2BYMB

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
AVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 28
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bymB00
2AROD 3AV1A 4HGAC 3B6FB 4R8PA 5AV5A 5GT0A 3KXBB 5JRGA 1P3OD 4LD9C 1N1JA 2IO5B 3AZJB 5CPKC 2CV5D 5AY8D 3O62C 5B32G 3AZFD 4KGCA 3AZLB 3AFAC 4J8UD 3VH6T 3AZMC 1BH8A 4KUDC 5B40B 3REHC 1HTAA 2AROC 2L5AA 1P3LA 5B2JB 5F99A 3AZHA 3C1CD 3REKD 5DNNA 1P3FA 3WTPB 2BYKB 1P3OC 4J8XB 4H9SC 5B32D 1KX3B 3MGPD 4Z66B 5GT3D 4Z5TA 2CV5C 4YM6A 3AZFC 4XZQD 4J8UC 1JFIA 2NQBA 5E5AB 4UUZA 3X1VB 5CPJA 5BO0B 1H3OA 3C1CC 3REKC 3NQUB 3C1BA 4J8VD 5B32C 1TZYA 3MGPC 1P3AA 4HGAB 5GT3C 3RELD 4XZQC 1U35A 2YFWA 4LD9B 3X1TD 2HIOA 3MNND 5BS7A 5CPKB 3O62B 5AVBB 3AZGD 5DNMA 3AFAB 3AZMB 4CSRB 4KUDB 5JA4B 5BNXA 4J8VC 3REHB 2AROB 5CP6D 3V9RB 1S32C 3W96A 3RELC 1P3MD 4G92C 3MVDD 1P3OB 3X1TC 3MNNC 2CV5B 3X1UD 3AZFB 1P34A 5BNVA 3UT9D 3B0CW 4X23D 3AZGC 4J8UB 2BYMA 5CP6C 4WNNA 4WU8D 3C1CB 3REKB 1P3MC 1F1EA 1KX4A 1AOIA 3MVDC 4WU9A 4KHAA 5B32B 3MGPB 3B6FA 5GT3B 3REID 2YFVA 3MGQD 3MGRA 4XZQB 4DRAA 3UT9C 4X23C 3KUYD 3MGSD 3AZJA 2F8ND 2NZDD 1BH9B 3AZED 3W99D 4WU8C 5B0ZD 4H9RB 5KDMB 3AZID 4J8VB 3W98D 2CWEA 3WKJA 1M19A 1P3KD 3UTBD 3REIC 1M1AD 4ZUXD 3RELB 4XUJA 4G92B 5AV6D 3MGQC 3AV2D 4NFTA 3WTPA 3X1TB 4J8XA 3LELD 3MNNB 3KUYC 3MGSC 2NZDC 3AZNA 3AYWD 3AZEC 3W99C 3X1SD 5B0ZC 3AZGB 1P3IA 1KX5D 3AZIC 3W98C 5FUGB 3VH6W 5CP6B 1HQ3A 3WAAD 3X1VA 1P3KC 4H9NB 4E45A 3UTBC 1M1AC 3R45A 4ZUXC 4YS3A 1P3MB 4NE3A 3NQJA 5AVCD 3AN2D 3LJAD 5AV6C 3MVDB 3AV2C 5CHLB 5GXQA 3LELC 3X1UB 3AYWC 3UT9B 3X1SC 4X23B 1KX5C 5G49B 3B0DC 1TAFB 3AV1D 4H9QB 3WAAC 5AV5D 3TU4A 5AVBA 4WU8B 3REJA 5JRGD 5AVCC 3AN2C 4CSRA 5AV9A 3VH5T 5JA4A 3LJAC 4CAYB 3REHA 1ZLAA 4WV4B 3REIB 2FJ7A 3V9RA 3UTAA 4QLCA 4KGCD 3MGQB 3KUYB 3MGSB 3AV1C 2F8NB 2NZDB 5F99D 5AY8A 5GT0C 5AV5C 3AZEB 3AZFA 3W99B 1P3FD 5B0ZB 5JRGC 3AZIB 2PYOA 4H9PB 3W98B 1B67A 5B1MA 4Z5TD 1P3KB 3UTBB 1M1AB 4YM6D 4ZUXB 4J8WA 3LZ0A 4KGCC 5AV6B 5B33A 3AV2B 2NQBD 5B32A 3LELB 1P3LC 3WA9D 5CPJD 5F99C 3LZ1A 5B31A 3AZHC 3AYWB 4JJNA 1S32D 1P3FC 3X1SB 3C1BD 1KX5B 1WWIA 1M18A 3B0DB 1TZYD 1P3AD 1R4VA 3WAAB 4Z5TC 1F66A 4YM6C 5AVCB 3AN2B 1U35D 5GSUA 3LJAB 4J8VA 4H9OB 4NE6A 2HIOD 5B0YA 2NQBC 3WA9C 5B24D 5CPJC 1P3BA 5DNMD 5B1LA 4E44A 3C1BC 1P3PA 3A6ND 5AV8A 1TZYC 3MNNA 3AV1B 3AZKA 1P3AC 5AV5B 3W96D 5B2IA 5JRGB 1U35C 3B6GA 1P3GD 1N1JB 2HIOC 5CPIA 5B24C 4KGCB 5DNMC 1BH8B 2F8NG 1EQZA 3W97A 1P3LB 3A6NC 5F99B 3X1UA 3W96C 1KX4D 1P3FB 4WU9D 3VH6A 1P3GC 3KXBA 1ID3D 4EO5C 4Z5TB 4YM6B 3MGRD 3KWQD 3AZLA 1JFIB 2NQBB 5B40A 3WA9B 4UUZB 5CPJB 1H3OB 5B2JA 4WZSB 1KX4C 3MGQA 1S32B 1AOIC 3C1BB 4WU9C 4AWLC 1TZYB 1P3AB 2BYKA 3WKJD 3MGSA 1M19D 1KX3A 1ID3C 4Z66A 4XUJD 3W99A 3MGRC 1U35B 2YFWB 3KWQC 2HIOB 4H9PA 3VH5W 5B24B 5E5AA 3UTBA 5BO0A 5DNMB 1P3ID 5BNXB 3NQUA 1HQ3D 3A6NB 3WKJC 1M19C 4YS3D 4M6BA 3W96B 4XUJC 1KX5A 3B0BA 5GXQD 1P3GB 4LD9A 4EO5B 3AZNC 5CPKA 4Z2MH 5BNVB 3O62A 4R8PD 5GT0D 5AVCA 3AN2A 1P3IC 2BYMB 3AFAA 3AZMA 4KUDA 1HQ3C 2AROA 4WNNB 3X1VC 3TU4D 4YS3C 1KX4B 3REJD 1AOIB 5AV9D 4WU9B 4KHAB 1ZLAD 5GXQC 4AWLB 4G91C 1P3OA 4H9SA 1ID3B 2YFVB 1P3LD 3UTAD 2FJ7D 4QLCD 2CV5A 3MGRB 3AZHD 4R8PC 5DNND 3KWQB 4J8UA 4ZBJC 3TU4C 5AVBC 3REJC 3C1CA 5AV9C 3REKA 2PYOD 5B31G 1ZLAC 5B1MD 3WKJB 1M19B 3MGPA 2FJ7C 3UTAC 4J8WD 3LZ0D 4QLCC 5GT3A 4XUJB 5B33D 5DNNC 4XZQA 3LZ1D 3AZNB 5AY8C 5B31D 4JJND 1BH9A 2F8NK 1P3IB 1M18D 2PYOC 4H9RA 5KDMA 1HQ3B 3WA9A 5B1MC 1WWSA 1F66D 3R45B 4J8WC 4YS3B 3LZ0C 3NQJB 5GSUD 1S32A 3RELA 5B33C 5GXQB 1BFMA 5B0YD 4G91B 3X1TA 1P3BD 3LZ1C 5B31C 4JJNC 5B1LD 4R8PB 5GT0B 1KU5A 1M18C 1P3PD 3AZGA 2HUEC 5C3IC 5AV8D 3AZKD 4ZBJB 5FUGA 1Q9CA 5B24A 5CP6A 5BS7C 3TU4B 1F66C 5B2ID 4H9NA 3REJB 1P34D 3B6GD 5GSUC 5AV9B 1P3MA 1ZLAB 3MVDA 5B0YC 3A6NA 5CPID 2FJ7B 3UTAB 1P3BC 4QLCB 3AZHB 5B1LC 5DNNB 1EQZD 3VH5A 1P3GA 1AOID 3UT9A 1P3PC 1B6WA 4X23A 3W97D 5AV8C 5G49A 3AZKC 3KSYA 1TAFA 5AY8B 3B6FD 4H9QA 5B2IC 1P34C 4WU8A 2PYOB 3B6GC 3KXBD 4CAYA 5CPIC 5B1MB 3AZJD 4NE5A 4J8WB 3LZ0B 3REIA 3WTPE 5B33B 5BT1D 3AZLD 1EQZC 2RVQD 5B40D 3W97C 4DRBA 1ID3A 3KUYA 5B2JD 3LZ1B 2F8NA 5B31B 2F8NH 3X1UC 4JJNB 3B6FC 2NZDA 3AZEA 1M18B 3KWQA 2HUEB 5B0ZA 5C3IB 3KXBC 3WTPD 3AZIA 4J8XD 1KX3D 3W98A 4Z66D 2IO5C 2LY8A 3AZJC 1F66B 3AZND 1P3KA 1M1AA 1A7WA 3B0CT 4ZUXA 5GSUB 5BT1C 3AZLC 5AV6A 5B0YB 2JSSA 3AV2A 2RVQC 5B40C 5E5AD 3LELA 1P3BB 5B2JC 3X1VD 5B1LB 3AYWA 4Z2MG 1P3PB 3X1SA 5AV8B 3WTPC 3AZKB 4J8XC 1KX3C 4Z66C 5B2IB 3WAAA 1ULYA 1P34B 3B6GB 4LD9D 3LJAA 4H9OA 5CPIB 5E5AC 5CPKD 3O62D 5AVBD 1EQZB 3AFAD 3AZMD 4KUDD 3W97B 3REHD
