2BYMB

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
AVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 28
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bymB00
1EQZC 4EO5B 1WWIA 1BH9A 5B32C 3REIA 5GT0B 3REID 5AV9C 3AN2C 1BFMA 3MGRC 2CWEA 3REKA 4XZQC 2RVQC 5AV6B 3REKD 2F8NK 5GT3C 5CPKA 1P3IC 4Z5TB 5AVCC 3AV2C 5CPKD 2BYMB 4WNNA 3AYWB 2NQBB 5BNXA 3VH5T 3W97B 5B33B 2HIOC 3MVDB 3W99C 1HQ3C 5B1MB 4UUZB 1P3GC 3MGQB 1JFIB 4NE3A 4YS3C 1U35B 3AZNC 3WA9C 3X1SB 4XUJB 1AOIB 3RELA 4KUDD 3MGSC 3RELD 5AY8C 5B24C 5B1LA 3UT9B 1M19A 2CV5C 4ZBJC 3KXBA 1BH9B 2JSSA 5B1LD 4Z66A 1M19D 3KXBD 4Z66D 3R45B 5B31C 3C1CC 4R8PC 1P3AC 2FJ7C 3REKB 4KHAA 1TAFB 3AZMC 4WU8A 4WU9B 2BYKA 5CPKB 4WU8D 4WNNB 3B6FA 4DRAA 3A6NA 3B6FD 1Q9CA 3A6ND 3VH6A 5CPIB 3AZIC 3VH5W 5AV8C 3LJAB 1M18C 3VH6T 2AROC 3AZKC 3TU4A 1P3FC 1R4VA 3TU4D 1KX4A 4J8WC 5C3IC 1M19B 2HUEC 3KXBB 3WKJB 3AZLC 1KX4D 3X1UB 4M6BA 4Z66B 5B0YA 1P3KA 4CAYB 5E5AB 4KGCB 5B0YD 1P3KD 3AZGA 5AV5A 5DNMC 1P3BA 3REHC 3AZGD 5AV5D 1M1AA 1P3BD 1M1AD 1ZLAA 3C1BC 2BYKB 1S32C 1ZLAD 1P3LA 1P3MB 1KX5C 1P34D 2IO5C 1P3LD 1ID3C 1KU5A 2PYOA 4X23B 5GSUA 4JJNA 4QLCC 5B0ZA 5GSUD 5JRGB 3LZ1C 4JJND 5B0ZD 3AV1C 3X1VA 3WTPB 4YM6A 3X1VD 3W96C 4YM6D 1P3PC 5BO0A 1N1JB 5GXQB 4LD9A 5B40A 1TZYB 5AV6A 3NQUB 4LD9D 3UTBA 5B40D 5AV6D 3UTBD 4Z5TA 5B2IC 2BYMA 5B2JB 3AYWA 1EQZA 4AWLB 3W97A 4Z5TD 5B33A 3NQJB 3MVDA 3LZ0B 5B1MA 3AYWD 1EQZD 4UUZA 3W97D 3REJA 5B33D 3MVDD 1JFIA 5B1MD 5BS7C 3AFAC 1B6WA 4J8XC 2LY8A 3REJD 3AZHC 5CP6C 3B0DB 3X1SA 3B0CT 2PYOB 5GSUB 4JJNB 1AOIA 1H3OB 3X1SD 3O62C 3X1TB 1AOID 3UT9A 5BT1C 3AZEB 5AVCA 3AZFC 3AV2A 3UT9D 3X1VB 5AVBC 4YM6B 5AVCD 3AV2D 4HGAB 1F66C 3W98C 3R45A 3B6GB 4ZUXB 1P3GA 3WAAA 4G91B 3KWQC 5BO0B 4H9RA 5GT0C 4YS3A 1P3GD 3WAAD 4LD9B 1TAFA 5B40B 4YS3D 3WTPE 2NZDB 4WU9A 3UTBB 3MNNB 4H9QA 4WU9D 5F99B 1EQZB 4J8UC 1P3OA 3REJB 3UTAC 5CPIA 1P3OD 3LJAA 5AV9B 3KUYC 5CPID 3MGRB 1U35C 4R8PA 3LJAD 1P3AA 4XUJC 4XZQB 4R8PD 3LELC 1P3AD 5DNNA 5GT3B 3B0CW 3WKJA 1P3IB 5AVCB 5DNND 3X1UA 3AV2B 3WKJD 3X1UD 4CAYA 2HIOB 5E5AA 3MGPC 3W99B 4KGCA 1P3GB 3WAAB 3REIC 5E5AD 4H9RB 4YS3B 4KGCD 3AZNB 3WA9B 1B67A 2AROA 3REKC 2AROD 4H9NA 4H9QB 3MGSB 5AY8B 5B24B 4ZBJB 1P3MA 4WZSB 1P3OB 1P3MD 5B31B 4X23A 4X23D 5JRGA 4R8PB 1P3AB 2FJ7B 5JRGD 4KUDC 3AZMB 5DNNB 3RELC 3WTPA 5B1LC 3WTPD 3KXBC 1N1JA 5GXQA 4G92B 1TZYA 5GXQD 3NQUA 3AZIB 5AV8B 1M18B 5FUGB 1TZYD 2AROB 5B2JA 4H9NB 1P3FB 4WU8C 3NQJA 5B2JD 3LZ0A 2YFVB 4Z2MG 4J8WB 5C3IB 2HUEB 3LZ0D 3AZLB 3B6FC 1KX3A 3A6NC 1F1EA 1KX3D 1H3OA 5DNMB 2PYOD 3REHB 3X1TA 3X1TD 3AZEA 3VH6W 3C1BB 3TU4C 3AZED 1S32B 4NE5A 1KX4C 3B6GA 3AZJA 4ZUXA 5JA4B 3B6GD 3AZJD 4ZUXD 1KX5B 2IO5B 5B0YC 4J8XA 5B32G 3AZHA 1P3KC 1ID3B 3AZHD 4J8XD 3B0BA 2NZDA 4J8VA 3MNNA 5AV5C 3O62A 3AZGC 1P3BC 2NZDD 4QLCB 3LZ1B 4J8VD 5F99A 3MNND 1M1AC 3AV1B 5F99D 5B32A 1ZLAC 5B32D 3W96B 1P34C 1KX3B 3AN2A 5AV9A 1P3LC 3KWQA 2F8NG 3MGRA 3AN2D 5AV9D 3KWQD 3MGRD 4XZQA 4CSRB 4JJNC 5CPJC 5GT3A 4XZQD 2RVQD 5B0ZC 1P3IA 2F8NH 5GT3D 4EO5C 5B2IB 4E44A 1P3ID 1WWSA 4H9SC 2HIOA 3X1VC 3W99A 1HQ3A 3AZJB 4J8UA 4E45A 2HIOD 3W99D 1HQ3D 3AFAB 4J8UD 3AZNA 3WA9A 3AZHB 4J8XB 5CP6B 3KUYA 3AZND 3WA9D 4J8VB 3O62B 3KUYD 5B31G 5B40C 2YFWB 5AV6C 5KDMA 3MGSA 5AY8A 5B24A 2CV5A 4Z5TC 3MGSD 5B32B 3AZFB 5AY8D 5B24D 3AYWC 2NQBC 5AVBB 2CV5D 3W97C 3MVDC 5B33C 1F66B 3W98B 5B1MC 5B31A 4H9OA 3MGPA 3REJC 3AN2B 3MGQC 3KWQB 