GSUA 1ZLAC 2AROD 1BH9B 2L5AA 2G5HC 1T3UA 2Y2HA 3KWQC 3WA9B 2BYMA 5B2JC 3P5JB 1P3GC 4WZSB 5BNXA 3AN2D 2ZY5A 2UWXA 5B0ZA 3AZNC 1KX3C 5B2ID 5AY8B 3UTAD 3X1TC 4ZUXC 5AV9C 5F99A 4G91C 5B40D 1KX4D 1P3AC 2HUEC 4Z66A 4YM6D 3AZKA 3NQUA 3WKJB 4HGAB 3KXBB 1N1JB 2F8NH 2Y2JA 3AYWA 4X23D 4YS3D 4WU8C 5GT0C 3W96B 3MGSC 3AFAA 3LELB 1TZYC 3LJAD 1P3OA 1M18C 1HQ3A 2YFVB 4H9RB 3REJB 4R8PB 2NQBB 1P3BA 5B33A 5JRGA 5AVBB 5BS7A 3W99B 3MNND 3REKD 5GSUB 1B6WA 3KWQB 4WNNA 5AV8A 4KGCA 5B1LC 2BYMB 3B6GC 3A1IA 3REIC 3AZFC 2Y2MA 5BNXB 1M1AA 5DNMD 1ID3D 5B0ZB 5CHLB 3AV1C 3AZEC 3UT9C 3AZGA 3MGQA 3KUYC 5F99B 5B24D 3IP4C 2CV5C 3X1SA 4Z66B 4UUZA 3AZMC 5CPIC 3AZKB 3NQUB 3H0LC 3X1VC 4H9PB 5DNNC 3X1UC 3C1BC 2JSSA 3AYWB 5B0YA 3AZIA 5CPJA 5AV5A 1F66A 3AZHD 3RELD 5E5AD 3AFAB 2ZY2A 2ZM5A 1P3OB 2YFWA 2IO5C 3MGRC 1HQ3B 4DQYB 1P3BB 1P3FA 3WTPE 5C3IC 3LZ0D 2Y2PA 5B33B 5JRGB 3B0DC 3W98C 5GXQA 4NFTA 3WAAD 5B31A 4XZQA 3MVDA 5AV8B 4JJND 4KGCB 5CP6A 1M1AD 1BH8A 4DRAA 1U35C 2G5IC 1B67A 1R4VA 3AZGB 4H9NA 3MGQB 2NZDC 3O62C 3X1SD 2Y2LA 3B6FC 3UTBA 1AOIA 4AWLB 4UUZB 3W97C 4XUJD 5DNNB 3X1UB 1WWIA 2Y2OA 5GT3C 1P3MD 2RVQC 3C1CD 3AZJD 5B0YB 3AZIB 5CPJB 5AV5B 1P3PA 1F66B 2AROA 2BG1A 3WA9C 3AZLC 3TU4D 4QLCD 2YFWB 1P3ID 2FJ7D 2JE5A 5JA4A 3H0RC 1P3FB 1M19D 3AN2A 3R45A 3B0DB 5AY8C 4KHAA 1EQZD 5B2IA 3UTAA 4H9SC 5GXQB 5BT1D 4XZQB 5B31B 3MVDB 4M6BA 4H9OA 5CP6B 5B40A 1KX4A 3WKJC 4YM6A 1BH8B 4HGAC 3KXBC 4J8WA 5AVCD 3VH5A 1S32D 4J8UD 3W96C 4X23A 4YS3A 2PYOC 3LELC 4H9NB 3LJAA 3LZ1D 4J8VD 3REJC 3UTBB 4R8PC 1AOIB 2NQBC 4H9QA 1JFIA 1KX5D 3W99C 5AVBC 4NE6A 5GSUC 3MNNA 3REKA 2DF4C 1P3PB 2AROB 3AZLB 3A6ND 3KFUG 1P34D 5JA4B 2BYKA 5B0ZC 2HIOD 4KUDD 1Q9CA 3AN2B 4Z5TD 5DNMA 1ID3A 3REHD 3R45B 5B2IB 2F8ND 3UTAB 5F99C 4H9OB 4Z66C 5B24A 4J8WD 1BFMA 3AZKC 5B40B 1KX4B 4YM6B 3MGPD 3AYWC 2F8NG 2PYOB 5AV6D 4X23B 4YS3B 3AFAC 1P3LD 3AZHA 1P3OC 3RELA 1P3KD 5E5AA 5CPKD 3LJAB 4ZBJC 1HQ3C 4WU9D 1P3BC 4CAYA 4H9QB 5B32D 5B33C 1JFIB 5JRGC 5BS7C 3LZ0A 5BO0A 3WTPA 3MNNB 3REKB 1W2EA 3AL0C 5AV8C 4KGCC 3WAAA 3VH5W 4JJNA 5B32G 3AV2D 1M1AC 2FFFB 2BYKB 4LD9A 4DRBA 5DNMB 1ID3B 4EO5C 3AZGC 3MGQC 4J8XD 5B1MD 3F6TA 1ZLAD 2W8SA 4AWLC 3X1SC 5B24B 4Z2MH 4XUJA 5B2JD 4G92B 1P3GD 5B0YC 3AZIC 5CPJC 2XD1A 5AV5C 1P3MA 4Z2MG 3C1CA 1F66C 3AZJA 3H0MC 3AZND 1KX3D 3AZHB 3RELB 5E5AB 4ZBJB 3EPLA 3TU4A 3X1TD 4CSRA 4QLCA 4ZUXD 1P3IA 2FJ7A 5AV9D 4CAYB 1P3FC 3WTPD 1P3AD 1M19A 3LZ0B 5BO0B 1EQZA 5GXQC 4WNNB 4XZQC 5B31C 3MVDC 3WAAB 1KU5A 5CP6C 5GT0D 4WU8D 4JJNB 3EPHA 3MGSD 1M1AB 4LD9D 1TZYD 1M18D 5AVCA 4EO5B 1S32A 4J8UA 2Y2NA 2JCHA 2RIQA 3UTBC 1AOIC 3X1SB 3LZ1A 4J8VA 1A7WA 3NQJA 1Z2CB 5B1LD 1KX5A 3B6GD 4XUJB 3VH5T 3REID 3AZFD 1P3MB 1P3PC 3C1CB 2AROC 3AZJB 3AV1D 3AZED 4NE5A 3UT9D 3TU4B 4QLCB 3A6NA 1P3IB 3KUYD 2FJ7B 1P34A 3AN2C 2CV5D 2HIOA 5BNVA 1M19B 4KUDA 3AZMD 4Z5TA 5CPID 3REHA 5B2IC 3UTAC 3X1VD 1EQZB 5DNND 3X1UD 3C1BD 2F8NA 2XD5A 4NE3A 2ZY3A 5B40C 1KX4C 4YM6C 4J8WC 3MGRD 5AVCB 3MGPA 4X23C 1S32B 4YS3C 4J8UB 5AV6A 1P3LA 3LJAC 2Y2KA 1P3KA 3W98D 5CPKA 3LZ1B 4J8VB 4WU9A 