chains in the Genus database with same CATH superfamily
2AROD 3AV1A 4HGAC 3B6FB 4R8PA 5AV5A 5GT0A 3FDDA 3KXBB 5JRGA 1P3OD 2XD5A 4LD9C 1N1JA 4UPKA 2IO5B 2Y2OA 3AZJB 5CPKC 2CV5D 5AY8D 3O62C 5B32G 3AZFD 4KGCA 3AZLB 3AFAC 4J8UD 3VH6T 3AZMC 1BH8A 4KUDC 5B40B 3REHC 1HTAA 2AROC 2L5AA 1P3LA 5B2JB 5F99A 3AZHA 3C1CD 3REKD 5DNNA 1P3FA 3WTPB 2BYKB 1P3OC 4J8XB 4H9SC 5B32D 1KX3B 3MGPD 4Z66B 5GT3D 4Z5TA 2CV5C 4YM6A 3AZFC 2JE5A 4XZQD 4J8UC 1JFIA 2NQBA 5E5AB 4UUZA 3X1VB 5CPJA 5BO0B 1H3OA 3C1CC 3REKC 3NQUB 3C1BA 4J8VD 5B32C 1TZYA 3MGPC 1P3AA 3IP4C 4HGAB 5GT3C 3RELD 1PZRA 4XZQC 1U35A 2YFWA 3A1KA 4LD9B 3X1TD 2HIOA 3MNND 5BS7A 5CPKB 2FFFB 3O62B 3EPHA 5AVBB 3AZGD 5DNMA 3AFAB 3AZMB 4CSRB 4KUDB 5JA4B 5BNXA 4J8VC 3REHB 2J8PA 2AROB 5CP6D 3V9RB 1S32C 2F2AC 3W96A 2W8SA 3RELC 1P3MD 4G92C 3MVDD 1P3OB 3X1TC 3MNNC 2CV5B 3X1UD 3AZFB 1P34A 5BNVA 3UT9D 3B0CW 4X23D 3AZGC 4J8UB 2BYMA 2Y2MA 5CP6C 4WNNA 4WU8D 3C1CB 3REKB 1P3MC 1F1EA 1KX4A 1AOIA 3MVDC 4WU9A 4KHAA 5B32B 3MGPB 3B6FA 2Y2KA 5GT3B 3REID 2YFVA 3MGQD 3MGRA 4XZQB 4DRAA 3UT9C 4X23C 3KUYD 3MGSD 3AZJA 2F8ND 2NZDD 1BH9B 3AZED 3W99D 4WU8C 5B0ZD 3H0MC 2Y2NA 4H9RB 5KDMB 3AZID 4J8VB 3W98D 2CWEA 3WKJA 1M19A 1P3KD 3UTBD 3REIC 1M1AD 4ZUXD 3RELB 4XUJA 4G92B 3A1IA 5AV6D 3MGQC 3AV2D 4NFTA 3WTPA 3X1TB 4J8XA 3LELD 4WJ3C 3MNNB 3KUYC 3MGSC 2NZDC 3AZNA 3AYWD 3AZEC 3W99C 3X1SD 5B0ZC 3AZGB 1P3IA 1KX5D 3AZIC 3W98C 5FUGB 3VH6W 5CP6B 1HQ3A 3WAAD 3X1VA 1P3KC 4H9NB 4E45A 3UTBC 1M1AC 3R45A 4ZUXC 4YS3A 1P3MB 4NE3A 3NQJA 5AVCD 3AN2D 3LJAD 5AV6C 3MVDB 3AV2C 5CHLB 5GXQA 3LELC 2ZY2A 3X1UB 3AYWC 3UT9B 3X1SC 4X23B 1KX5C 5G49B 3B0DC 2Y2HA 1TAFB 3AV1D 4H9QB 3WAAC 5AV5D 3TU4A 5AVBA 4WU8B 2BG1A 3REJA 5JRGD 5AVCC 3AN2C 4CSRA 5AV9A 3VH5T 5JA4A 3LJAC 4CAYB 3REHA 1ZLAA 4WV4B 3REIB 2FJ7A 3V9RA 3UTAA 4QLCA 4KGCD 3MGQB 3KUYB 3MGSB 3AV1C 2F8NB 2NZDB 5F99D 5AY8A 5GT0C 5AV5C 3AZEB 3AZFA 3W99B 1P3FD 5B0ZB 5JRGC 3AZIB 2PYOA 4H9PB 3W98B 1B67A 5B1MA 4Z5TD 1P3KB 3UTBB 1M1AB 4YM6D 4ZUXB 4J8WA 3LZ0A 3KFUG 4KGCC 5AV6B 5B33A 3AV2B 2NQBD 5B32A 3LELB 1P3LC 3WA9D 5CPJD 5F99C 3LZ1A 5B31A 3AZHC 1Z2CB 4JJNA 3AYWB 1S32D 1P3FC 3X1SB 3C1BD 1KX5B 1WWIA 1M18A 3B0DB 3H0RC 1TZYD 1P3AD 1R4VA 3WAAB 4Z5TC 1F66A 4YM6C 5AVCB 3AN2B 2JCHA 5GSUA 3LJAB 1U35D 4J8VA 4H9OB 4NE6A 2HIOD 5B0YA 2NQBC 3WA9C 5B24D 5CPJC 1P3BA 5DNMD 5B1LA 4E44A 3C1BC 2G5HC 1P3PA 3A6ND 5AV8A 1TZYC 3MNNA 3AV1B 3AZKA 1P3AC 5AV5B 2ZY5A 3W96D 5B2IA 2UWXA 5JRGB 1U35C 3B6GA 1P3GD 1N1JB 2HIOC 2DQNC 2Y2GA 5CPIA 5B24C 4KGCB 5DNMC 1BH8B 2F8NG 3EPJA 1EQZA 3W97A 1P3LB 3A6NC 2RIQA 5F99B 3X1UA 3W96C 1KX4D 1P3FB 3F6TA 4WU9D 3VH6A 1P3GC 3KXBA 1ID3D 4EO5C 4Z5TB 4YM6B 3MGRD 3KWQD 3AZLA 2Y2QA 1JFIB 3AL0C 2NQBB 5B40A 3WA9B 4UUZB 5CPJB 1H3OB 5B2JA 4WZSB 1KX4C 3MGQA 1S32B 1AOIC 3C1BB 4WU9C 4AWLC 1TZYB 2VQRA 2BYKA 1P3AB 3MGSA 1M19D 1KX3A 3WKJD 1ID3C 4Z66A 4XUJD 3W99A 2G5IC 3MGRC 1U35B 2YFWB 3KWQC 2HIOB 4H9PA 3VH5W 5B24B 5E5AA 3UTBA 5BO0A 5DNMB 1P3ID 5BNXB 3NQUA 1HQ3D 3A6NB 3WKJC 1M19C 4YS3D 3EPLA 4M6BA 3W96B 4XUJC 1KX5A 3H0LC 3B0BA 5GXQD 1P3GB 4LD9A 4EO5B 3AZNC 5CPKA 4Z2MH 5BNVB 3O62A 4R8PD 5GT0D 5AVCA 3AN2A 1P3IC 2DF4C 2BYMB 1W2EA 3AFAA 3AZMA 4KUDA 1HQ3C 3EPKA 2AROA 4WNNB 3X1VC 3TU4D 4YS3C 1KX4B 3REJD 1AOIB 5AV9D 4WU9B 4KHAB 1ZLAD 5GXQC 4AWLB 4G91C 1P3OA 4H9SA 1ID3B 2YFVB 1P3LD 3UTAD 2FJ7D 4QLCD 2CV5A 3MGRB 3AZHD 4R8PC 5DNND 3KWQB 4J8UA 4ZBJC 2ZM5A 3TU4C 2ZY3A 5AVBC 3REJC 3C1CA 5AV9C 3REKA 2PYOD 5B31G 1ZLAC 2Y2JA 5B1MD 3WKJB 1M19B 2ZY4A 3MGPA 2FJ7C 3UTAC 4J8WD 3LZ0D 4QLCC 5GT3A 4XUJB 5B33D 5DNNC 4XZQA 2Y2PA 3LZ1D 3AZNB 5AY8C 5B31D 4JJND 1BH9A 2F8NK 1P3IB 1M18D 2PYOC 4H9RA 5KDMA 1HQ3B 3WA9A 5B1MC 1WWSA 1F66D 3R45B 4J8WC 4YS3B 3LZ0C 3NQJB 5GSUD 1S32A 3RELA 5B33C 5GXQB 1BFMA 5B0YD 4G91B 3X1TA 1P3BD 3LZ1C 5B31C 4JJNC 5B1LD 4R8PB 5GT0B 4DQYB 1KU5A 1M18C 1P3PD 3AZGA 2HUEC 5C3IC 5AV8D 3AZKD 4ZBJB 5FUGA 1Q9CA 2Y2LA 5CP6A 5BS7C 5B24A 3TU4B 1F66C 5B2ID 4H9NA 3REJB 1P34D 3B6GD 5GSUC 5AV9B 1P3MA 1ZLAB 3MVDA 5B0YC 3A6NA 5CPID 3EG5B 2FJ7B 3UTAB 1P3BC 4QLCB 3AZHB 5B1LC 1T3UA 5DNNB 1EQZD 3VH5A 1P3GA 1AOID 3UT9A 1P3PC 1B6WA 4X23A 3W97D 5AV8C 5G49A 3AZKC 3KSYA 1TAFA 5AY8B 3B6FD 4H9QA 5B2IC 1P34C 4WU8A 2PYOB 3B6GC 3KXBD 4CAYA 5CPIC 5B1MB 3AZJD 4NE5A 4J8WB 3LZ0B 3REIA 3WTPE 5B33B 5BT1D 3AZLD 1EQZC 2RVQD 5B40D 3W97C 4DRBA 1ID3A 3KUYA 5B2JD 3LZ1B 2F8NA 5B31B 2F8NH 3X1UC 4JJNB 3B6FC 2NZDA 3AZEA 1M18B 3KWQA 2HUEB 2XD1A 5C3IB 5B0ZA 3WTPD 3KXBC 3AZIA 4J8XD 1KX3D 3W98A 4Z66D 2IO5C 2LY8A 3AZJC 1F66B 3AZND 1P3KA 1M1AA 1A7WA 3B0CT 4ZUXA 5GSUB 5BT1C 3AZLC 5AV6A 5B0YB 2JSSA 3AV2A 2RVQC 5B40C 5E5AD 3LELA 1P3BB 2Y2IA 5B2JC 3X1VD 5B1LB 3AYWA 4Z2MG 1P3PB 3X1SA 5AV8B 3WTPC 3AZKB 4J8XC 1KX3C 3P5JB 4Z66C 5B2IB 3WAAA 1ULYA 1P34B 3B6GB 4LD9D 3LJAA 4H9OA 5CPIB 5E5AC 5CPKD 3O62D 5AVBD 1EQZB 3AFAD 3AZMD 4KUDD 3W97B 3REHD