3C1CA 5B31D 3MGPD 4NE6A 2FJ7A 3C1CD 3X1SC 2FJ7D 3AZMA 1AOIC 3AZMD 2F8NB 3UT9C 3VH5A 1HQ3B 4J8UB 3UTAB 3AZIA 3WAAC 5AV8A 1M18A 3V9RB 5FUGA 3KUYB 3AZID 5AV8D 3AZKA 1M18D 4H9PB 3AZKD 1P3FA 3LELB 4KUDA 5KDMB 4WU9C 2YFVA 5CPKC 1P3FD 4J8WA 2CV5B 3AZLA 4J8WD 3AZLD 1A7WA 4H9OB 4WV4B 3MGPB 1P3OC 3REIB 3C1CB 5DNMA 5CPIC 3REHA 3LJAC 5DNMD 3REHD 5BNVA 3C1BA 1S32A 3C1BD 5DNNC 1S32D 1M19C 3WKJC 5CHLB 5JA4A 3X1UC 1KX5A 4Z66C 5G49A 5BNXB 1ID3A 5E5AC 1KX5D 4KGCC 1ID3D 4G92C 4QLCA 3LZ1A 3AZKB 4QLCD 3AV1A 3LZ1D 4KUDB 3AV1D 3RELB 3W96A 5B1LB 1P3PA 1P3MC 1BH8A 3W96D 3KSYA 1P3PD 4Z2MH 4CSRA 4X23C 5JRGC 5BNVB 5B2IA 4KHAB 5B2ID 4WU8B 3WTPC 5BS7A 3AFAA 3B6FB 5G49B 1P34A 5CP6A 3AFAD 3A6NB 5GXQC 5CP6D 1TZYC 2YFWA 3O62D 5CPJA 1ULYA 5CPJD 4NFTA 3AZFA 5B2JC 3TU4B 5AVBA 5BT1D 4AWLC 2L5AA 3AZFD 1F66A 3LZ0C 4H9SA 3W98A 5AVBD 1KX4B 1F66D 1P3PB 3W98D 1BH8B 5GT0A 1KX3C 5B0YB 1P3KB 3B0DC 5GT0D 2PYOC 5GSUC 3AZGB 5AV5B 1P3BB 3X1TC 1M1AB 2F8NA 3AZEC 1ZLAB 2F8ND 2NQBA 4YM6C 4HGAC 3UTAA 2NQBD 3B6GC 3AZJC 4ZUXC 1P34B 4G91C 3V9RA 3MGQA 3UTAD 1P3LB 1U35A 3MGQD 4LD9C 4H9PA 1U35D 4DRBA 4XUJA 3LELA 2NZDC 1HTAA 4J8VC 3UTBC 3MNNC 5CPJB 4XUJD 3LELD 5B0ZB 5F99C
chains in the Genus database with same CATH superfamily
1EQZC 4EO5B 1T3UA 2ZM5A 1WWIA 1BH9A 5B32C 3REIA 2Y2LA 5GT0B 3REID 5AV9C 3AN2C 1BFMA 3MGRC 2CWEA 3REKA 4XZQC 2RVQC 5AV6B 3REKD 2F8NK 5GT3C 5CPKA 1P3IC 4Z5TB 5AVCC 3AV2C 5CPKD 2BYMB 4WNNA 3AYWB 2NQBB 5BNXA 3VH5T 3W97B 5B33B 2HIOC 3MVDB 3W99C 1HQ3C 5B1MB 4UUZB 1P3GC 3MGQB 1JFIB 2W8SA 4NE3A 4YS3C 1U35B 2F2AC 3AZNC 3WA9C 3X1SB 4XUJB 1AOIB 3RELA 4KUDD 3MGSC 3IP4C 3RELD 5AY8C 5B24C 5B1LA 3UT9B 1M19A 2CV5C 4ZBJC 3KXBA 1BH9B 2JSSA 5B1LD 4Z66A 1M19D 3KXBD 4DQYB 4Z66D 3R45B 5B31C 3C1CC 4R8PC 1P3AC 2FJ7C 3REKB 2ZY2A 4KHAA 1TAFB 3AZMC 4WU8A 4WU9B 2BYKA 5CPKB 4WU8D 4WNNB 3B6FA 4DRAA 2UWXA 3A6NA 3B6FD 1Q9CA 3A6ND 3VH6A 5CPIB 3AZIC 3VH5W 5AV8C 3LJAB 1M18C 3VH6T 2AROC 3AZKC 3TU4A 1P3FC 1R4VA 3TU4D 1KX4A 4J8WC 5C3IC 1M19B 2HUEC 3KXBB 3WKJB 3AZLC 1W2EA 1KX4D 3X1UB 4M6BA 4Z66B 5B0YA 1P3KA 2Y2NA 4CAYB 5E5AB 4KGCB 5B0YD 1P3KD 2JE5A 3AZGA 5AV5A 5DNMC 1P3BA 3REHC 3AZGD 5AV5D 1M1AA 1P3BD 3EPKA 1M1AD 1ZLAA 3C1BC 2BYKB 1S32C 1ZLAD 1PZRA 3KFUG 1P3LA 1P3MB 1KX5C 1P34D 2IO5C 1P3LD 1ID3C 1KU5A 2PYOA 4X23B 5GSUA 4JJNA 2XD5A 3H0LC 4QLCC 5B0ZA 5GSUD 5JRGB 3LZ1C 4JJND 5B0ZD 3AV1C 2Y2GA 3X1VA 3WTPB 4YM6A 3X1VD 3W96C 4YM6D 2DQNC 1P3PC 5BO0A 1N1JB 3H0MC 5GXQB 4LD9A 5B40A 1TZYB 5AV6A 3NQUB 4LD9D 3UTBA 5B40D 5AV6D 3UTBD 4Z5TA 5B2IC 2BYMA 5B2JB 3AYWA 1EQZA 4AWLB 3W97A 4Z5TD 5B33A 3NQJB 3MVDA 3LZ0B 5B1MA 3AYWD 1EQZD 4UUZA 3W97D 3REJA 5B33D 3MVDD 1JFIA 5B1MD 5BS7C 3AFAC 1B6WA 2FFFB 2LY8A 4J8XC 3REJD 2BG1A 5CP6C 3B0DB 3X1SA 3AZHC 3B0CT 2PYOB 5GSUB 4JJNB 1AOIA 1H3OB 3X1SD 3O62C 3X1TB 1AOID 3UT9A 5BT1C 3AZEB 5AVCA 3AZFC 3AV2A 3UT9D 3X1VB 5AVBC 4YM6B 5AVCD 3AV2D 4HGAB 1F66C 3W98C 3R45A 3B6GB 4ZUXB 1P3GA 3WAAA 4G91B 3KWQC 5BO0B 4H9RA 5GT0C 4YS3A 1P3GD 3WAAD 4LD9B 1TAFA 5B40B 4YS3D 3WTPE 2NZDB 4WU9A 3UTBB 3MNNB 2JCHA 4H9QA 4WU9D 5F99B 1EQZB 4J8UC 1P3OA 3REJB 3UTAC 3EPJA 5CPIA 1P3OD 3LJAA 3A1KA 5AV9B 3AL0C 3KUYC 5CPID 3MGRB 1U35C 4R8PA 3LJAD 1P3AA 3F6TA 4XUJC 4XZQB 4R8PD 3LELC 1P3AD 5DNNA 5GT3B 3B0CW 3WKJA 1P3IB 5AVCB 5DNND 3X1UA 3AV2B 3WKJD 2RIQA 4CAYA 2HIOB 5E5AA 3X1UD 3MGPC 3W99B 4KGCA 1P3GB 3WAAB 3REIC 5E5AD 4H9RB 4YS3B 4KGCD 3AZNB 3WA9B 1B67A 