3NQJB 5B32A 3FDDA 1KX5B 3MNNC 3REKC 1U35D 3EPKA 2NZDD 3O62D 3AV2A 1P34B 3B6FD 4WJ3C 5DNMC 1ID3C 4KHAB 2HIOB 5BNVB 4KUDB 4E45A 4Z5TB 2F2AC 2YFVA 3VH6A 3REHB 3W97D 3A1KA 4J8XA 5GT3D 2F8NB 5B1MA 2RVQD 5B24C 1ZLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W B;  3WA9 D;  3AZL D;  3KWQ A;  4G92 C;  4E44 A;  5B2J A;  3MGP B;  1P3G A;  3AZH C;  5AV6 B;  3REL C;  5E5A C;  5AY8 D;  3AZN A;  1P3L B;  1KX3 A;  1P3K B;  5CPK B;  3X1T A;  4ZUX A;  4WU9 B;  5AV9 A;  3LZ0 C;  5B32 B;  3WTP C;  1WWS A;  1P3A A;  3WKJ D;  3KXB D;  3KSY A;  2CWE A;  2F8N K;  3WAA C;  4H9P A;  4JJN C;  2PYO D;  3W96 D;  4WU8 A;  5GT0 A;  3LEL D;  3MGS A;  3AV2 B;  1TZY A;  4LD9 C;  2NQB D;  3REJ D;  4R8P D;  1H3O A;  1M18 A;  3W99 D;  5AVB D;  4J8X B;  5GSU D;  5B1M B;  3B0C T;  1ZLA B;  3KWQ D;  4XUJ C;  5B1L A;  1TAF A;  5G49 A;  1P3M C;  3B6G A;  5B2J B;  3C1C C;  1P3G B;  3REI A;  3AZJ C;  3AZF A;  5B0Z D;  3AZN B;  3AV1 A;  1KX3 B;  3TU4 C;  3AZE A;  3UT9 A;  4QLC C;  3VH6 W;  1P3I C;  2FJ7 C;  5F99 D;  4ZUX B;  3X1T B;  3V9R A;  3KUY A;  5AV9 B;  1M19 C;  4Z66 D;  4G91 B;  3WTP B;  3AZK D;  2CV5 A;  1P3A B;  2HUE B;  1EQZ C;  3AZM A;  5CPI A;  3X1V A;  5BT1 C;  3AYW D;  5DNN A;  3X1U A;  3C1B A;  4WU8 B;  3AFA D;  5GT0 B;  1P3O D;  3MGS B;  4LD9 B;  1TZY B;  1HQ3 D;  5AVC C;  1H3O B;  1S32 C;  3MGR A;  4J8U C;  1P3B D;  1M18 B;  5B33 D;  5JRG D;  3LZ1 C;  4J8V C;  3W98 A;  5AV8 D;  4KGC D;  1KX5 C;  5B1L B;  1TAF B;  5G49 B;  3B6G B;  3REI B;  3AZF B;  1U35 A;  4WV4 B;  3AZG D;  4CSR B;  3MGQ D;  3AZE B;  3AV1 B;  5FUG A;  3A6N C;  3UT9 B;  2NZD A;  1P34 C;  3O62 A;  3V9R B;  3KUY B;  2HIO C;  5KDM A;  3B6F A;  4KUD C;  4Z5T C;  3REH C;  2CV5 B;  3AZM B;  5CPI B;  3W97 A;  3X1V B;  2LY8 A;  3C1B B;  5GT3 A;  5CPJ D;  5B0Y D;  5AV5 D;  3AZI D;  1F66 D;  1BH9 A;  3WA9 A;  3AZL A;  3MGP C;  2IO5 B;  3VH6 T;  3MGR B;  1P3F D;  5AV6 C;  1P3L C;  5C3I B;  1P3K C;  5AY8 A;  5CPK C;  1HTA A;  5GXQ D;  3W98 B;  5B31 D;  4XZQ D;  4H9S A;  3MVD D;  4WU9 C;  5B32 C;  5CP6 D;  3B0C W;  3WKJ A;  3KXB A;  1N1J A;  1U35 B;  5B31 G;  3A6N B;  3W96 A;  5FUG B;  2PYO A;  3LEL A;  3AV2 C;  2NZD B;  1ULY A;  3O62 B;  3UTB D;  1AOI D;  5KDM B;  2NQB A;  4H9R A;  3REJ A;  3B6F B;  4R8P A;  4J8X C;  1F1E A;  3W97 B;  3B0B A;  5AVB A;  5B1M C;  3W99 A;  1P3P D;  5GT3 B;  5GSU A;  1ZLA C;  2ARO D;  1BH9 B;  2L5A A;  3KWQ C;  3WA9 B;  2BYM A;  5B2J C;  1P3G C;  4WZS B;  5BNX A;  3AN2 D;  5B0Z A;  3AZN C;  1KX3 C;  5B2I D;  5AY8 B;  3UTA D;  3X1T C;  4ZUX C;  5AV9 C;  5F99 A;  4G91 C;  5B40 D;  1KX4 D;  1P3A C;  2HUE C;  4Z66 A;  4YM6 D;  3AZK A;  3NQU A;  3WKJ B;  4HGA B;  3KXB B;  1N1J B;  2F8N H;  3AYW A;  4X23 D;  4YS3 D;  4WU8 C;  5GT0 C;  3W96 B;  3MGS C;  3AFA A;  3LEL B;  1TZY C;  3LJA D;  1P3O A;  1M18 C;  1HQ3 A;  2YFV B;  4H9R B;  3REJ B;  4R8P B;  2NQB B;  1P3B A;  5B33 A;  5JRG A;  5AVB B;  5BS7 A;  3W99 B;  3MNN D;  3REK D;  5GSU B;  1B6W A;  3KWQ B;  4WNN A;  5AV8 