chains in the Genus database with same CATH topology
2AROD 3AV1A 4HGAC 3B6FB 4R8PA 5AV5A 5GT0A 3FDDA 3KXBB 5JRGA 1P3OD 2XD5A 4LD9C 1N1JA 4UPKA 2IO5B 2Y2OA 3AZJB 5CPKC 2CV5D 5AY8D 3O62C 5B32G 3AZFD 4KGCA 3AZLB 3AFAC 4J8UD 3VH6T 3AZMC 1BH8A 4KUDC 5B40B 3REHC 1HTAA 2AROC 2L5AA 1P3LA 5B2JB 5F99A 3AZHA 3C1CD 3REKD 5DNNA 1P3FA 3WTPB 2BYKB 1P3OC 4J8XB 4H9SC 5B32D 1KX3B 3MGPD 4Z66B 5GT3D 4Z5TA 2CV5C 4YM6A 3AZFC 2JE5A 4XZQD 4J8UC 1JFIA 2NQBA 5E5AB 4UUZA 3X1VB 5CPJA 5BO0B 1H3OA 3C1CC 3REKC 3NQUB 3C1BA 4J8VD 5B32C 1TZYA 3MGPC 1P3AA 3IP4C 4HGAB 5GT3C 3RELD 1PZRA 4XZQC 1U35A 2YFWA 3A1KA 4LD9B 3X1TD 2HIOA 3MNND 5BS7A 5CPKB 2FFFB 3O62B 3EPHA 5AVBB 3AZGD 5DNMA 3AFAB 3AZMB 4CSRB 4KUDB 5JA4B 5BNXA 4J8VC 3REHB 2J8PA 2AROB 5CP6D 3V9RB 1S32C 2F2AC 3W96A 2W8SA 3RELC 1P3MD 4G92C 3MVDD 1P3OB 3X1TC 3MNNC 2CV5B 3X1UD 3AZFB 1P34A 5BNVA 3UT9D 3B0CW 4X23D 3AZGC 4J8UB 2BYMA 2Y2MA 5CP6C 4WNNA 4WU8D 3C1CB 3REKB 1P3MC 1F1EA 1KX4A 1AOIA 3MVDC 4WU9A 4KHAA 5B32B 3MGPB 3B6FA 2Y2KA 5GT3B 3REID 2YFVA 3MGQD 3MGRA 4XZQB 4DRAA 3UT9C 4X23C 3KUYD 3MGSD 3AZJA 2F8ND 2NZDD 1BH9B 3AZED 3W99D 4WU8C 5B0ZD 3H0MC 2Y2NA 4H9RB 5KDMB 3AZID 4J8VB 3W98D 2CWEA 3WKJA 1M19A 1P3KD 3UTBD 3REIC 1M1AD 4ZUXD 3RELB 4XUJA 4G92B 3A1IA 5AV6D 3MGQC 3AV2D 4NFTA 3WTPA 3X1TB 4J8XA 3LELD 4WJ3C 3MNNB 3KUYC 3MGSC 2NZDC 3AZNA 3AYWD 3AZEC 3W99C 3X1SD 5B0ZC 3AZGB 1P3IA 1KX5D 3AZIC 3W98C 5FUGB 3VH6W 5CP6B 1HQ3A 3WAAD 3X1VA 1P3KC 4H9NB 4E45A 3UTBC 1M1AC 3R45A 4ZUXC 4YS3A 1P3MB 4NE3A 3NQJA 5AVCD 3AN2D 3LJAD 5AV6C 3MVDB 3AV2C 5CHLB 5GXQA 3LELC 2ZY2A 3X1UB 3AYWC 3UT9B 3X1SC 4X23B 1KX5C 5G49B 3B0DC 2Y2HA 1TAFB 3AV1D 4H9QB 3WAAC 5AV5D 3TU4A 5AVBA 4WU8B 2BG1A 3REJA 5JRGD 5AVCC 3AN2C 4CSRA 5AV9A 3VH5T 5JA4A 3LJAC 4CAYB 3REHA 1ZLAA 4WV4B 3REIB 2FJ7A 3V9RA 3UTAA 4QLCA 4KGCD 3MGQB 3KUYB 3MGSB 3AV1C 2F8NB 2NZDB 5F99D 5AY8A 5GT0C 5AV5C 3AZEB 3AZFA 3W99B 1P3FD 5B0ZB 5JRGC 3AZIB 2PYOA 4H9PB 3W98B 1B67A 5B1MA 4Z5TD 1P3KB 3UTBB 1M1AB 4YM6D 4ZUXB 4J8WA 3LZ0A 3KFUG 4KGCC 5AV6B 5B33A 3AV2B 2NQBD 5B32A 3LELB 1P3LC 3WA9D 5CPJD 5F99C 3LZ1A 5B31A 3AZHC 1Z2CB 4JJNA 3AYWB 1S32D 1P3FC 3X1SB 3C1BD 1KX5B 1WWIA 1M18A 3B0DB 3H0RC 1TZYD 1P3AD 1R4VA 3WAAB 4Z5TC 1F66A 4YM6C 5AVCB 3AN2B 2JCHA 5GSUA 3LJAB 1U35D 4J8VA 4H9OB 4NE6A 2HIOD 5B0YA 2NQBC 3WA9C 5B24D 5CPJC 1P3BA 5DNMD 5B1LA 4E44A 3C1BC 2G5HC 1P3PA 3A6ND 5AV8A 1TZYC 3MNNA 3AV1B 3AZKA 1P3AC 5AV5B 2ZY5A 3W96D 5B2IA 2UWXA 5JRGB 1U35C 3B6GA 1P3GD 1N1JB 2HIOC 2DQNC 2Y2GA 5CPIA 5B24C 4KGCB 5DNMC 1BH8B 2F8NG 3EPJA 1EQZA 3W97A 1P3LB 3A6NC 2RIQA 5F99B 3X1UA 3W96C 1KX4D 1P3FB 3F6TA 4WU9D 3VH6A 1P3GC 3KXBA 1ID3D 4EO5C 4Z5TB 4YM6B 3MGRD 3KWQD 3AZLA 2Y2QA 1JFIB 3AL0C 2NQBB 5B40A 3WA9B 4UUZB 5CPJB 1H3OB 5B2JA 4WZSB 1KX4C 3MGQA 1S32B 1AOIC 3C1BB 4WU9C 4AWLC 1TZYB 2VQRA 2BYKA 1P3AB 3MGSA 1M19D 1KX3A 3WKJD 1ID3C 4Z66A 4XUJD 3W99A 2G5IC 3MGRC 1U35B 2YFWB 3KWQC 2HIOB 4H9PA 3VH5W 5B24B 5E5AA 3UTBA 5BO0A 5DNMB 1P3ID 5BNXB 3NQUA 1HQ3D 3A6NB 3WKJC 1M19C 4YS3D 3EPLA 4M6BA 3W96B 4XUJC 1KX5A 3H0LC 3B0BA 5GXQD 1P3GB 4LD9A 4EO5B 3AZNC 5CPKA 4Z2MH 5BNVB 3O62A 4R8PD 5GT0D 5AVCA 3AN2A 1P3IC 2DF4C 2BYMB 1W2EA 3AFAA 3AZMA 4KUDA 1HQ3C 3EPKA 2AROA 4WNNB 3X1VC 3TU4D 4YS3C 1KX4B 3REJD 1AOIB 5AV9D 4WU9B 4KHAB 1ZLAD 5GXQC 4AWLB 4G91C 1P3OA 4H9SA 1ID3B 2YFVB 1P3LD 3UTAD 2FJ7D 4QLCD 2CV5A 3MGRB 3AZHD 4R8PC 5DNND 3KWQB 4J8UA 4ZBJC 2ZM5A 3TU4C 2ZY3A 5AVBC 3REJC 3C1CA 5AV9C 3REKA 2PYOD 5B31G 1ZLAC 2Y2JA 5B1MD 3WKJB 1M19B 2ZY4A 3MGPA 2FJ7C 3UTAC 4J8WD 3LZ0D 4QLCC 5GT3A 4XUJB 5B33D 5DNNC 4XZQA 2Y2PA 3LZ1D 3AZNB 5AY8C 5B31D 4JJND 1BH9A 2F8NK 1P3IB 1M18D 2PYOC 4H9RA 5KDMA 1HQ3B 3WA9A 5B1MC 1WWSA 1F66D 3R45B 4J8WC 4YS3B 3LZ0C 3NQJB 5GSUD 1S32A 3RELA 5B33C 5GXQB 1BFMA 5B0YD 4G91B 3X1TA 1P3BD 3LZ1C 5B31C 4JJNC 5B1LD 4R8PB 5GT0B 4DQYB 1KU5A 1M18C 1P3PD 3AZGA 2HUEC 5C3IC 