2AROA 2Y2MA 3REKC 3EG5B 2AROD 4H9NA 4H9QB 3MGSB 5AY8B 5B24B 4ZBJB 1P3MA 3H0RC 4WZSB 1P3OB 2VQRA 1P3MD 5B31B 4X23A 4X23D 5JRGA 4R8PB 1P3AB 2FJ7B 5JRGD 4KUDC 3AZMB 5DNNB 3RELC 3WTPA 5B1LC 3WTPD 3KXBC 1N1JA 5GXQA 2Y2HA 4G92B 1TZYA 5GXQD 3NQUA 3AZIB 5AV8B 1M18B 5FUGB 1TZYD 2AROB 2ZY5A 5B2JA 4H9NB 1P3FB 4WU8C 3NQJA 5B2JD 3LZ0A 2YFVB 4Z2MG 4J8WB 5C3IB 2HUEB 3LZ0D 3AZLB 3B6FC 1KX3A 3A6NC 1F1EA 1KX3D 1H3OA 5DNMB 2PYOD 3REHB 3X1TA 3X1TD 2G5HC 3AZEA 3VH6W 3C1BB 3TU4C 2ZY4A 3AZED 1S32B 4NE5A 1KX4C 3B6GA 3AZJA 4ZUXA 5JA4B 3EPLA 3B6GD 3AZJD 4ZUXD 1KX5B 2IO5B 5B0YC 4J8XA 5B32G 3AZHA 1P3KC 2Y2OA 1ID3B 4WJ3C 3AZHD 4J8XD 3B0BA 2NZDA 4J8VA 3MNNA 5AV5C 3O62A 3AZGC 1P3BC 2NZDD 4QLCB 3LZ1B 4J8VD 5F99A 3MNND 1M1AC 3AV1B 5F99D 5B32A 1ZLAC 5B32D 3W96B 1P34C 1KX3B 3AN2A 5AV9A 1P3LC 3KWQA 2F8NG 3MGRA 3AN2D 5AV9D 3KWQD 3MGRD 4XZQA 4CSRB 4JJNC 5CPJC 5GT3A 4XZQD 2RVQD 5B0ZC 1P3IA 2F8NH 5GT3D 4EO5C 5B2IB 4E44A 1P3ID 1WWSA 2HIOA 4H9SC 3X1VC 3W99A 1HQ3A 3AZJB 4J8UA 4E45A 2HIOD 3W99D 1HQ3D 3AFAB 4J8UD 3AZNA 3WA9A 3AZHB 4J8XB 5CP6B 3KUYA 3AZND 3WA9D 4J8VB 2ZY3A 3O62B 3KUYD 5B31G 5B40C 2YFWB 5AV6C 5KDMA 3MGSA 5AY8A 5B24A 2CV5A 4Z5TC 3MGSD 5B32B 3AZFB 5AY8D 5B24D 3AYWC 2NQBC 5AVBB 2CV5D 3W97C 3MVDC 5B33C 1F66B 3W98B 5B1MC 5B31A 4H9OA 3MGPA 3REJC 3AN2B 3MGQC 3KWQB 3C1CA 5B31D 3MGPD 4NE6A 2FJ7A 3C1CD 3X1SC 2FJ7D 3AZMA 1AOIC 3AZMD 2J8PA 3A1IA 2F8NB 3UT9C 1Z2CB 3VH5A 1HQ3B 4J8UB 3UTAB 3AZIA 3WAAC 5AV8A 2Y2KA 1M18A 3V9RB 5FUGA 3KUYB 3AZID 5AV8D 3AZKA 1M18D 4H9PB 3AZKD 1P3FA 3LELB 4KUDA 5KDMB 4WU9C 2YFVA 5CPKC 3FDDA 1P3FD 4J8WA 2CV5B 3AZLA 4J8WD 3AZLD 1A7WA 4H9OB 4WV4B 3MGPB 1P3OC 3REIB 3C1CB 5DNMA 5CPIC 3REHA 3LJAC 5DNMD 3REHD 5BNVA 3C1BA 1S32A 3C1BD 5DNNC 1S32D 1M19C 3WKJC 5CHLB 5JA4A 3X1UC 1KX5A 4Z66C 5G49A 5BNXB 1ID3A 5E5AC 2Y2JA 1KX5D 4KGCC 1ID3D 4G92C 4QLCA 3LZ1A 3AZKB 4QLCD 3AV1A 3LZ1D 4KUDB 3AV1D 3RELB 2Y2PA 3W96A 5B1LB 1P3PA 1P3MC 1BH8A 3W96D 3KSYA 1P3PD 4Z2MH 2XD1A 4CSRA 4X23C 2Y2IA 5JRGC 2Y2QA 5BNVB 5B2IA 4KHAB 2DF4C 4UPKA 5B2ID 4WU8B 3WTPC 5BS7A 3AFAA 3B6FB 5G49B 1P34A 5CP6A 3AFAD 3A6NB 5GXQC 5CP6D 1TZYC 2YFWA 3O62D 5CPJA 1ULYA 5CPJD 4NFTA 3AZFA 5B2JC 3TU4B 5AVBA 5BT1D 4AWLC 2L5AA 3AZFD 1F66A 3LZ0C 4H9SA 3W98A 5AVBD 1KX4B 1F66D 1P3PB 3W98D 1BH8B 5GT0A 1KX3C 5B0YB 1P3KB 3B0DC 5GT0D 2PYOC 5GSUC 3AZGB 2G5IC 5AV5B 3EPHA 1P3BB 3X1TC 1M1AB 2F8NA 3AZEC 1ZLAB 2F8ND 2NQBA 4YM6C 4HGAC 3UTAA 2NQBD 3B6GC 3AZJC 4ZUXC 1P34B 4G91C 3P5JB 3V9RA 3MGQA 3UTAD 1P3LB 1U35A 3MGQD 4LD9C 4H9PA 1U35D 4DRBA 4XUJA 3LELA 2NZDC 1HTAA 4J8VC 3UTBC 3MNNC 5CPJB 4XUJD 3LELD 5B0ZB 5F99C
chains in the Genus database with same CATH topology
1EQZC 4EO5B 1T3UA 2ZM5A 1WWIA 1BH9A 5B32C 3REIA 2Y2LA 5GT0B 3REID 5AV9C 3AN2C 1BFMA 3MGRC 2CWEA 3REKA 4XZQC 2RVQC 5AV6B 3REKD 2F8NK 5GT3C 5CPKA 1P3IC 4Z5TB 5AVCC 3AV2C 5CPKD 2BYMB 4WNNA 3AYWB 2NQBB 5BNXA 3VH5T 3W97B 5B33B 2HIOC 3MVDB 3W99C 1HQ3C 5B1MB 4UUZB 1P3GC 3MGQB 1JFIB 2W8SA 4NE3A 4YS3C 1U35B 2F2AC 3AZNC 3WA9C 3X1SB 4XUJB 1AOIB 3RELA 4KUDD 3MGSC 3IP4C 3RELD 5AY8C 5B24C 5B1LA 3UT9B 1M19A 2CV5C 4ZBJC 3KXBA 1BH9B 2JSSA 5B1LD 4Z66A 1M19D 3KXBD 4DQYB 4Z66D 3R45B 5B31C 3C1CC 4R8PC 1P3AC 2FJ7C 3REKB 2ZY2A 4KHAA 1TAFB 3AZMC 4WU8A 4WU9B 2BYKA 5CPKB 4WU8D 4WNNB 3B6FA 4DRAA 2UWXA 3A6NA 3B6FD 1Q9CA 3A6ND 3VH6A 5CPIB 3AZIC 3VH5W 5AV8C 3LJAB 1M18C 3VH6T 2AROC 3AZKC 3TU4A 1P3FC 1R4VA 3TU4D 1KX4A 4J8WC 