A;  4KGC A;  5B1L C;  2BYM B;  3B6G C;  3REI C;  3AZF C;  5BNX B;  1M1A A;  5DNM D;  1ID3 D;  5B0Z B;  5CHL B;  3AV1 C;  3AZE C;  3UT9 C;  3AZG A;  3MGQ A;  3KUY C;  5F99 B;  5B24 D;  2CV5 C;  3X1S A;  4Z66 B;  4UUZ A;  3AZM C;  5CPI C;  3AZK B;  3NQU B;  3X1V C;  4H9P B;  5DNN C;  3X1U C;  3C1B C;  2JSS A;  3AYW B;  5B0Y A;  3AZI A;  5CPJ A;  5AV5 A;  1F66 A;  3AZH D;  3REL D;  5E5A D;  3AFA B;  1P3O B;  2YFW A;  2IO5 C;  3MGR C;  1HQ3 B;  1P3B B;  1P3F A;  3WTP E;  5C3I C;  3LZ0 D;  5B33 B;  5JRG B;  3B0D C;  3W98 C;  5GXQ A;  4NFT A;  3WAA D;  5B31 A;  4XZQ A;  3MVD A;  5AV8 B;  4JJN D;  4KGC B;  5CP6 A;  1M1A D;  1BH8 A;  4DRA A;  1U35 C;  1B67 A;  1R4V A;  3AZG B;  4H9N A;  3MGQ B;  2NZD C;  3O62 C;  3X1S D;  3B6F C;  3UTB A;  1AOI A;  4AWL B;  4UUZ B;  3W97 C;  4XUJ D;  5DNN B;  3X1U B;  1WWI A;  5GT3 C;  1P3M D;  2RVQ C;  3C1C D;  3AZJ D;  5B0Y B;  3AZI B;  5CPJ B;  5AV5 B;  1P3P A;  1F66 B;  2ARO A;  3WA9 C;  3AZL C;  3TU4 D;  4QLC D;  2YFW B;  1P3I D;  2FJ7 D;  5JA4 A;  1P3F B;  1M19 D;  3AN2 A;  3R45 A;  3B0D B;  5AY8 C;  4KHA A;  1EQZ D;  5B2I A;  3UTA A;  4H9S C;  5GXQ B;  5BT1 D;  4XZQ B;  5B31 B;  3MVD B;  4M6B A;  4H9O A;  5CP6 B;  5B40 A;  1KX4 A;  3WKJ C;  4YM6 A;  1BH8 B;  4HGA C;  3KXB C;  4J8W A;  5AVC D;  3VH5 A;  1S32 D;  4J8U D;  3W96 C;  4X23 A;  4YS3 A;  2PYO C;  3LEL C;  4H9N B;  3LJA A;  3LZ1 D;  4J8V D;  3REJ C;  3UTB B;  4R8P C;  1AOI B;  2NQB C;  4H9Q A;  1JFI A;  1KX5 D;  3W99 C;  5AVB C;  4NE6 A;  5GSU C;  3MNN A;  3REK A;  1P3P B;  2ARO B;  3AZL B;  3A6N D;  1P34 D;  5JA4 B;  2BYK A;  5B0Z C;  2HIO D;  4KUD D;  1Q9C A;  3AN2 B;  4Z5T D;  5DNM A;  1ID3 A;  3REH D;  3R45 B;  5B2I B;  2F8N D;  3UTA B;  5F99 C;  4H9O B;  4Z66 C;  5B24 A;  4J8W D;  1BFM A;  3AZK C;  5B40 B;  1KX4 B;  4YM6 B;  3MGP D;  3AYW C;  2F8N G;  2PYO B;  5AV6 D;  4X23 B;  4YS3 B;  3AFA C;  1P3L D;  3AZH A;  1P3O C;  3REL A;  1P3K D;  5E5A A;  5CPK D;  3LJA B;  4ZBJ C;  1HQ3 C;  4WU9 D;  1P3B C;  4CAY A;  4H9Q B;  5B32 D;  5B33 C;  1JFI B;  5JRG C;  5BS7 C;  3LZ0 A;  5BO0 A;  3WTP A;  3MNN B;  3REK B;  5AV8 C;  4KGC C;  3WAA A;  3VH5 W;  4JJN A;  5B32 G;  3AV2 D;  1M1A C;  2BYK B;  4LD9 A;  4DRB A;  5DNM B;  1ID3 B;  4EO5 C;  3AZG C;  3MGQ C;  4J8X D;  5B1M D;  1ZLA D;  4AWL C;  3X1S C;  5B24 B;  4Z2M H;  4XUJ A;  5B2J D;  4G92 B;  1P3G D;  5B0Y C;  3AZI C;  5CPJ C;  5AV5 C;  1P3M A;  4Z2M G;  3C1C A;  1F66 C;  3AZJ A;  3AZN D;  1KX3 D;  3AZH B;  3REL B;  5E5A B;  4ZBJ B;  3TU4 A;  3X1T D;  4CSR A;  4QLC A;  4ZUX D;  1P3I A;  2FJ7 A;  5AV9 D;  4CAY B;  1P3F C;  3WTP D;  1P3A D;  1M19 A;  3LZ0 B;  5BO0 B;  1EQZ A;  5GXQ C;  4WNN B;  4XZQ C;  5B31 C;  3MVD C;  3WAA B;  1KU5 A;  5CP6 C;  5GT0 D;  4WU8 D;  4JJN B;  3MGS D;  1M1A B;  4LD9 D;  1TZY D;  1M18 D;  5AVC A;  4EO5 B;  1S32 A;  4J8U A;  3UTB C;  1AOI C;  3X1S B;  3LZ1 A;  4J8V A;  1A7W A;  3NQJ A;  5B1L D;  1KX5 A;  3B6G D;  4XUJ B;  3VH5 T;  3REI D;  3AZF D;  1P3M B;  1P3P