5AV8D 3AZKD 4ZBJB 5FUGA 1Q9CA 2Y2LA 5CP6A 5BS7C 5B24A 3TU4B 1F66C 5B2ID 4H9NA 3REJB 1P34D 3B6GD 5GSUC 5AV9B 1P3MA 1ZLAB 3MVDA 5B0YC 3A6NA 5CPID 3EG5B 2FJ7B 3UTAB 1P3BC 4QLCB 3AZHB 5B1LC 1T3UA 5DNNB 1EQZD 3VH5A 1P3GA 1AOID 3UT9A 1P3PC 1B6WA 4X23A 3W97D 5AV8C 5G49A 3AZKC 3KSYA 1TAFA 5AY8B 3B6FD 4H9QA 5B2IC 1P34C 4WU8A 2PYOB 3B6GC 3KXBD 4CAYA 5CPIC 5B1MB 3AZJD 4NE5A 4J8WB 3LZ0B 3REIA 3WTPE 5B33B 5BT1D 3AZLD 1EQZC 2RVQD 5B40D 3W97C 4DRBA 1ID3A 3KUYA 5B2JD 3LZ1B 2F8NA 5B31B 2F8NH 3X1UC 4JJNB 3B6FC 2NZDA 3AZEA 1M18B 3KWQA 2HUEB 2XD1A 5C3IB 5B0ZA 3WTPD 3KXBC 3AZIA 4J8XD 1KX3D 3W98A 4Z66D 2IO5C 2LY8A 3AZJC 1F66B 3AZND 1P3KA 1M1AA 1A7WA 3B0CT 4ZUXA 5GSUB 5BT1C 3AZLC 5AV6A 5B0YB 2JSSA 3AV2A 2RVQC 5B40C 5E5AD 3LELA 1P3BB 2Y2IA 5B2JC 3X1VD 5B1LB 3AYWA 4Z2MG 1P3PB 3X1SA 5AV8B 3WTPC 3AZKB 4J8XC 1KX3C 3P5JB 4Z66C 5B2IB 3WAAA 1ULYA 1P34B 3B6GB 4LD9D 3LJAA 4H9OA 5CPIB 5E5AC 5CPKD 3O62D 5AVBD 1EQZB 3AFAD 3AZMD 4KUDD 3W97B 3REHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO D;  3AV1 A;  4HGA C;  3B6F B;  4R8P A;  5AV5 A;  5GT0 A;  3KXB B;  5JRG A;  1P3O D;  4LD9 C;  1N1J A;  2IO5 B;  3AZJ B;  5CPK C;  2CV5 D;  5AY8 D;  3O62 C;  5B32 G;  3AZF D;  4KGC A;  3AZL B;  3AFA C;  4J8U D;  3VH6 T;  3AZM C;  1BH8 A;  4KUD C;  5B40 B;  3REH C;  1HTA A;  2ARO C;  2L5A A;  1P3L A;  5B2J B;  5F99 A;  3AZH A;  3C1C D;  3REK D;  5DNN A;  1P3F A;  3WTP B;  2BYK B;  1P3O C;  4J8X B;  4H9S C;  5B32 D;  1KX3 B;  3MGP D;  4Z66 B;  5GT3 D;  4Z5T A;  2CV5 C;  4YM6 A;  3AZF C;  4XZQ D;  4J8U C;  1JFI A;  2NQB A;  5E5A B;  4UUZ A;  3X1V B;  5CPJ A;  5BO0 B;  1H3O A;  3C1C C;  3REK C;  3NQU B;  3C1B A;  4J8V D;  5B32 C;  1TZY A;  3MGP C;  1P3A A;  4HGA B;  5GT3 C;  3REL D;  4XZQ C;  1U35 A;  2YFW A;  4LD9 B;  3X1T D;  2HIO A;  3MNN D;  5BS7 A;  5CPK B;  3O62 B;  5AVB B;  3AZG D;  5DNM A;  3AFA B;  3AZM B;  4CSR B;  4KUD B;  5JA4 B;  5BNX A;  4J8V C;  3REH B;  2ARO B;  5CP6 D;  3V9R B;  1S32 C;  3W96 A;  3REL C;  1P3M D;  4G92 C;  3MVD D;  1P3O B;  3X1T C;  3MNN C;  2CV5 B;  3X1U D;  3AZF B;  1P34 A;  5BNV A;  3UT9 D;  3B0C W;  4X23 D;  3AZG C;  4J8U B;  2BYM A;  5CP6 C;  4WNN A;  4WU8 D;  3C1C B;  3REK B;  1P3M C;  1F1E A;  1KX4 A;  1AOI A;  3MVD C;  4WU9 A;  4KHA A;  5B32 B;  3MGP B;  3B6F A;  5GT3 B;  3REI D;  2YFV A;  3MGQ D;  3MGR A;  4XZQ B;  4DRA A;  3UT9 C;  4X23 C;  3KUY D;  3MGS D;  3AZJ A;  2F8N D;  2NZD D;  1BH9 B;  3AZE D;  3W99 D;  4WU8 C;  5B0Z D;  4H9R B;  5KDM B;  3AZI D;  4J8V B;  3W98 D;  2CWE A;  3WKJ A;  1M19 A;  1P3K D;  3UTB D;  3REI C;  1M1A D;  4ZUX D;  3REL B;  4XUJ A;  4G92 B;  5AV6 D;  3MGQ C;  3AV2 D;  4NFT A;  3WTP A;  3X1T B;  4J8X A;  3LEL D;  3MNN B;  3KUY C;  3MGS C;  2NZD C;  3AZN A;  3AYW D;  3AZE C;  3W99 C;  3X1S D;  5B0Z C;  3AZG B;  1P3I A;  1KX5 D;  3AZI C;  3W98 C;  5FUG B;  3VH6 W;  5CP6 B;  1HQ3 A;  3WAA D;  3X1V A;  1P3K C;  4H9N B;  4E45 A;  3UTB C;  1M1A C;  3R45 A;  4ZUX C;  4YS3 A;  1P3M B;  4NE3 A;  3NQJ A;  5AVC D;  3AN2 D;  3LJA D;  5AV6 C;  3MVD B;  3AV2 C;  5CHL B;  5GXQ A;  3LEL C;  3X1U B;  3AYW C;  3UT9 B;  3X1S C;  4X23 B;  1KX5 C;  5G49 B;  3B0D C;  1TAF B;  3AV1 D;  4H9Q B;  3WAA C;  5AV5 D;  3TU4 A;  5AVB A;  4WU8 B;  3REJ A;  5JRG D;  5AVC C;  3AN2 C;  4CSR A;  5AV9 A;  3VH5 T;  5JA4 A;  3LJA C;  4CAY B;  3REH A;  1ZLA A;  4WV4 B;  3REI B;  2FJ7 A;  3V9R A;  3UTA A;  4QLC A;  4KGC D;  3MGQ B;  3KUY B;  3MGS B;  3AV1 C;  2F8N B;  2NZD B;  5F99 D;  5AY8 A;  5GT0 C;  5AV5 C;  3AZE B;  3AZF A;  3W99 B;  1P3F D;  5B0Z B;  5JRG C;  3AZI B;  2PYO A;  4H9P B;  3W98 B;  1B67 A;  5B1M A;  4Z5T D;  1P3K B;  3UTB B;  1M1A B;  4YM6 D;  4ZUX B;  4J8W A;  3LZ0 A;  4KGC C;  5AV6 B;  5B33 A;  3AV2 B;  2NQB D;  5B32 A;  3LEL B;  1P3L C;  3WA9 D;  5CPJ D;  5F99 C;  3LZ1 A;  5B31 A;  3AZH C;  3AYW B;  4JJN A;  1S32 D;  1P3F C;  3X1S B;  3C1B D;  1KX5 B;  1WWI A;  1M18 A;  3B0D B;  1TZY D;  1P3A D;  1R4V A;  3WAA B;  4Z5T C;  1F66 A;  4YM6 C;  5AVC B;  3AN2 B;  1U35 D;  5GSU A;  3LJA B;  4J8V A;  4H9O B;  4NE6 A;  2HIO D;  5B0Y A;  2NQB C;  3WA9 C;  5B24 D;  5CPJ C;  1P3B A;  5DNM D;  5B1L A;  4E44 A;  3C1B C;  1P3P A;  3A6N D;  5AV8 A;  1TZY C;  3MNN A;  3AV1 B;  3AZK A;  1P3A C;  5AV5 B;  3W96 D;  5B2I A;  5JRG B;  1U35 C;  3B6G A;  1P3G D;  1N1J B;  2HIO C;  5CPI A;  5B24 C;  4KGC B;  5DNM C;  