5C3IC 1M19B 2HUEC 3KXBB 3WKJB 3AZLC 1W2EA 1KX4D 3X1UB 4M6BA 4Z66B 5B0YA 1P3KA 2Y2NA 4CAYB 5E5AB 4KGCB 5B0YD 1P3KD 2JE5A 3AZGA 5AV5A 5DNMC 1P3BA 3REHC 3AZGD 5AV5D 1M1AA 1P3BD 3EPKA 1M1AD 1ZLAA 3C1BC 2BYKB 1S32C 1ZLAD 1PZRA 3KFUG 1P3LA 1P3MB 1KX5C 1P34D 2IO5C 1P3LD 1ID3C 1KU5A 2PYOA 4X23B 5GSUA 4JJNA 2XD5A 3H0LC 4QLCC 5B0ZA 5GSUD 5JRGB 3LZ1C 4JJND 5B0ZD 3AV1C 2Y2GA 3X1VA 3WTPB 4YM6A 3X1VD 3W96C 4YM6D 2DQNC 1P3PC 5BO0A 1N1JB 3H0MC 5GXQB 4LD9A 5B40A 1TZYB 5AV6A 3NQUB 4LD9D 3UTBA 5B40D 5AV6D 3UTBD 4Z5TA 5B2IC 2BYMA 5B2JB 3AYWA 1EQZA 4AWLB 3W97A 4Z5TD 5B33A 3NQJB 3MVDA 3LZ0B 5B1MA 3AYWD 1EQZD 4UUZA 3W97D 3REJA 5B33D 3MVDD 1JFIA 5B1MD 5BS7C 3AFAC 1B6WA 2FFFB 2LY8A 4J8XC 3REJD 2BG1A 5CP6C 3B0DB 3X1SA 3AZHC 3B0CT 2PYOB 5GSUB 4JJNB 1AOIA 1H3OB 3X1SD 3O62C 3X1TB 1AOID 3UT9A 5BT1C 3AZEB 5AVCA 3AZFC 3AV2A 3UT9D 3X1VB 5AVBC 4YM6B 5AVCD 3AV2D 4HGAB 1F66C 3W98C 3R45A 3B6GB 4ZUXB 1P3GA 3WAAA 4G91B 3KWQC 5BO0B 4H9RA 5GT0C 4YS3A 1P3GD 3WAAD 4LD9B 1TAFA 5B40B 4YS3D 3WTPE 2NZDB 4WU9A 3UTBB 3MNNB 2JCHA 4H9QA 4WU9D 5F99B 1EQZB 4J8UC 1P3OA 3REJB 3UTAC 3EPJA 5CPIA 1P3OD 3LJAA 3A1KA 5AV9B 3AL0C 3KUYC 5CPID 3MGRB 1U35C 4R8PA 3LJAD 1P3AA 3F6TA 4XUJC 4XZQB 4R8PD 3LELC 1P3AD 5DNNA 5GT3B 3B0CW 3WKJA 1P3IB 5AVCB 5DNND 3X1UA 3AV2B 3WKJD 2RIQA 4CAYA 2HIOB 5E5AA 3X1UD 3MGPC 3W99B 4KGCA 1P3GB 3WAAB 3REIC 5E5AD 4H9RB 4YS3B 4KGCD 3AZNB 3WA9B 1B67A 2AROA 2Y2MA 3REKC 3EG5B 2AROD 4H9NA 4H9QB 3MGSB 5AY8B 5B24B 4ZBJB 1P3MA 3H0RC 4WZSB 1P3OB 2VQRA 1P3MD 5B31B 4X23A 4X23D 5JRGA 4R8PB 1P3AB 2FJ7B 5JRGD 4KUDC 3AZMB 5DNNB 3RELC 3WTPA 5B1LC 3WTPD 3KXBC 1N1JA 5GXQA 2Y2HA 4G92B 1TZYA 5GXQD 3NQUA 3AZIB 5AV8B 1M18B 5FUGB 1TZYD 2AROB 2ZY5A 5B2JA 4H9NB 1P3FB 4WU8C 3NQJA 5B2JD 3LZ0A 2YFVB 4Z2MG 4J8WB 5C3IB 2HUEB 3LZ0D 3AZLB 3B6FC 1KX3A 3A6NC 1F1EA 1KX3D 1H3OA 5DNMB 2PYOD 3REHB 3X1TA 3X1TD 2G5HC 3AZEA 3VH6W 3C1BB 3TU4C 2ZY4A 3AZED 1S32B 4NE5A 1KX4C 3B6GA 3AZJA 4ZUXA 5JA4B 3EPLA 3B6GD 3AZJD 4ZUXD 1KX5B 2IO5B 5B0YC 4J8XA 5B32G 3AZHA 1P3KC 2Y2OA 1ID3B 4WJ3C 3AZHD 4J8XD 3B0BA 2NZDA 4J8VA 3MNNA 5AV5C 3O62A 3AZGC 1P3BC 2NZDD 4QLCB 3LZ1B 4J8VD 5F99A 3MNND 1M1AC 3AV1B 5F99D 5B32A 1ZLAC 5B32D 3W96B 1P34C 1KX3B 3AN2A 5AV9A 1P3LC 3KWQA 2F8NG 3MGRA 3AN2D 5AV9D 3KWQD 3MGRD 4XZQA 4CSRB 4JJNC 5CPJC 5GT3A 4XZQD 2RVQD 5B0ZC 1P3IA 2F8NH 5GT3D 4EO5C 5B2IB 4E44A 1P3ID 1WWSA 2HIOA 4H9SC 3X1VC 3W99A 1HQ3A 3AZJB 4J8UA 4E45A 2HIOD 3W99D 1HQ3D 3AFAB 4J8UD 3AZNA 3WA9A 3AZHB 4J8XB 5CP6B 3KUYA 3AZND 3WA9D 4J8VB 2ZY3A 3O62B 3KUYD 5B31G 5B40C 2YFWB 5AV6C 5KDMA 3MGSA 5AY8A 5B24A 2CV5A 4Z5TC 3MGSD 5B32B 3AZFB 5AY8D 5B24D 3AYWC 2NQBC 5AVBB 2CV5D 3W97C 3MVDC 5B33C 1F66B 3W98B 5B1MC 5B31A 4H9OA 3MGPA 3REJC 3AN2B 3MGQC 3KWQB 3C1CA 5B31D 3MGPD 4NE6A 2FJ7A 3C1CD 3X1SC 2FJ7D 3AZMA 1AOIC 3AZMD 2J8PA 3A1IA 2F8NB 3UT9C 1Z2CB 3VH5A 1HQ3B 4J8UB 3UTAB 3AZIA 3WAAC 5AV8A 2Y2KA 1M18A 3V9RB 5FUGA 3KUYB 3AZID 5AV8D 3AZKA 1M18D 4H9PB 3AZKD 1P3FA 3LELB 4KUDA 5KDMB 4WU9C 2YFVA 5CPKC 3FDDA 1P3FD 4J8WA 2CV5B 3AZLA 4J8WD 3AZLD 1A7WA 4H9OB 4WV4B 3MGPB 1P3OC 3REIB 3C1CB 5DNMA 5CPIC 3REHA 3LJAC 5DNMD 3REHD 5BNVA 3C1BA 1S32A 3C1BD 5DNNC 1S32D 1M19C 3WKJC 5CHLB 5JA4A 3X1UC 1KX5A 4Z66C 5G49A 5BNXB 1ID3A 5E5AC 2Y2JA 1KX5D 4KGCC 1ID3D 4G92C 4QLCA 3LZ1A 3AZKB 4QLCD 3AV1A 3LZ1D 4KUDB 3AV1D 3RELB 2Y2PA 3W96A 5B1LB 1P3PA 1P3MC 1BH8A 3W96D 3KSYA 1P3PD 4Z2MH 2XD1A 4CSRA 4X23C 2Y2IA 