C;  3C1C B;  2ARO C;  3AZJ B;  3AV1 D;  3AZE D;  4NE5 A;  3UT9 D;  3TU4 B;  4QLC B;  3A6N A;  1P3I B;  3KUY D;  2FJ7 B;  1P34 A;  3AN2 C;  2CV5 D;  2HIO A;  5BNV A;  1M19 B;  4KUD A;  3AZM D;  4Z5T A;  5CPI D;  3REH A;  5B2I C;  3UTA C;  3X1V D;  1EQZ B;  5DNN D;  3X1U D;  3C1B D;  2F8N A;  4NE3 A;  5B40 C;  1KX4 C;  4YM6 C;  4J8W C;  3MGR D;  5AVC B;  3MGP A;  4X23 C;  1S32 B;  4YS3 C;  4J8U B;  5AV6 A;  1P3L A;  3LJA C;  1P3K A;  3W98 D;  5CPK A;  3LZ1 B;  4J8V B;  4WU9 A;  3NQJ B;  5B32 A;  1KX5 B;  3MNN C;  3REK C;  1U35 D;  2NZD D;  3O62 D;  3AV2 A;  1P34 B;  3B6F D;  5DNM C;  1ID3 C;  4KHA B;  2HIO B;  5BNV B;  4KUD B;  4E45 A;  4Z5T B;  2YFV A;  3VH6 A;  3REH B;  3W97 D;  4J8X A;  5GT3 D;  2F8N B;  5B1M A;  2RVQ D;  5B24 C;  1ZLA A; 
#chains in the Genus database with same CATH topology
 4J8W B;  3WA9 D;  3AZL D;  3KWQ A;  4G92 C;  2DQN C;  4E44 A;  5B2J A;  3MGP B;  1P3G A;  2ZY4 A;  3AZH C;  5AV6 B;  3REL C;  5E5A C;  5AY8 D;  3EPJ A;  3AZN A;  1P3L B;  1KX3 A;  1P3K B;  5CPK B;  3X1T A;  4ZUX A;  4WU9 B;  5AV9 A;  2J8P A;  3LZ0 C;  5B32 B;  3WTP C;  1WWS A;  1P3A A;  3WKJ D;  3KXB D;  2Y2Q A;  3KSY A;  2CWE A;  2F8N K;  3WAA C;  4H9P A;  4JJN C;  2PYO D;  3W96 D;  4WU8 A;  5GT0 A;  3LEL D;  3MGS A;  3AV2 B;  1TZY A;  4LD9 C;  2NQB D;  3REJ D;  4R8P D;  1H3O A;  1M18 A;  3W99 D;  5AVB D;  4J8X B;  5GSU D;  5B1M B;  3B0C T;  1ZLA B;  3KWQ D;  4XUJ C;  5B1L A;  1TAF A;  5G49 A;  1P3M C;  3B6G A;  5B2J B;  3C1C C;  1P3G B;  3REI A;  3AZJ C;  3AZF A;  5B0Z D;  3AZN B;  3AV1 A;  1KX3 B;  3TU4 C;  3AZE A;  3UT9 A;  4QLC C;  3VH6 W;  1P3I C;  2FJ7 C;  5F99 D;  4ZUX B;  3X1T B;  3V9R A;  3KUY A;  5AV9 B;  1M19 C;  4Z66 D;  4G91 B;  3WTP B;  3AZK D;  2CV5 A;  1P3A B;  2HUE B;  1EQZ C;  3AZM A;  5CPI A;  3X1V A;  5BT1 C;  3AYW D;  5DNN A;  3X1U A;  3C1B A;  4WU8 B;  3AFA D;  5GT0 B;  1P3O D;  3MGS B;  4LD9 B;  1TZY B;  1HQ3 D;  5AVC C;  1H3O B;  1S32 C;  3MGR A;  4J8U C;  1P3B D;  1M18 B;  5B33 D;  5JRG D;  3LZ1 C;  4J8V C;  3W98 A;  5AV8 D;  4KGC D;  1KX5 C;  4UPK A;  5B1L B;  1TAF B;  5G49 B;  3B6G B;  3REI B;  3AZF B;  1U35 A;  2VQR A;  4WV4 B;  3AZG D;  4CSR B;  3MGQ D;  3AZE B;  3AV1 B;  5FUG A;  3A6N C;  3UT9 B;  2NZD A;  1P34 C;  3O62 A;  3V9R B;  3KUY B;  2HIO C;  5KDM A;  3B6F A;  4KUD C;  4Z5T C;  3REH C;  2CV5 B;  3AZM B;  5CPI B;  3W97 A;  3X1V B;  2LY8 A;  3C1B B;  5GT3 A;  5CPJ D;  5B0Y D;  5AV5 D;  3AZI D;  1F66 D;  1BH9 A;  3WA9 A;  3AZL A;  3MGP C;  2IO5 B;  3VH6 T;  3MGR B;  1P3F D;  5AV6 C;  1P3L C;  5C3I B;  1P3K C;  5AY8 A;  5CPK C;  1HTA A;  5GXQ D;  3W98 B;  5B31 D;  4XZQ D;  4H9S A;  3MVD D;  4WU9 C;  5B32 C;  5CP6 D;  1PZR A;  3B0C W;  2Y2G A;  3EG5 B;  3WKJ A;  2Y2I A;  3KXB A;  1N1J A;  1U35 B;  5B31 G;  3A6N B;  3W96 A;  5FUG B;  2PYO A;  3LEL A;  3AV2 C;  2NZD B;  1ULY A;  3O62 B;  3UTB D;  1AOI D;  5KDM B;  2NQB A;  4H9R A;  3REJ A;  3B6F B;  4R8P A;  4J8X C;  1F1E A;  3W97 B;  3B0B A;  5AVB A;  5B1M