1BH8 B;  2F8N G;  1EQZ A;  3W97 A;  1P3L B;  3A6N C;  5F99 B;  3X1U A;  3W96 C;  1KX4 D;  1P3F B;  4WU9 D;  3VH6 A;  1P3G C;  3KXB A;  1ID3 D;  4EO5 C;  4Z5T B;  4YM6 B;  3MGR D;  3KWQ D;  3AZL A;  1JFI B;  2NQB B;  5B40 A;  3WA9 B;  4UUZ B;  5CPJ B;  1H3O B;  5B2J A;  4WZS B;  1KX4 C;  3MGQ A;  1S32 B;  1AOI C;  3C1B B;  4WU9 C;  4AWL C;  1TZY B;  1P3A B;  2BYK A;  3WKJ D;  3MGS A;  1M19 D;  1KX3 A;  1ID3 C;  4Z66 A;  4XUJ D;  3W99 A;  3MGR C;  1U35 B;  2YFW B;  3KWQ C;  2HIO B;  4H9P A;  3VH5 W;  5B24 B;  5E5A A;  3UTB A;  5BO0 A;  5DNM B;  1P3I D;  5BNX B;  3NQU A;  1HQ3 D;  3A6N B;  3WKJ C;  1M19 C;  4YS3 D;  4M6B A;  3W96 B;  4XUJ C;  1KX5 A;  3B0B A;  5GXQ D;  1P3G B;  4LD9 A;  4EO5 B;  3AZN C;  5CPK A;  4Z2M H;  5BNV B;  3O62 A;  4R8P D;  5GT0 D;  5AVC A;  3AN2 A;  1P3I C;  2BYM B;  3AFA A;  3AZM A;  4KUD A;  1HQ3 C;  2ARO A;  4WNN B;  3X1V C;  3TU4 D;  4YS3 C;  1KX4 B;  3REJ D;  1AOI B;  5AV9 D;  4WU9 B;  4KHA B;  1ZLA D;  5GXQ C;  4AWL B;  4G91 C;  1P3O A;  4H9S A;  1ID3 B;  2YFV B;  1P3L D;  3UTA D;  2FJ7 D;  4QLC D;  2CV5 A;  3MGR B;  3AZH D;  4R8P C;  5DNN D;  3KWQ B;  4J8U A;  4ZBJ C;  3TU4 C;  5AVB C;  3REJ C;  3C1C A;  5AV9 C;  3REK A;  2PYO D;  5B31 G;  1ZLA C;  5B1M D;  3WKJ B;  1M19 B;  3MGP A;  2FJ7 C;  3UTA C;  4J8W D;  3LZ0 D;  4QLC C;  5GT3 A;  4XUJ B;  5B33 D;  5DNN C;  4XZQ A;  3LZ1 D;  3AZN B;  5AY8 C;  5B31 D;  4JJN D;  1BH9 A;  2F8N K;  1P3I B;  1M18 D;  2PYO C;  4H9R A;  5KDM A;  1HQ3 B;  3WA9 A;  5B1M C;  1WWS A;  1F66 D;  3R45 B;  4J8W C;  4YS3 B;  3LZ0 C;  3NQJ B;  5GSU D;  1S32 A;  3REL A;  5B33 C;  5GXQ B;  1BFM A;  5B0Y D;  4G91 B;  3X1T A;  1P3B D;  3LZ1 C;  5B31 C;  4JJN C;  5B1L D;  4R8P B;  5GT0 B;  1KU5 A;  1M18 C;  1P3P D;  3AZG A;  2HUE C;  5C3I C;  5AV8 D;  3AZK D;  4ZBJ B;  5FUG A;  1Q9C A;  5B24 A;  5CP6 A;  5BS7 C;  3TU4 B;  1F66 C;  5B2I D;  4H9N A;  3REJ B;  1P34 D;  3B6G D;  5GSU C;  5AV9 B;  1P3M A;  1ZLA B;  3MVD A;  5B0Y C;  3A6N A;  5CPI D;  2FJ7 B;  3UTA B;  1P3B C;  4QLC B;  3AZH B;  5B1L C;  5DNN B;  1EQZ D;  3VH5 A;  1P3G A;  1AOI D;  3UT9 A;  1P3P C;  1B6W A;  4X23 A;  3W97 D;  5AV8 C;  5G49 A;  3AZK C;  3KSY A;  1TAF A;  5AY8 B;  3B6F D;  4H9Q A;  5B2I C;  1P34 C;  4WU8 A;  2PYO B;  3B6G C;  3KXB D;  4CAY A;  5CPI C;  5B1M B;  3AZJ D;  4NE5 A;  4J8W B;  3LZ0 B;  3REI A;  3WTP E;  5B33 B;  5BT1 D;  3AZL D;  1EQZ C;  2RVQ D;  5B40 D;  3W97 C;  4DRB A;  1ID3 A;  3KUY A;  5B2J D;  3LZ1 B;  2F8N A;  5B31 B;  2F8N H;  3X1U C;  4JJN B;  3B6F C;  2NZD A;  3AZE A;  1M18 B;  3KWQ A;  2HUE B;  5B0Z A;  5C3I B;  3KXB C;  3WTP D;  3AZI A;  4J8X D;  1KX3 D;  3W98 A;  4Z66 D;  2IO5 C;  2LY8 A;  3AZJ C;  1F66 B;  3AZN D;  1P3K A;  1M1A A;  1A7W A;  3B0C T;  4ZUX A;  5GSU B;  5BT1 C;  3AZL C;  5AV6 A;  5B0Y B;  2JSS A;  3AV2 A;  2RVQ C;  5B40 C;  5E5A D;  3LEL A;  1P3B B;  5B2J C;  3X1V D;  5B1L B;  3AYW A;  4Z2M G;  1P3P B;  3X1S A;  5AV8 B;  3WTP C;  3AZK B;  4J8X C;  1KX3 C;  4Z66 C;  5B2I B;  3WAA A;  1ULY A;  1P34 B;  3B6G B;  4LD9 D;  3LJA A;  4H9O A;  5CPI B;  5E5A C;  5CPK D;  3O62 D;  5AVB D;  1EQZ B;  3AFA D;  3AZM D;  4KUD D;  3W97 B;  3REH D; 
#chains in the Genus database with same CATH topology
 2ARO D;  3AV1 A;  4HGA C;  3B6F B;  4R8P A;  5AV5 A;  5GT0 A;  3FDD A;  3KXB B;  5JRG A;  1P3O D;  2XD5 A;  4LD9 C;  1N1J A;  4UPK A;  2IO5 B;  2Y2O A;  3AZJ B;  5CPK C;  2CV5 D;  5AY8 D;  3O62 C;  5B32 G;  3AZF D;  4KGC A;  3AZL B;  3AFA C;  4J8U D;  3VH6 T;  3AZM C;  1BH8 A;  4KUD C;  5B40 B;  3REH C;  1HTA A;  2ARO C;  2L5A A;  1P3L A;  5B2J B;  5F99 A;  3AZH A;  3C1C D;  3REK D;  5DNN A;  1P3F A;  3WTP B;  2BYK B;  1P3O C;  4J8X B;  4H9S C;  5B32 D;  1KX3 B;  3MGP D;  4Z66 B;  5GT3 D;  4Z5T A;  2CV5 C;  4YM6 A;  3AZF C;  2JE5 A;  4XZQ D;  4J8U C;  1JFI A;  2NQB A;  5E5A B;  4UUZ A;  3X1V B;  5CPJ A;  5BO0 B;  1H3O A;  3C1C C;  3REK C;  3NQU B;  3C1B A;  4J8V D;  5B32 C;  1TZY A;  3MGP C;  1P3A A;  3IP4 C;  4HGA B;  5GT3 C;  3REL D;  1PZR A;  4XZQ C;  1U35 A;  2YFW A;  3A1K A;  4LD9 B;  3X1T D;  2HIO A;  3MNN D;  5BS7 A;  5CPK B;  2FFF B;  3O62 B;  3EPH A;  5AVB B;  3AZG D;  5DNM A;  3AFA B;  3AZM B;  4CSR B;  4KUD B;  5JA4 B;  5BNX A;  4J8V C;  3REH B;  2J8P A;  2ARO B;  5CP6 D;  3V9R B;  1S32 C;  2F2A C;  3W96 A;  2W8S A;  3REL C;  1P3M D;  4G92 C;  