5JRGC 2Y2QA 5BNVB 5B2IA 4KHAB 2DF4C 4UPKA 5B2ID 4WU8B 3WTPC 5BS7A 3AFAA 3B6FB 5G49B 1P34A 5CP6A 3AFAD 3A6NB 5GXQC 5CP6D 1TZYC 2YFWA 3O62D 5CPJA 1ULYA 5CPJD 4NFTA 3AZFA 5B2JC 3TU4B 5AVBA 5BT1D 4AWLC 2L5AA 3AZFD 1F66A 3LZ0C 4H9SA 3W98A 5AVBD 1KX4B 1F66D 1P3PB 3W98D 1BH8B 5GT0A 1KX3C 5B0YB 1P3KB 3B0DC 5GT0D 2PYOC 5GSUC 3AZGB 2G5IC 5AV5B 3EPHA 1P3BB 3X1TC 1M1AB 2F8NA 3AZEC 1ZLAB 2F8ND 2NQBA 4YM6C 4HGAC 3UTAA 2NQBD 3B6GC 3AZJC 4ZUXC 1P34B 4G91C 3P5JB 3V9RA 3MGQA 3UTAD 1P3LB 1U35A 3MGQD 4LD9C 4H9PA 1U35D 4DRBA 4XUJA 3LELA 2NZDC 1HTAA 4J8VC 3UTBC 3MNNC 5CPJB 4XUJD 3LELD 5B0ZB 5F99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ C;  4EO5 B;  1WWI A;  1BH9 A;  5B32 C;  3REI A;  5GT0 B;  3REI D;  5AV9 C;  3AN2 C;  1BFM A;  3MGR C;  2CWE A;  3REK A;  4XZQ C;  2RVQ C;  5AV6 B;  3REK D;  2F8N K;  5GT3 C;  5CPK A;  1P3I C;  4Z5T B;  5AVC C;  3AV2 C;  5CPK D;  2BYM B;  4WNN A;  3AYW B;  2NQB B;  5BNX A;  3VH5 T;  3W97 B;  5B33 B;  2HIO C;  3MVD B;  3W99 C;  1HQ3 C;  5B1M B;  4UUZ B;  1P3G C;  3MGQ B;  1JFI B;  4NE3 A;  4YS3 C;  1U35 B;  3AZN C;  3WA9 C;  3X1S B;  4XUJ B;  1AOI B;  3REL A;  4KUD D;  3MGS C;  3REL D;  5AY8 C;  5B24 C;  5B1L A;  3UT9 B;  1M19 A;  2CV5 C;  4ZBJ C;  3KXB A;  1BH9 B;  2JSS A;  5B1L D;  4Z66 A;  1M19 D;  3KXB D;  4Z66 D;  3R45 B;  5B31 C;  3C1C C;  4R8P C;  1P3A C;  2FJ7 C;  3REK B;  4KHA A;  1TAF B;  3AZM C;  4WU8 A;  4WU9 B;  2BYK A;  5CPK B;  4WU8 D;  4WNN B;  3B6F A;  4DRA A;  3A6N A;  3B6F D;  1Q9C A;  3A6N D;  3VH6 A;  5CPI B;  3AZI C;  3VH5 W;  5AV8 C;  3LJA B;  1M18 C;  3VH6 T;  2ARO C;  3AZK C;  3TU4 A;  1P3F C;  1R4V A;  3TU4 D;  1KX4 A;  4J8W C;  5C3I C;  1M19 B;  2HUE C;  3KXB B;  3WKJ B;  3AZL C;  1KX4 D;  3X1U B;  4M6B A;  4Z66 B;  5B0Y A;  1P3K A;  4CAY B;  5E5A B;  4KGC B;  5B0Y D;  1P3K D;  3AZG A;  5AV5 A;  5DNM C;  1P3B A;  3REH C;  3AZG D;  5AV5 D;  1M1A A;  1P3B D;  1M1A D;  1ZLA A;  3C1B C;  2BYK B;  1S32 C;  1ZLA D;  1P3L A;  1P3M B;  1KX5 C;  1P34 D;  2IO5 C;  1P3L D;  1ID3 C;  1KU5 A;  2PYO A;  4X23 B;  5GSU A;  4JJN A;  4QLC C;  5B0Z A;  5GSU D;  5JRG B;  3LZ1 C;  4JJN D;  5B0Z D;  3AV1 C;  3X1V A;  3WTP B;  4YM6 A;  3X1V D;  3W96 C;  4YM6 D;  1P3P C;  5BO0 A;  1N1J B;  5GXQ B;  4LD9 A;  5B40 A;  1TZY B;  5AV6 A;  3NQU B;  4LD9 D;  3UTB A;  5B40 D;  5AV6 D;  3UTB D;  4Z5T A;  5B2I C;  2BYM A;  5B2J B;  3AYW A;  1EQZ A;  4AWL B;  3W97 A;  4Z5T D;  5B33 A;  3NQJ B;  3MVD A;  3LZ0 B;  5B1M A;  3AYW D;  1EQZ D;  4UUZ A;  3W97 D;  3REJ A;  5B33 D;  3MVD D;  1JFI A;  5B1M D;  5BS7 C;  3AFA C;  1B6W A;  4J8X C;  2LY8 A;  3REJ D;  3AZH C;  5CP6 C;  3B0D B;  3X1S A;  3B0C T;  2PYO B;  5GSU B;  4JJN B;  1AOI A;  1H3O B;  3X1S D;  3O62 C;  3X1T B;  1AOI D;  3UT9 A;  5BT1 C;  3AZE B;  5AVC A;  3AZF C;  3AV2 A;  3UT9 D;  3X1V B;  5AVB C;  4YM6 B;  5AVC D;  3AV2 D;  4HGA B;  1F66 C;  3W98 C;  3R45 A;  3B6G B;  4ZUX B;  1P3G A;  3WAA A;  4G91 B;  3KWQ C;  5BO0 B;  4H9R A;  5GT0 C;  4YS3 A;  1P3G D;  3WAA D;  4LD9 B;  1TAF A;  5B40 B;  4YS3 D;  3WTP E;  2NZD B;  4WU9 A;  3UTB B;  3MNN B;  4H9Q A;  4WU9 D;  5F99 B;  1EQZ B;  4J8U C;  1P3O A;  3REJ B;  3UTA C;  5CPI A;  1P3O D;  3LJA A;  5AV9 B;  3KUY C;  5CPI D;  3MGR B;  1U35 C;  4R8P A;  3LJA D;  1P3A A;  4XUJ C;  4XZQ B;  4R8P D;  3LEL C;  1P3A D;  5DNN A;  5GT3 B;  3B0C W;  3WKJ A;  