C;  3W99 A;  1P3P D;  5GT3 B;  5GSU A;  1ZLA C;  2ARO D;  1BH9 B;  2L5A A;  2G5H C;  1T3U A;  2Y2H A;  3KWQ C;  3WA9 B;  2BYM A;  5B2J C;  3P5J B;  1P3G C;  4WZS B;  5BNX A;  3AN2 D;  2ZY5 A;  2UWX A;  5B0Z A;  3AZN C;  1KX3 C;  5B2I D;  5AY8 B;  3UTA D;  3X1T C;  4ZUX C;  5AV9 C;  5F99 A;  4G91 C;  5B40 D;  1KX4 D;  1P3A C;  2HUE C;  4Z66 A;  4YM6 D;  3AZK A;  3NQU A;  3WKJ B;  4HGA B;  3KXB B;  1N1J B;  2F8N H;  2Y2J A;  3AYW A;  4X23 D;  4YS3 D;  4WU8 C;  5GT0 C;  3W96 B;  3MGS C;  3AFA A;  3LEL B;  1TZY C;  3LJA D;  1P3O A;  1M18 C;  1HQ3 A;  2YFV B;  4H9R B;  3REJ B;  4R8P B;  2NQB B;  1P3B A;  5B33 A;  5JRG A;  5AVB B;  5BS7 A;  3W99 B;  3MNN D;  3REK D;  5GSU B;  1B6W A;  3KWQ B;  4WNN A;  5AV8 A;  4KGC A;  5B1L C;  2BYM B;  3B6G C;  3A1I A;  3REI C;  3AZF C;  2Y2M A;  5BNX B;  1M1A A;  5DNM D;  1ID3 D;  5B0Z B;  5CHL B;  3AV1 C;  3AZE C;  3UT9 C;  3AZG A;  3MGQ A;  3KUY C;  5F99 B;  5B24 D;  3IP4 C;  2CV5 C;  3X1S A;  4Z66 B;  4UUZ A;  3AZM C;  5CPI C;  3AZK B;  3NQU B;  3H0L C;  3X1V C;  4H9P B;  5DNN C;  3X1U C;  3C1B C;  2JSS A;  3AYW B;  5B0Y A;  3AZI A;  5CPJ A;  5AV5 A;  1F66 A;  3AZH D;  3REL D;  5E5A D;  3AFA B;  2ZY2 A;  2ZM5 A;  1P3O B;  2YFW A;  2IO5 C;  3MGR C;  1HQ3 B;  4DQY B;  1P3B B;  1P3F A;  3WTP E;  5C3I C;  3LZ0 D;  2Y2P A;  5B33 B;  5JRG B;  3B0D C;  3W98 C;  5GXQ A;  4NFT A;  3WAA D;  5B31 A;  4XZQ A;  3MVD A;  5AV8 B;  4JJN D;  4KGC B;  5CP6 A;  1M1A D;  1BH8 A;  4DRA A;  1U35 C;  2G5I C;  1B67 A;  1R4V A;  3AZG B;  4H9N A;  3MGQ B;  2NZD C;  3O62 C;  3X1S D;  2Y2L A;  3B6F C;  3UTB A;  1AOI A;  4AWL B;  4UUZ B;  3W97 C;  4XUJ D;  5DNN B;  3X1U B;  1WWI A;  2Y2O A;  5GT3 C;  1P3M D;  2RVQ C;  3C1C D;  3AZJ D;  5B0Y B;  3AZI B;  5CPJ B;  5AV5 B;  1P3P A;  1F66 B;  2ARO A;  2BG1 A;  3WA9 C;  3AZL C;  3TU4 D;  4QLC D;  2YFW B;  1P3I D;  2FJ7 D;  2JE5 A;  5JA4 A;  3H0R C;  1P3F B;  1M19 D;  3AN2 A;  3R45 A;  3B0D B;  5AY8 C;  4KHA A;  1EQZ D;  5B2I A;  3UTA A;  4H9S C;  5GXQ B;  5BT1 D;  4XZQ B;  5B31 B;  3MVD B;  4M6B A;  4H9O A;  5CP6 B;  5B40 A;  1KX4 A;  3WKJ C;  4YM6 A;  1BH8 B;  4HGA C;  3KXB C;  4J8W A;  5AVC D;  3VH5 A;  1S32 D;  4J8U D;  3W96 C;  4X23 A;  4YS3 A;  2PYO C;  3LEL C;  4H9N B;  3LJA A;  3LZ1 D;  4J8V D;  3REJ C;  3UTB B;  4R8P C;  1AOI B;  2NQB C;  4H9Q A;  1JFI A;  1KX5 D;  3W99 C;  5AVB C;  4NE6 A;  5GSU C;  3MNN A;  3REK A;  2DF4 C;  1P3P B;  2ARO B;  3AZL B;  3A6N D;  3KFU G;  1P34 D;  5JA4 B;  2BYK A;  5B0Z C;  2HIO D;  4KUD D;  1Q9C A;  3AN2 B;  4Z5T D;  5DNM A;  1ID3 A;  3REH D;  3R45 B;  5B2I B;  2F8N D;  3UTA B;  5F99 C;  4H9O B;  4Z66 C;  5B24 A;  4J8W D;  1BFM A;  3AZK C;  5B40 B;  1KX4 B;  4YM6 B;  3MGP D;  3AYW C;  2F8N G;  2PYO B;  5AV6 D;  4X23 B;  4YS3 B;  3AFA C;  1P3L D;  3AZH A;  1P3O C;  3REL A;  1P3K D;  5E5A A;  5CPK D;  3LJA B;  4ZBJ C;  1HQ3 C;  4WU9 D;  1P3B C;  4CAY A;  4H9Q B;  5B32 D;  5B33 C;  1JFI B;  5JRG C;  5BS7 C;  3LZ0 A;  5BO0 A;  3WTP A;  3MNN B;  