3MVD D;  1P3O B;  3X1T C;  3MNN C;  2CV5 B;  3X1U D;  3AZF B;  1P34 A;  5BNV A;  3UT9 D;  3B0C W;  4X23 D;  3AZG C;  4J8U B;  2BYM A;  2Y2M A;  5CP6 C;  4WNN A;  4WU8 D;  3C1C B;  3REK B;  1P3M C;  1F1E A;  1KX4 A;  1AOI A;  3MVD C;  4WU9 A;  4KHA A;  5B32 B;  3MGP B;  3B6F A;  2Y2K A;  5GT3 B;  3REI D;  2YFV A;  3MGQ D;  3MGR A;  4XZQ B;  4DRA A;  3UT9 C;  4X23 C;  3KUY D;  3MGS D;  3AZJ A;  2F8N D;  2NZD D;  1BH9 B;  3AZE D;  3W99 D;  4WU8 C;  5B0Z D;  3H0M C;  2Y2N A;  4H9R B;  5KDM B;  3AZI D;  4J8V B;  3W98 D;  2CWE A;  3WKJ A;  1M19 A;  1P3K D;  3UTB D;  3REI C;  1M1A D;  4ZUX D;  3REL B;  4XUJ A;  4G92 B;  3A1I A;  5AV6 D;  3MGQ C;  3AV2 D;  4NFT A;  3WTP A;  3X1T B;  4J8X A;  3LEL D;  4WJ3 C;  3MNN B;  3KUY C;  3MGS C;  2NZD C;  3AZN A;  3AYW D;  3AZE C;  3W99 C;  3X1S D;  5B0Z C;  3AZG B;  1P3I A;  1KX5 D;  3AZI C;  3W98 C;  5FUG B;  3VH6 W;  5CP6 B;  1HQ3 A;  3WAA D;  3X1V A;  1P3K C;  4H9N B;  4E45 A;  3UTB C;  1M1A C;  3R45 A;  4ZUX C;  4YS3 A;  1P3M B;  4NE3 A;  3NQJ A;  5AVC D;  3AN2 D;  3LJA D;  5AV6 C;  3MVD B;  3AV2 C;  5CHL B;  5GXQ A;  3LEL C;  2ZY2 A;  3X1U B;  3AYW C;  3UT9 B;  3X1S C;  4X23 B;  1KX5 C;  5G49 B;  3B0D C;  2Y2H A;  1TAF B;  3AV1 D;  4H9Q B;  3WAA C;  5AV5 D;  3TU4 A;  5AVB A;  4WU8 B;  2BG1 A;  3REJ A;  5JRG D;  5AVC C;  3AN2 C;  4CSR A;  5AV9 A;  3VH5 T;  5JA4 A;  3LJA C;  4CAY B;  3REH A;  1ZLA A;  4WV4 B;  3REI B;  2FJ7 A;  3V9R A;  3UTA A;  4QLC A;  4KGC D;  3MGQ B;  3KUY B;  3MGS B;  3AV1 C;  2F8N B;  2NZD B;  5F99 D;  5AY8 A;  5GT0 C;  5AV5 C;  3AZE B;  3AZF A;  3W99 B;  1P3F D;  5B0Z B;  5JRG C;  3AZI B;  2PYO A;  4H9P B;  3W98 B;  1B67 A;  5B1M A;  4Z5T D;  1P3K B;  3UTB B;  1M1A B;  4YM6 D;  4ZUX B;  4J8W A;  3LZ0 A;  3KFU G;  4KGC C;  5AV6 B;  5B33 A;  3AV2 B;  2NQB D;  5B32 A;  3LEL B;  1P3L C;  3WA9 D;  5CPJ D;  5F99 C;  3LZ1 A;  5B31 A;  3AZH C;  1Z2C B;  4JJN A;  3AYW B;  1S32 D;  1P3F C;  3X1S B;  3C1B D;  1KX5 B;  1WWI A;  1M18 A;  3B0D B;  3H0R C;  1TZY D;  1P3A D;  1R4V A;  3WAA B;  4Z5T C;  1F66 A;  4YM6 C;  5AVC B;  3AN2 B;  2JCH A;  5GSU A;  3LJA B;  1U35 D;  4J8V A;  4H9O B;  4NE6 A;  2HIO D;  5B0Y A;  2NQB C;  3WA9 C;  5B24 D;  5CPJ C;  1P3B A;  5DNM D;  5B1L A;  4E44 A;  3C1B C;  2G5H C;  1P3P A;  3A6N D;  5AV8 A;  1TZY C;  3MNN A;  3AV1 B;  3AZK A;  1P3A C;  5AV5 B;  2ZY5 A;  3W96 D;  5B2I A;  2UWX A;  5JRG B;  1U35 C;  3B6G A;  1P3G D;  1N1J B;  2HIO C;  2DQN C;  2Y2G A;  5CPI A;  5B24 C;  4KGC B;  5DNM C;  1BH8 B;  2F8N G;  3EPJ A;  1EQZ A;  3W97 A;  1P3L B;  3A6N C;  2RIQ A;  5F99 B;  3X1U A;  3W96 C;  1KX4 D;  1P3F B;  3F6T A;  4WU9 D;  3VH6 A;  1P3G C;  3KXB A;  1ID3 D;  4EO5 C;  4Z5T B;  4YM6 B;  3MGR D;  3KWQ D;  3AZL A;  2Y2Q A;  1JFI B;  3AL0 C;  2NQB B;  5B40 A;  3WA9 B;  4UUZ B;  5CPJ B;  1H3O B;  5B2J A;  4WZS B;  1KX4 C;  3MGQ A;  1S32 B;  1AOI C;  3C1B B;  4WU9 C;  4AWL C;  1TZY B;  2VQR A;  2BYK A;  1P3A B;  3MGS A;  1M19 D;  1KX3 A;  3WKJ D;  1ID3 C;  4Z66 A;  4XUJ D;  3W99 A;  2G5I C;  3MGR C;  1U35 B;  2YFW B;  3KWQ C;  2HIO B;  4H9P A;  3VH5 W;  5B24 B;  5E5A A;  3UTB A;  5BO0 A;  5DNM B;  1P3I D;  5BNX B;  3NQU A;  1HQ3 D;  3A6N B;  3WKJ C;  1M19 C;  4YS3 D;  3EPL A;  4M6B A;  3W96 B;  4XUJ C;  1KX5 A;  3H0L C;  3B0B A;  5GXQ D;  1P3G B;  4LD9 A;  4EO5 B;  3AZN C;  5CPK A;  4Z2M H;  5BNV B;  3O62 A;  4R8P D;  5GT0 D;  5AVC A;  3AN2 A;  1P3I C;  2DF4 C;  2BYM B;  1W2E A;  3AFA A;  3AZM A;  4KUD A;  1HQ3 C;  3EPK A;  2ARO A;  4WNN B;  3X1V C;  3TU4 D;  4YS3 C;  1KX4 B;  3REJ D;  1AOI B;  5AV9 D;  4WU9 B;  4KHA B;  1ZLA D;  5GXQ C;  4AWL B;  4G91 C;  1P3O A;  4H9S A;  1ID3 B;  2YFV B;  1P3L D;  3UTA D;  2FJ7 D;  4QLC D;  2CV5 A;  3MGR B;  3AZH D;  4R8P C;  5DNN D;  3KWQ B;  4J8U A;  4ZBJ C;  2ZM5 A;  3TU4 C;  2ZY3 A;  5AVB C;  3REJ C;  3C1C A;  5AV9 C;  3REK A;  2PYO D;  5B31 G;  1ZLA C;  2Y2J A;  5B1M D;  3WKJ B;  1M19 B;  2ZY4 A;  3MGP A;  2FJ7 C;  3UTA C;  4J8W D;  3LZ0 D;  4QLC C;  5GT3 A;  4XUJ B;  5B33 D;  5DNN C;  4XZQ A;  2Y2P A;  3LZ1 D;  3AZN B;  5AY8 C;  5B31 D;  4JJN D;  1BH9 A;  2F8N K;  1P3I B;  1M18 D;  2PYO C;  4H9R A;  5KDM A;  1HQ3 B;  3WA9 A;  5B1M C;  1WWS A;  1F66 D;  3R45 B;  4J8W C;  4YS3 B;  3LZ0 C;  3NQJ B;  5GSU D;  1S32 A;  3REL A;  5B33 C;  5GXQ B;  1BFM A;  5B0Y D;  4G91 B;  3X1T A;  1P3B D;  3LZ1 