1P3I B;  5AVC B;  5DNN D;  3X1U A;  3AV2 B;  3WKJ D;  3X1U D;  4CAY A;  2HIO B;  5E5A A;  3MGP C;  3W99 B;  4KGC A;  1P3G B;  3WAA B;  3REI C;  5E5A D;  4H9R B;  4YS3 B;  4KGC D;  3AZN B;  3WA9 B;  1B67 A;  2ARO A;  3REK C;  2ARO D;  4H9N A;  4H9Q B;  3MGS B;  5AY8 B;  5B24 B;  4ZBJ B;  1P3M A;  4WZS B;  1P3O B;  1P3M D;  5B31 B;  4X23 A;  4X23 D;  5JRG A;  4R8P B;  1P3A B;  2FJ7 B;  5JRG D;  4KUD C;  3AZM B;  5DNN B;  3REL C;  3WTP A;  5B1L C;  3WTP D;  3KXB C;  1N1J A;  5GXQ A;  4G92 B;  1TZY A;  5GXQ D;  3NQU A;  3AZI B;  5AV8 B;  1M18 B;  5FUG B;  1TZY D;  2ARO B;  5B2J A;  4H9N B;  1P3F B;  4WU8 C;  3NQJ A;  5B2J D;  3LZ0 A;  2YFV B;  4Z2M G;  4J8W B;  5C3I B;  2HUE B;  3LZ0 D;  3AZL B;  3B6F C;  1KX3 A;  3A6N C;  1F1E A;  1KX3 D;  1H3O A;  5DNM B;  2PYO D;  3REH B;  3X1T A;  3X1T D;  3AZE A;  3VH6 W;  3C1B B;  3TU4 C;  3AZE D;  1S32 B;  4NE5 A;  1KX4 C;  3B6G A;  3AZJ A;  4ZUX A;  5JA4 B;  3B6G D;  3AZJ D;  4ZUX D;  1KX5 B;  2IO5 B;  5B0Y C;  4J8X A;  5B32 G;  3AZH A;  1P3K C;  1ID3 B;  3AZH D;  4J8X D;  3B0B A;  2NZD A;  4J8V A;  3MNN A;  5AV5 C;  3O62 A;  3AZG C;  1P3B C;  2NZD D;  4QLC B;  3LZ1 B;  4J8V D;  5F99 A;  3MNN D;  1M1A C;  3AV1 B;  5F99 D;  5B32 A;  1ZLA C;  5B32 D;  3W96 B;  1P34 C;  1KX3 B;  3AN2 A;  5AV9 A;  1P3L C;  3KWQ A;  2F8N G;  3MGR A;  3AN2 D;  5AV9 D;  3KWQ D;  3MGR D;  4XZQ A;  4CSR B;  4JJN C;  5CPJ C;  5GT3 A;  4XZQ D;  2RVQ D;  5B0Z C;  1P3I A;  2F8N H;  5GT3 D;  4EO5 C;  5B2I B;  4E44 A;  1P3I D;  1WWS A;  4H9S C;  2HIO A;  3X1V C;  3W99 A;  1HQ3 A;  3AZJ B;  4J8U A;  4E45 A;  2HIO D;  3W99 D;  1HQ3 D;  3AFA B;  4J8U D;  3AZN A;  3WA9 A;  3AZH B;  4J8X B;  5CP6 B;  3KUY A;  3AZN D;  3WA9 D;  4J8V B;  3O62 B;  3KUY D;  5B31 G;  5B40 C;  2YFW B;  5AV6 C;  5KDM A;  3MGS A;  5AY8 A;  5B24 A;  2CV5 A;  4Z5T C;  3MGS D;  5B32 B;  3AZF B;  5AY8 D;  5B24 D;  3AYW C;  2NQB C;  5AVB B;  2CV5 D;  3W97 C;  3MVD C;  5B33 C;  1F66 B;  3W98 B;  5B1M C;  5B31 A;  4H9O A;  3MGP A;  3REJ C;  3AN2 B;  3MGQ C;  3KWQ B;  3C1C A;  5B31 D;  3MGP D;  4NE6 A;  2FJ7 A;  3C1C D;  3X1S C;  2FJ7 D;  3AZM A;  1AOI C;  3AZM D;  2F8N B;  3UT9 C;  3VH5 A;  1HQ3 B;  4J8U B;  3UTA B;  3AZI A;  3WAA C;  5AV8 A;  1M18 A;  3V9R B;  5FUG A;  3KUY B;  3AZI D;  5AV8 D;  3AZK A;  1M18 D;  4H9P B;  3AZK D;  1P3F A;  3LEL B;  4KUD A;  5KDM B;  4WU9 C;  2YFV A;  5CPK C;  1P3F D;  4J8W A;  2CV5 B;  3AZL A;  4J8W D;  3AZL D;  1A7W A;  4H9O B;  4WV4 B;  3MGP B;  1P3O C;  3REI B;  3C1C B;  5DNM A;  5CPI C;  3REH A;  3LJA C;  5DNM D;  3REH D;  5BNV A;  3C1B A;  1S32 A;  3C1B D;  5DNN C;  1S32 D;  1M19 C;  3WKJ C;  5CHL B;  5JA4 A;  3X1U C;  1KX5 A;  4Z66 C;  5G49 A;  5BNX B;  1ID3 A;  5E5A C;  1KX5 D;  4KGC C;  1ID3 D;  4G92 C;  4QLC A;  3LZ1 A;  3AZK B;  4QLC D;  3AV1 A;  3LZ1 D;  4KUD B;  3AV1 D;  3REL B;  3W96 A;  5B1L B;  1P3P A;  1P3M C;  1BH8 A;  3W96 D;  3KSY A;  1P3P D;  4Z2M H;  4CSR A;  4X23 C;  5JRG C;  5BNV B;  5B2I A;  4KHA B;  5B2I D;  4WU8 B;  3WTP C;  5BS7 A;  3AFA A;  3B6F B;  5G49 B;  1P34 A;  5CP6 A;  3AFA D;  3A6N B;  5GXQ C;  5CP6 D;  1TZY C;  2YFW A;  3O62 D;  5CPJ A;  1ULY A;  5CPJ D;  4NFT A;  3AZF A;  5B2J C;  3TU4 B;  5AVB A;  5BT1 D;  4AWL C;  2L5A A;  3AZF D;  1F66 A;  3LZ0 C;  4H9S A;  3W98 A;  5AVB D;  1KX4 B;  1F66 D;  1P3P B;  3W98 D;  1BH8 B;  5GT0 A;  1KX3 C;  5B0Y B;  1P3K B;  3B0D C;  5GT0 D;  2PYO C;  5GSU C;  3AZG B;  5AV5 B;  1P3B B;  3X1T C;  1M1A B;  2F8N A;  3AZE C;  1ZLA B;  2F8N D;  2NQB A;  4YM6 C;  4HGA C;  3UTA A;  2NQB D;  3B6G C;  3AZJ C;  4ZUX C;  1P34 B;  4G91 C;  3V9R A;  3MGQ A;  3UTA D;  1P3L B;  1U35 A;  3MGQ D;  4LD9 C;  4H9P A;  1U35 D;  4DRB A;  4XUJ A;  3LEL A;  2NZD C;  1HTA A;  4J8V C;  3UTB C;  3MNN C;  5CPJ B;  4XUJ D;  3LEL D;  5B0Z B;  5F99 C; 