3REK B;  1W2E A;  3AL0 C;  5AV8 C;  4KGC C;  3WAA A;  3VH5 W;  4JJN A;  5B32 G;  3AV2 D;  1M1A C;  2FFF B;  2BYK B;  4LD9 A;  4DRB A;  5DNM B;  1ID3 B;  4EO5 C;  3AZG C;  3MGQ C;  4J8X D;  5B1M D;  3F6T A;  1ZLA D;  2W8S A;  4AWL C;  3X1S C;  5B24 B;  4Z2M H;  4XUJ A;  5B2J D;  4G92 B;  1P3G D;  5B0Y C;  3AZI C;  5CPJ C;  2XD1 A;  5AV5 C;  1P3M A;  4Z2M G;  3C1C A;  1F66 C;  3AZJ A;  3H0M C;  3AZN D;  1KX3 D;  3AZH B;  3REL B;  5E5A B;  4ZBJ B;  3EPL A;  3TU4 A;  3X1T D;  4CSR A;  4QLC A;  4ZUX D;  1P3I A;  2FJ7 A;  5AV9 D;  4CAY B;  1P3F C;  3WTP D;  1P3A D;  1M19 A;  3LZ0 B;  5BO0 B;  1EQZ A;  5GXQ C;  4WNN B;  4XZQ C;  5B31 C;  3MVD C;  3WAA B;  1KU5 A;  5CP6 C;  5GT0 D;  4WU8 D;  4JJN B;  3EPH A;  3MGS D;  1M1A B;  4LD9 D;  1TZY D;  1M18 D;  5AVC A;  4EO5 B;  1S32 A;  4J8U A;  2Y2N A;  2JCH A;  2RIQ A;  3UTB C;  1AOI C;  3X1S B;  3LZ1 A;  4J8V A;  1A7W A;  3NQJ A;  1Z2C B;  5B1L D;  1KX5 A;  3B6G D;  4XUJ B;  3VH5 T;  3REI D;  3AZF D;  1P3M B;  1P3P C;  3C1C B;  2ARO C;  3AZJ B;  3AV1 D;  3AZE D;  4NE5 A;  3UT9 D;  3TU4 B;  4QLC B;  3A6N A;  1P3I B;  3KUY D;  2FJ7 B;  1P34 A;  3AN2 C;  2CV5 D;  2HIO A;  5BNV A;  1M19 B;  4KUD A;  3AZM D;  4Z5T A;  5CPI D;  3REH A;  5B2I C;  3UTA C;  3X1V D;  1EQZ B;  5DNN D;  3X1U D;  3C1B D;  2F8N A;  2XD5 A;  4NE3 A;  2ZY3 A;  5B40 C;  1KX4 C;  4YM6 C;  4J8W C;  3MGR D;  5AVC B;  3MGP A;  4X23 C;  1S32 B;  4YS3 C;  4J8U B;  5AV6 A;  1P3L A;  3LJA C;  2Y2K A;  1P3K A;  3W98 D;  5CPK A;  3LZ1 B;  4J8V B;  4WU9 A;  3NQJ B;  5B32 A;  3FDD A;  1KX5 B;  3MNN C;  3REK C;  1U35 D;  3EPK A;  2NZD D;  3O62 D;  3AV2 A;  1P34 B;  3B6F D;  4WJ3 C;  5DNM C;  1ID3 C;  4KHA B;  2HIO B;  5BNV B;  4KUD B;  4E45 A;  4Z5T B;  2F2A C;  2YFV A;  3VH6 A;  3REH B;  3W97 D;  3A1K A;  4J8X A;  5GT3 D;  2F8N B;  5B1M A;  2RVQ D;  5B24 C;  1ZLA A; 
#chains in the Genus database with same CATH homology
 4J8W B;  3WA9 D;  3AZL D;  3KWQ A;  4G92 C;  2DQN C;  4E44 A;  5B2J A;  3MGP B;  1P3G A;  2ZY4 A;  3AZH C;  5AV6 B;  3REL C;  5E5A C;  5AY8 D;  3EPJ A;  3AZN A;  1P3L B;  1KX3 A;  1P3K B;  5CPK B;  3X1T A;  4ZUX A;  4WU9 B;  5AV9 A;  2J8P A;  3LZ0 C;  5B32 B;  3WTP C;  1WWS A;  1P3A A;  3WKJ D;  3KXB D;  2Y2Q A;  3KSY A;  2CWE A;  2F8N K;  3WAA C;  4H9P A;  4JJN C;  2PYO D;  3W96 D;  4WU8 A;  5GT0 A;  3LEL D;  3MGS A;  3AV2 B;  1TZY A;  4LD9 C;  2NQB D;  3REJ D;  4R8P D;  1H3O A;  1M18 A;  3W99 D;  5AVB D;  4J8X B;  5GSU D;  5B1M B;  3B0C T;  1ZLA B;  3KWQ D;  4XUJ C;  5B1L A;  1TAF A;  5G49 A;  1P3M C;  3B6G A;  5B2J B;  3C1C C;  1P3G B;  3REI A;  3AZJ C;  3AZF A;  5B0Z D;  3AZN B;  3AV1 A;  1KX3 B;  3TU4 C;  3AZE A;  3UT9 A;  4QLC C;  3VH6 W;  1P3I C;  2FJ7 C;  5F99 D;  4ZUX B;  3X1T B;  3V9R A;  3KUY A;  5AV9 B;  1M19 C;  4Z66 D;  4G91 B;  3WTP B;  3AZK D;  2CV5 A;  1P3A B;  2HUE B;  1EQZ C;  3AZM A;  5CPI A;  3X1V A;  5BT1 C;  3AYW D;  5DNN A;  3X1U A;  3C1B A;  4WU8 B;  3AFA D;  5GT0 B;  1P3O D;  3MGS B;  4LD9 B;  