C;  5B31 C;  4JJN C;  5B1L D;  4R8P B;  5GT0 B;  4DQY B;  1KU5 A;  1M18 C;  1P3P D;  3AZG A;  2HUE C;  5C3I C;  5AV8 D;  3AZK D;  4ZBJ B;  5FUG A;  1Q9C A;  2Y2L A;  5CP6 A;  5BS7 C;  5B24 A;  3TU4 B;  1F66 C;  5B2I D;  4H9N A;  3REJ B;  1P34 D;  3B6G D;  5GSU C;  5AV9 B;  1P3M A;  1ZLA B;  3MVD A;  5B0Y C;  3A6N A;  5CPI D;  3EG5 B;  2FJ7 B;  3UTA B;  1P3B C;  4QLC B;  3AZH B;  5B1L C;  1T3U A;  5DNN B;  1EQZ D;  3VH5 A;  1P3G A;  1AOI D;  3UT9 A;  1P3P C;  1B6W A;  4X23 A;  3W97 D;  5AV8 C;  5G49 A;  3AZK C;  3KSY A;  1TAF A;  5AY8 B;  3B6F D;  4H9Q A;  5B2I C;  1P34 C;  4WU8 A;  2PYO B;  3B6G C;  3KXB D;  4CAY A;  5CPI C;  5B1M B;  3AZJ D;  4NE5 A;  4J8W B;  3LZ0 B;  3REI A;  3WTP E;  5B33 B;  5BT1 D;  3AZL D;  1EQZ C;  2RVQ D;  5B40 D;  3W97 C;  4DRB A;  1ID3 A;  3KUY A;  5B2J D;  3LZ1 B;  2F8N A;  5B31 B;  2F8N H;  3X1U C;  4JJN B;  3B6F C;  2NZD A;  3AZE A;  1M18 B;  3KWQ A;  2HUE B;  2XD1 A;  5C3I B;  5B0Z A;  3WTP D;  3KXB C;  3AZI A;  4J8X D;  1KX3 D;  3W98 A;  4Z66 D;  2IO5 C;  2LY8 A;  3AZJ C;  1F66 B;  3AZN D;  1P3K A;  1M1A A;  1A7W A;  3B0C T;  4ZUX A;  5GSU B;  5BT1 C;  3AZL C;  5AV6 A;  5B0Y B;  2JSS A;  3AV2 A;  2RVQ C;  5B40 C;  5E5A D;  3LEL A;  1P3B B;  2Y2I A;  5B2J C;  3X1V D;  5B1L B;  3AYW A;  4Z2M G;  1P3P B;  3X1S A;  5AV8 B;  3WTP C;  3AZK B;  4J8X C;  1KX3 C;  3P5J B;  4Z66 C;  5B2I B;  3WAA A;  1ULY A;  1P34 B;  3B6G B;  4LD9 D;  3LJA A;  4H9O A;  5CPI B;  5E5A C;  5CPK D;  3O62 D;  5AVB D;  1EQZ B;  3AFA D;  3AZM D;  4KUD D;  3W97 B;  3REH D; 
#chains in the Genus database with same CATH homology
 2ARO D;  3AV1 A;  4HGA C;  3B6F B;  4R8P A;  5AV5 A;  5GT0 A;  3FDD A;  3KXB B;  5JRG A;  1P3O D;  2XD5 A;  4LD9 C;  1N1J A;  4UPK A;  2IO5 B;  2Y2O A;  3AZJ B;  5CPK C;  2CV5 D;  5AY8 D;  3O62 C;  5B32 G;  3AZF D;  4KGC A;  3AZL B;  3AFA C;  4J8U D;  3VH6 T;  3AZM C;  1BH8 A;  4KUD C;  5B40 B;  3REH C;  1HTA A;  2ARO C;  2L5A A;  1P3L A;  5B2J B;  5F99 A;  3AZH A;  3C1C D;  3REK D;  5DNN A;  1P3F A;  3WTP B;  2BYK B;  1P3O C;  4J8X B;  4H9S C;  5B32 D;  1KX3 B;  3MGP D;  4Z66 B;  5GT3 D;  4Z5T A;  2CV5 C;  4YM6 A;  3AZF C;  2JE5 A;  4XZQ D;  4J8U C;  1JFI A;  2NQB A;  5E5A B;  4UUZ A;  3X1V B;  5CPJ A;  5BO0 B;  1H3O A;  3C1C C;  3REK C;  3NQU B;  3C1B A;  4J8V D;  5B32 C;  1TZY A;  3MGP C;  1P3A A;  3IP4 C;  4HGA B;  5GT3 C;  3REL D;  1PZR A;  4XZQ C;  1U35 A;  2YFW A;  3A1K A;  4LD9 B;  3X1T D;  2HIO A;  3MNN D;  5BS7 A;  5CPK B;  2FFF B;  3O62 B;  3EPH A;  5AVB B;  3AZG D;  5DNM A;  3AFA B;  3AZM B;  4CSR B;  4KUD B;  5JA4 B;  5BNX A;  4J8V C;  3REH B;  2J8P A;  2ARO B;  5CP6 D;  3V9R B;  1S32 C;  2F2A C;  3W96 A;  2W8S A;  3REL C;  1P3M D;  4G92 C;  3MVD D;  1P3O B;  3X1T C;  3MNN C;  2CV5 B;  3X1U D;  3AZF B;  1P34 A;  5BNV A;  3UT9 D;  3B0C W;  4X23 D;  3AZG C;  4J8U B;  2BYM A;  2Y2M A;  5CP6 C;  4WNN A;  4WU8 D;  3C1C B;  3REK B;  1P3M C;  1F1E A;  1KX4 A;  1AOI A;  3MVD C;  4WU9 A;  4KHA A;  5B32 B;  3MGP B;  3B6F A;  2Y2K A;  5GT3 B;  3REI D;  2YFV A;  3MGQ D;  3MGR A;  4XZQ B;  4DRA A;  3UT9 C;  4X23 C;  3KUY D;  3MGS D;  3AZJ A;  2F8N D;  2NZD D;  1BH9 B;  3AZE D;  3W99 D;  4WU8 C;  5B0Z D;  3H0M C;  2Y2N A;  4H9R B;  5KDM B;  3AZI D;  4J8V B;  3W98 D;  2CWE A;  3WKJ A;  1M19 A;  1P3K D;  3UTB D;  3REI C;  1M1A D;  4ZUX D;  3REL B;  4XUJ A;  4G92 B;  3A1I A;  5AV6 D;  3MGQ C;  3AV2 D;  4NFT A;  3WTP A;  3X1T B;  4J8X A;  3LEL D;  4WJ3 C;  3MNN B;  3KUY C;  3MGS C;  2NZD C;  3AZN A;  3AYW D;  3AZE C;  3W99 C;  3X1S D;  5B0Z C;  3AZG B;  1P3I A;  1KX5 D;  3AZI C;  3W98 C;  5FUG B;  3VH6 W;  5CP6 B;  1HQ3 A;  3WAA D;  3X1V A;  1P3K C;  4H9N B;  4E45 A;  3UTB C;  1M1A C;  3R45 A;  4ZUX C;  4YS3 A;  1P3M B;  4NE3 A;  3NQJ A;  5AVC D;  3AN2 D;  3LJA D;  5AV6 C;  3MVD B;  3AV2 C;  5CHL B;  5GXQ A;  3LEL C;  2ZY2 A;  3X1U B;  3AYW C;  3UT9 B;  3X1S C;  4X23 B;  1KX5 C;  5G49 B;  3B0D C;  2Y2H A;  1TAF B;  3AV1 D;  4H9Q B;  3WAA C;  5AV5 D;  3TU4 A;  5AVB A;  4WU8 B;  2BG1 A;  3REJ A;  5JRG D;  5AVC C;  3AN2 C;  4CSR A;  5AV9 A;  3VH5 T;  5JA4 A;  3LJA C;  4CAY B;  3REH A;  1ZLA A;  4WV4 B;  3REI B;  2FJ7 A;  3V9R A;  3UTA A;  4QLC A;  4KGC D;  3MGQ B;  3KUY B;  3MGS B;  3AV1 C;  2F8N B;  2NZD B;  5F99 D;  5AY8 A;  5GT0 C;  5AV5 C;  3AZE B;  3AZF A;  3W99 B;  1P3F D;  5B0Z