#chains in the Genus database with same CATH topology
 1EQZ C;  4EO5 B;  1T3U A;  2ZM5 A;  1WWI A;  1BH9 A;  5B32 C;  3REI A;  2Y2L A;  5GT0 B;  3REI D;  5AV9 C;  3AN2 C;  1BFM A;  3MGR C;  2CWE A;  3REK A;  4XZQ C;  2RVQ C;  5AV6 B;  3REK D;  2F8N K;  5GT3 C;  5CPK A;  1P3I C;  4Z5T B;  5AVC C;  3AV2 C;  5CPK D;  2BYM B;  4WNN A;  3AYW B;  2NQB B;  5BNX A;  3VH5 T;  3W97 B;  5B33 B;  2HIO C;  3MVD B;  3W99 C;  1HQ3 C;  5B1M B;  4UUZ B;  1P3G C;  3MGQ B;  1JFI B;  2W8S A;  4NE3 A;  4YS3 C;  1U35 B;  2F2A C;  3AZN C;  3WA9 C;  3X1S B;  4XUJ B;  1AOI B;  3REL A;  4KUD D;  3MGS C;  3IP4 C;  3REL D;  5AY8 C;  5B24 C;  5B1L A;  3UT9 B;  1M19 A;  2CV5 C;  4ZBJ C;  3KXB A;  1BH9 B;  2JSS A;  5B1L D;  4Z66 A;  1M19 D;  3KXB D;  4DQY B;  4Z66 D;  3R45 B;  5B31 C;  3C1C C;  4R8P C;  1P3A C;  2FJ7 C;  3REK B;  2ZY2 A;  4KHA A;  1TAF B;  3AZM C;  4WU8 A;  4WU9 B;  2BYK A;  5CPK B;  4WU8 D;  4WNN B;  3B6F A;  4DRA A;  2UWX A;  3A6N A;  3B6F D;  1Q9C A;  3A6N D;  3VH6 A;  5CPI B;  3AZI C;  3VH5 W;  5AV8 C;  3LJA B;  1M18 C;  3VH6 T;  2ARO C;  3AZK C;  3TU4 A;  1P3F C;  1R4V A;  3TU4 D;  1KX4 A;  4J8W C;  5C3I C;  1M19 B;  2HUE C;  3KXB B;  3WKJ B;  3AZL C;  1W2E A;  1KX4 D;  3X1U B;  4M6B A;  4Z66 B;  5B0Y A;  1P3K A;  2Y2N A;  4CAY B;  5E5A B;  4KGC B;  5B0Y D;  1P3K D;  2JE5 A;  3AZG A;  5AV5 A;  5DNM C;  1P3B A;  3REH C;  3AZG D;  5AV5 D;  1M1A A;  1P3B D;  3EPK A;  1M1A D;  1ZLA A;  3C1B C;  2BYK B;  1S32 C;  1ZLA D;  1PZR A;  3KFU G;  1P3L A;  1P3M B;  1KX5 C;  1P34 D;  2IO5 C;  1P3L D;  1ID3 C;  1KU5 A;  2PYO A;  4X23 B;  5GSU A;  4JJN A;  2XD5 A;  3H0L C;  4QLC C;  5B0Z A;  5GSU D;  5JRG B;  3LZ1 C;  4JJN D;  5B0Z D;  3AV1 C;  2Y2G A;  3X1V A;  3WTP B;  4YM6 A;  3X1V D;  3W96 C;  4YM6 D;  2DQN C;  1P3P C;  5BO0 A;  1N1J B;  3H0M C;  5GXQ B;  4LD9 A;  5B40 A;  1TZY B;  5AV6 A;  3NQU B;  4LD9 D;  3UTB A;  5B40 D;  5AV6 D;  3UTB D;  4Z5T A;  5B2I C;  2BYM A;  5B2J B;  3AYW A;  1EQZ A;  4AWL B;  3W97 A;  4Z5T D;  5B33 A;  3NQJ B;  3MVD A;  3LZ0 B;  5B1M A;  3AYW D;  1EQZ D;  4UUZ A;  3W97 D;  3REJ A;  5B33 D;  3MVD D;  1JFI A;  5B1M D;  5BS7 C;  3AFA C;  1B6W A;  2FFF B;  2LY8 A;  4J8X C;  3REJ D;  2BG1 A;  5CP6 C;  3B0D B;  3X1S A;  3AZH C;  3B0C T;  2PYO B;  5GSU B;  4JJN B;  1AOI A;  1H3O B;  3X1S D;  3O62 C;  3X1T B;  1AOI D;  3UT9 A;  5BT1 C;  3AZE B;  5AVC A;  3AZF C;  3AV2 A;  3UT9 D;  3X1V B;  5AVB C;  4YM6 B;  5AVC D;  3AV2 D;  4HGA B;  1F66 C;  3W98 C;  3R45 A;  3B6G B;  4ZUX B;  1P3G A;  3WAA A;  4G91 B;  3KWQ C;  5BO0 B;  4H9R A;  5GT0 C;  4YS3 A;  1P3G D;  3WAA D;  4LD9 B;  1TAF A;  5B40 B;  4YS3 D;  3WTP E;  2NZD B;  4WU9 A;  3UTB B;  3MNN B;  2JCH A;  4H9Q A;  4WU9 D;  5F99 B;  1EQZ B;  4J8U C;  1P3O A;  3REJ B;  3UTA C;  3EPJ A;  5CPI A;  1P3O D;  3LJA A;  3A1K A;  5AV9 B;  3AL0 C;  3KUY C;  5CPI D;  3MGR B;  1U35 C;  