1TZY B;  1HQ3 D;  5AVC C;  1H3O B;  1S32 C;  3MGR A;  4J8U C;  1P3B D;  1M18 B;  5B33 D;  5JRG D;  3LZ1 C;  4J8V C;  3W98 A;  5AV8 D;  4KGC D;  1KX5 C;  4UPK A;  5B1L B;  1TAF B;  5G49 B;  3B6G B;  3REI B;  3AZF B;  1U35 A;  2VQR A;  4WV4 B;  3AZG D;  4CSR B;  3MGQ D;  3AZE B;  3AV1 B;  5FUG A;  3A6N C;  3UT9 B;  2NZD A;  1P34 C;  3O62 A;  3V9R B;  3KUY B;  2HIO C;  5KDM A;  3B6F A;  4KUD C;  4Z5T C;  3REH C;  2CV5 B;  3AZM B;  5CPI B;  3W97 A;  3X1V B;  2LY8 A;  3C1B B;  5GT3 A;  5CPJ D;  5B0Y D;  5AV5 D;  3AZI D;  1F66 D;  1BH9 A;  3WA9 A;  3AZL A;  3MGP C;  2IO5 B;  3VH6 T;  3MGR B;  1P3F D;  5AV6 C;  1P3L C;  5C3I B;  1P3K C;  5AY8 A;  5CPK C;  1HTA A;  5GXQ D;  3W98 B;  5B31 D;  4XZQ D;  4H9S A;  3MVD D;  4WU9 C;  5B32 C;  5CP6 D;  1PZR A;  3B0C W;  2Y2G A;  3EG5 B;  3WKJ A;  2Y2I A;  3KXB A;  1N1J A;  1U35 B;  5B31 G;  3A6N B;  3W96 A;  5FUG B;  2PYO A;  3LEL A;  3AV2 C;  2NZD B;  1ULY A;  3O62 B;  3UTB D;  1AOI D;  5KDM B;  2NQB A;  4H9R A;  3REJ A;  3B6F B;  4R8P A;  4J8X C;  1F1E A;  3W97 B;  3B0B A;  5AVB A;  5B1M C;  3W99 A;  1P3P D;  5GT3 B;  5GSU A;  1ZLA C;  2ARO D;  1BH9 B;  2L5A A;  2G5H C;  1T3U A;  2Y2H A;  3KWQ C;  3WA9 B;  2BYM A;  5B2J C;  3P5J B;  1P3G C;  4WZS B;  5BNX A;  3AN2 D;  2ZY5 A;  2UWX A;  5B0Z A;  3AZN C;  1KX3 C;  5B2I D;  5AY8 B;  3UTA D;  3X1T C;  4ZUX C;  5AV9 C;  5F99 A;  4G91 C;  5B40 D;  1KX4 D;  1P3A C;  2HUE C;  4Z66 A;  4YM6 D;  3AZK A;  3NQU A;  3WKJ B;  4HGA B;  3KXB B;  1N1J B;  2F8N H;  2Y2J A;  3AYW A;  4X23 D;  4YS3 D;  4WU8 C;  5GT0 C;  3W96 B;  3MGS C;  3AFA A;  3LEL B;  1TZY C;  3LJA D;  1P3O A;  1M18 C;  1HQ3 A;  2YFV B;  4H9R B;  3REJ B;  4R8P B;  2NQB B;  1P3B A;  5B33 A;  5JRG A;  5AVB B;  5BS7 A;  3W99 B;  3MNN D;  3REK D;  5GSU B;  1B6W A;  3KWQ B;  4WNN A;  5AV8 A;  4KGC A;  5B1L C;  2BYM B;  3B6G C;  3A1I A;  3REI C;  3AZF C;  2Y2M A;  5BNX B;  1M1A A;  5DNM D;  1ID3 D;  5B0Z B;  5CHL B;  3AV1 C;  3AZE C;  3UT9 C;  3AZG A;  3MGQ A;  3KUY C;  5F99 B;  5B24 D;  3IP4 C;  2CV5 C;  3X1S A;  4Z66 B;  4UUZ A;  3AZM C;  5CPI C;  3AZK B;  3NQU B;  3H0L C;  3X1V C;  4H9P B;  5DNN C;  3X1U C;  3C1B C;  2JSS A;  3AYW B;  5B0Y A;  3AZI A;  5CPJ A;  5AV5 A;  1F66 A;  3AZH D;  3REL D;  5E5A D;  3AFA B;  2ZY2 A;  2ZM5 A;  1P3O B;  2YFW A;  2IO5 C;  3MGR C;  1HQ3 B;  4DQY B;  1P3B B;  1P3F A;  3WTP E;  5C3I C;  3LZ0 D;  2Y2P A;  5B33 B;  5JRG B;  3B0D C;  3W98 C;  5GXQ A;  4NFT A;  3WAA D;  5B31 A;  4XZQ A;  3MVD A;  5AV8 B;  4JJN D;  4KGC B;  5CP6 A;  1M1A D;  1BH8 A;  4DRA A;  1U35 C;  2G5I C;  1B67 A;  1R4V A;  3AZG B;  4H9N A;  3MGQ B;  2NZD C;  3O62 C;  3X1S D;  2Y2L A;  3B6F C;  3UTB A;  1AOI A;  4AWL B;  4UUZ B;  3W97 C;  4XUJ D;  5DNN B;  3X1U B;  1WWI A;  2Y2O A;  5GT3 C;  1P3M D;  2RVQ C;  3C1C D;  3AZJ D;  5B0Y B;  3AZI B;  5CPJ B;  5AV5 B;  1P3P A;  1F66 B;  2ARO A;  2BG1 A;  3WA9 C;  3AZL C;  3TU4 D;  4QLC D;  2YFW B;  1P3I D;  2FJ7 D;  2JE5 A;  5JA4 A;  3H0R C;  1P3F B;  1M19 