B;  5JRG C;  3AZI B;  2PYO A;  4H9P B;  3W98 B;  1B67 A;  5B1M A;  4Z5T D;  1P3K B;  3UTB B;  1M1A B;  4YM6 D;  4ZUX B;  4J8W A;  3LZ0 A;  3KFU G;  4KGC C;  5AV6 B;  5B33 A;  3AV2 B;  2NQB D;  5B32 A;  3LEL B;  1P3L C;  3WA9 D;  5CPJ D;  5F99 C;  3LZ1 A;  5B31 A;  3AZH C;  1Z2C B;  4JJN A;  3AYW B;  1S32 D;  1P3F C;  3X1S B;  3C1B D;  1KX5 B;  1WWI A;  1M18 A;  3B0D B;  3H0R C;  1TZY D;  1P3A D;  1R4V A;  3WAA B;  4Z5T C;  1F66 A;  4YM6 C;  5AVC B;  3AN2 B;  2JCH A;  5GSU A;  3LJA B;  1U35 D;  4J8V A;  4H9O B;  4NE6 A;  2HIO D;  5B0Y A;  2NQB C;  3WA9 C;  5B24 D;  5CPJ C;  1P3B A;  5DNM D;  5B1L A;  4E44 A;  3C1B C;  2G5H C;  1P3P A;  3A6N D;  5AV8 A;  1TZY C;  3MNN A;  3AV1 B;  3AZK A;  1P3A C;  5AV5 B;  2ZY5 A;  3W96 D;  5B2I A;  2UWX A;  5JRG B;  1U35 C;  3B6G A;  1P3G D;  1N1J B;  2HIO C;  2DQN C;  2Y2G A;  5CPI A;  5B24 C;  4KGC B;  5DNM C;  1BH8 B;  2F8N G;  3EPJ A;  1EQZ A;  3W97 A;  1P3L B;  3A6N C;  2RIQ A;  5F99 B;  3X1U A;  3W96 C;  1KX4 D;  1P3F B;  3F6T A;  4WU9 D;  3VH6 A;  1P3G C;  3KXB A;  1ID3 D;  4EO5 C;  4Z5T B;  4YM6 B;  3MGR D;  3KWQ D;  3AZL A;  2Y2Q A;  1JFI B;  3AL0 C;  2NQB B;  5B40 A;  3WA9 B;  4UUZ B;  5CPJ B;  1H3O B;  5B2J A;  4WZS B;  1KX4 C;  3MGQ A;  1S32 B;  1AOI C;  3C1B B;  4WU9 C;  4AWL C;  1TZY B;  2VQR A;  2BYK A;  1P3A B;  3MGS A;  1M19 D;  1KX3 A;  3WKJ D;  1ID3 C;  4Z66 A;  4XUJ D;  3W99 A;  2G5I C;  3MGR C;  1U35 B;  2YFW B;  3KWQ C;  2HIO B;  4H9P A;  3VH5 W;  5B24 B;  5E5A A;  3UTB A;  5BO0 A;  5DNM B;  1P3I D;  5BNX B;  3NQU A;  1HQ3 D;  3A6N B;  3WKJ C;  1M19 C;  4YS3 D;  3EPL A;  4M6B A;  3W96 B;  4XUJ C;  1KX5 A;  3H0L C;  3B0B A;  5GXQ D;  1P3G B;  4LD9 A;  4EO5 B;  3AZN C;  5CPK A;  4Z2M H;  5BNV B;  3O62 A;  4R8P D;  5GT0 D;  5AVC A;  3AN2 A;  1P3I C;  2DF4 C;  2BYM B;  1W2E A;  3AFA A;  3AZM A;  4KUD A;  1HQ3 C;  3EPK A;  2ARO A;  4WNN B;  3X1V C;  3TU4 D;  4YS3 C;  1KX4 B;  3REJ D;  1AOI B;  5AV9 D;  4WU9 B;  4KHA B;  1ZLA D;  5GXQ C;  4AWL B;  4G91 C;  1P3O A;  4H9S A;  1ID3 B;  2YFV B;  1P3L D;  3UTA D;  2FJ7 D;  4QLC D;  2CV5 A;  3MGR B;  3AZH D;  4R8P C;  5DNN D;  3KWQ B;  4J8U A;  4ZBJ C;  2ZM5 A;  3TU4 C;  2ZY3 A;  5AVB C;  3REJ C;  3C1C A;  5AV9 C;  3REK A;  2PYO D;  5B31 G;  1ZLA C;  2Y2J A;  5B1M D;  3WKJ B;  1M19 B;  2ZY4 A;  3MGP A;  2FJ7 C;  3UTA C;  4J8W D;  3LZ0 D;  4QLC C;  5GT3 A;  4XUJ B;  5B33 D;  5DNN C;  4XZQ A;  2Y2P A;  3LZ1 D;  3AZN B;  5AY8 C;  5B31 D;  4JJN D;  1BH9 A;  2F8N K;  1P3I B;  1M18 D;  2PYO C;  4H9R A;  5KDM A;  1HQ3 B;  3WA9 A;  5B1M C;  1WWS A;  1F66 D;  3R45 B;  4J8W C;  4YS3 B;  3LZ0 C;  3NQJ B;  5GSU D;  1S32 A;  3REL A;  5B33 C;  5GXQ B;  1BFM A;  5B0Y D;  4G91 B;  3X1T A;  1P3B D;  3LZ1 C;  5B31 C;  4JJN C;  5B1L D;  4R8P B;  5GT0 B;  4DQY B;  1KU5 A;  1M18 C;  1P3P D;  3AZG A;  2HUE C;  5C3I C;  5AV8 D;  3AZK D;  4ZBJ B;  5FUG A;  1Q9C A;  2Y2L A;  5CP6 A;  5BS7 C;  5B24 A;  3TU4 B;  1F66 C;  5B2I D;  4H9N A;  3REJ B;  1P34 D;  3B6G D;  5GSU C;  5AV9 B;  1P3M A;  1ZLA B;  3MVD A;  5B0Y C;  3A6N A;  5CPI D;  3EG5 B;  2FJ7 B;  3UTA B;  1P3B C;  4QLC B;  3AZH B;  5B1L C;  1T3U A;  5DNN B;  1EQZ D;  3VH5 A;  1P3G A;  1AOI D;  3UT9 A;  1P3P C;  1B6W A;  4X23 A;  3W97 D;  5AV8 C;  5G49 A;  3AZK C;  3KSY A;  1TAF A;  5AY8 B;  3B6F D;  4H9Q A;  5B2I C;  1P34 C;  4WU8 A;  2PYO B;  3B6G C;  3KXB D;  4CAY A;  5CPI C;  5B1M B;  3AZJ D;  4NE5 A;  4J8W B;  3LZ0 B;  3REI A;  3WTP E;  5B33 B;  5BT1 D;  3AZL D;  1EQZ C;  2RVQ D;  5B40 D;  3W97 C;  4DRB A;  1ID3 A;  3KUY A;  5B2J D;  3LZ1 B;  2F8N A;  5B31 B;  2F8N H;  3X1U C;  4JJN B;  3B6F C;  2NZD A;  3AZE A;  1M18 B;  3KWQ A;  2HUE B;  2XD1 A;  5C3I B;  5B0Z A;  3WTP D;  3KXB C;  3AZI A;  4J8X D;  1KX3 D;  3W98 A;  4Z66 D;  2IO5 C;  2LY8 A;  3AZJ C;  1F66 B;  3AZN D;  1P3K A;  1M1A A;  1A7W A;  3B0C T;  4ZUX A;  5GSU B;  5BT1 C;  3AZL C;  5AV6 A;  5B0Y B;  2JSS A;  3AV2 A;  2RVQ C;  5B40 C;  5E5A D;  3LEL A;  1P3B B;  2Y2I A;  5B2J C;  3X1V D;  5B1L B;  3AYW A;  4Z2M G;  1P3P B;  3X1S A;  5AV8 B;  3WTP C;  3AZK B;  4J8X C;  1KX3 C;  3P5J B;  4Z66 C;  5B2I B;  3WAA A;  1ULY A;  1P34 B;  3B6G B;  4LD9 D;  3LJA A;  4H9O A;  5CPI B;  5E5A C;  5CPK D;  3O62 D;  5AVB D;  1EQZ B;  3AFA D;  3AZM D;  4KUD D;  3W97 B;  3REH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...