D;  3AN2 A;  3R45 A;  3B0D B;  5AY8 C;  4KHA A;  1EQZ D;  5B2I A;  3UTA A;  4H9S C;  5GXQ B;  5BT1 D;  4XZQ B;  5B31 B;  3MVD B;  4M6B A;  4H9O A;  5CP6 B;  5B40 A;  1KX4 A;  3WKJ C;  4YM6 A;  1BH8 B;  4HGA C;  3KXB C;  4J8W A;  5AVC D;  3VH5 A;  1S32 D;  4J8U D;  3W96 C;  4X23 A;  4YS3 A;  2PYO C;  3LEL C;  4H9N B;  3LJA A;  3LZ1 D;  4J8V D;  3REJ C;  3UTB B;  4R8P C;  1AOI B;  2NQB C;  4H9Q A;  1JFI A;  1KX5 D;  3W99 C;  5AVB C;  4NE6 A;  5GSU C;  3MNN A;  3REK A;  2DF4 C;  1P3P B;  2ARO B;  3AZL B;  3A6N D;  3KFU G;  1P34 D;  5JA4 B;  2BYK A;  5B0Z C;  2HIO D;  4KUD D;  1Q9C A;  3AN2 B;  4Z5T D;  5DNM A;  1ID3 A;  3REH D;  3R45 B;  5B2I B;  2F8N D;  3UTA B;  5F99 C;  4H9O B;  4Z66 C;  5B24 A;  4J8W D;  1BFM A;  3AZK C;  5B40 B;  1KX4 B;  4YM6 B;  3MGP D;  3AYW C;  2F8N G;  2PYO B;  5AV6 D;  4X23 B;  4YS3 B;  3AFA C;  1P3L D;  3AZH A;  1P3O C;  3REL A;  1P3K D;  5E5A A;  5CPK D;  3LJA B;  4ZBJ C;  1HQ3 C;  4WU9 D;  1P3B C;  4CAY A;  4H9Q B;  5B32 D;  5B33 C;  1JFI B;  5JRG C;  5BS7 C;  3LZ0 A;  5BO0 A;  3WTP A;  3MNN B;  3REK B;  1W2E A;  3AL0 C;  5AV8 C;  4KGC C;  3WAA A;  3VH5 W;  4JJN A;  5B32 G;  3AV2 D;  1M1A C;  2FFF B;  2BYK B;  4LD9 A;  4DRB A;  5DNM B;  1ID3 B;  4EO5 C;  3AZG C;  3MGQ C;  4J8X D;  5B1M D;  3F6T A;  1ZLA D;  2W8S A;  4AWL C;  3X1S C;  5B24 B;  4Z2M H;  4XUJ A;  5B2J D;  4G92 B;  1P3G D;  5B0Y C;  3AZI C;  5CPJ C;  2XD1 A;  5AV5 C;  1P3M A;  4Z2M G;  3C1C A;  1F66 C;  3AZJ A;  3H0M C;  3AZN D;  1KX3 D;  3AZH B;  3REL B;  5E5A B;  4ZBJ B;  3EPL A;  3TU4 A;  3X1T D;  4CSR A;  4QLC A;  4ZUX D;  1P3I A;  2FJ7 A;  5AV9 D;  4CAY B;  1P3F C;  3WTP D;  1P3A D;  1M19 A;  3LZ0 B;  5BO0 B;  1EQZ A;  5GXQ C;  4WNN B;  4XZQ C;  5B31 C;  3MVD C;  3WAA B;  1KU5 A;  5CP6 C;  5GT0 D;  4WU8 D;  4JJN B;  3EPH A;  3MGS D;  1M1A B;  4LD9 D;  1TZY D;  1M18 D;  5AVC A;  4EO5 B;  1S32 A;  4J8U A;  2Y2N A;  2JCH A;  2RIQ A;  3UTB C;  1AOI C;  3X1S B;  3LZ1 A;  4J8V A;  1A7W A;  3NQJ A;  1Z2C B;  5B1L D;  1KX5 A;  3B6G D;  4XUJ B;  3VH5 T;  3REI D;  3AZF D;  1P3M B;  1P3P C;  3C1C B;  2ARO C;  3AZJ B;  3AV1 D;  3AZE D;  4NE5 A;  3UT9 D;  3TU4 B;  4QLC B;  3A6N A;  1P3I B;  3KUY D;  2FJ7 B;  1P34 A;  3AN2 C;  2CV5 D;  2HIO A;  5BNV A;  1M19 B;  4KUD A;  3AZM D;  4Z5T A;  5CPI D;  3REH A;  5B2I C;  3UTA C;  3X1V D;  1EQZ B;  5DNN D;  3X1U D;  3C1B D;  2F8N A;  2XD5 A;  4NE3 A;  2ZY3 A;  5B40 C;  1KX4 C;  4YM6 C;  4J8W C;  3MGR D;  5AVC B;  3MGP A;  4X23 C;  1S32 B;  4YS3 C;  4J8U B;  5AV6 A;  1P3L A;  3LJA C;  2Y2K A;  1P3K A;  3W98 D;  5CPK A;  3LZ1 B;  4J8V B;  4WU9 A;  3NQJ B;  5B32 A;  3FDD A;  1KX5 B;  3MNN C;  3REK C;  1U35 D;  3EPK A;  2NZD D;  3O62 D;  3AV2 A;  1P34 B;  3B6F D;  4WJ3 C;  5DNM C;  1ID3 C;  4KHA B;  2HIO B;  5BNV B;  4KUD B;  4E45 A;  4Z5T B;  2F2A C;  2YFV A;  3VH6 A;  3REH B;  3W97 D;  3A1K A;  4J8X A;  5GT3 D;  2F8N B;  5B1M A;  2RVQ D;  5B24 C;  1ZLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...