4R8P A;  3LJA D;  1P3A A;  3F6T A;  4XUJ C;  4XZQ B;  4R8P D;  3LEL C;  1P3A D;  5DNN A;  5GT3 B;  3B0C W;  3WKJ A;  1P3I B;  5AVC B;  5DNN D;  3X1U A;  3AV2 B;  3WKJ D;  2RIQ A;  4CAY A;  2HIO B;  5E5A A;  3X1U D;  3MGP C;  3W99 B;  4KGC A;  1P3G B;  3WAA B;  3REI C;  5E5A D;  4H9R B;  4YS3 B;  4KGC D;  3AZN B;  3WA9 B;  1B67 A;  2ARO A;  2Y2M A;  3REK C;  3EG5 B;  2ARO D;  4H9N A;  4H9Q B;  3MGS B;  5AY8 B;  5B24 B;  4ZBJ B;  1P3M A;  3H0R C;  4WZS B;  1P3O B;  2VQR A;  1P3M D;  5B31 B;  4X23 A;  4X23 D;  5JRG A;  4R8P B;  1P3A B;  2FJ7 B;  5JRG D;  4KUD C;  3AZM B;  5DNN B;  3REL C;  3WTP A;  5B1L C;  3WTP D;  3KXB C;  1N1J A;  5GXQ A;  2Y2H A;  4G92 B;  1TZY A;  5GXQ D;  3NQU A;  3AZI B;  5AV8 B;  1M18 B;  5FUG B;  1TZY D;  2ARO B;  2ZY5 A;  5B2J A;  4H9N B;  1P3F B;  4WU8 C;  3NQJ A;  5B2J D;  3LZ0 A;  2YFV B;  4Z2M G;  4J8W B;  5C3I B;  2HUE B;  3LZ0 D;  3AZL B;  3B6F C;  1KX3 A;  3A6N C;  1F1E A;  1KX3 D;  1H3O A;  5DNM B;  2PYO D;  3REH B;  3X1T A;  3X1T D;  2G5H C;  3AZE A;  3VH6 W;  3C1B B;  3TU4 C;  2ZY4 A;  3AZE D;  1S32 B;  4NE5 A;  1KX4 C;  3B6G A;  3AZJ A;  4ZUX A;  5JA4 B;  3EPL A;  3B6G D;  3AZJ D;  4ZUX D;  1KX5 B;  2IO5 B;  5B0Y C;  4J8X A;  5B32 G;  3AZH A;  1P3K C;  2Y2O A;  1ID3 B;  4WJ3 C;  3AZH D;  4J8X D;  3B0B A;  2NZD A;  4J8V A;  3MNN A;  5AV5 C;  3O62 A;  3AZG C;  1P3B C;  2NZD D;  4QLC B;  3LZ1 B;  4J8V D;  5F99 A;  3MNN D;  1M1A C;  3AV1 B;  5F99 D;  5B32 A;  1ZLA C;  5B32 D;  3W96 B;  1P34 C;  1KX3 B;  3AN2 A;  5AV9 A;  1P3L C;  3KWQ A;  2F8N G;  3MGR A;  3AN2 D;  5AV9 D;  3KWQ D;  3MGR D;  4XZQ A;  4CSR B;  4JJN C;  5CPJ C;  5GT3 A;  4XZQ D;  2RVQ D;  5B0Z C;  1P3I A;  2F8N H;  5GT3 D;  4EO5 C;  5B2I B;  4E44 A;  1P3I D;  1WWS A;  2HIO A;  4H9S C;  3X1V C;  3W99 A;  1HQ3 A;  3AZJ B;  4J8U A;  4E45 A;  2HIO D;  3W99 D;  1HQ3 D;  3AFA B;  4J8U D;  3AZN A;  3WA9 A;  3AZH B;  4J8X B;  5CP6 B;  3KUY A;  3AZN D;  3WA9 D;  4J8V B;  2ZY3 A;  3O62 B;  3KUY D;  5B31 G;  5B40 C;  2YFW B;  5AV6 C;  5KDM A;  3MGS A;  5AY8 A;  5B24 A;  2CV5 A;  4Z5T C;  3MGS D;  5B32 B;  3AZF B;  5AY8 D;  5B24 D;  3AYW C;  2NQB C;  5AVB B;  2CV5 D;  3W97 C;  3MVD C;  5B33 C;  1F66 B;  3W98 B;  5B1M C;  5B31 A;  4H9O A;  3MGP A;  3REJ C;  3AN2 B;  3MGQ C;  3KWQ B;  3C1C A;  5B31 D;  3MGP D;  4NE6 A;  2FJ7 A;  3C1C D;  3X1S C;  2FJ7 D;  3AZM A;  1AOI C;  3AZM D;  2J8P A;  3A1I A;  2F8N B;  3UT9 C;  1Z2C B;  3VH5 A;  1HQ3 B;  4J8U B;  3UTA B;  3AZI A;  3WAA C;  5AV8 A;  2Y2K A;  1M18 A;  3V9R B;  5FUG A;  3KUY B;  3AZI D;  5AV8 D;  3AZK A;  1M18 D;  4H9P B;  3AZK D;  1P3F A;  3LEL B;  4KUD A;  5KDM B;  4WU9 C;  2YFV A;  5CPK C;  3FDD A;  1P3F D;  4J8W A;  2CV5 B;  3AZL A;  4J8W D;  3AZL D;  1A7W A;  4H9O B;  4WV4 B;  3MGP B;  1P3O C;  3REI B;  3C1C B;  5DNM A;  5CPI C;  3REH A;  3LJA C;  5DNM D;  3REH D;  5BNV A;  3C1B A;  1S32 A;  3C1B D;  5DNN C;  1S32 D;  1M19 C;  3WKJ C;  5CHL B;  5JA4 A;  3X1U C;  1KX5 A;  4Z66 C;  5G49 A;  5BNX B;  1ID3 A;  5E5A C;  2Y2J A;  1KX5 D;  4KGC C;  1ID3 D;  4G92 C;  4QLC A;  3LZ1 A;  3AZK B;  4QLC D;  3AV1 A;  3LZ1 D;  4KUD B;  3AV1 D;  3REL B;  2Y2P A;  3W96 A;  5B1L B;  1P3P A;  1P3M C;  1BH8 A;  3W96 D;  3KSY A;  1P3P D;  4Z2M H;  2XD1 A;  4CSR A;  4X23 C;  2Y2I A;  5JRG C;  2Y2Q A;  5BNV B;  5B2I A;  4KHA B;  2DF4 C;  4UPK A;  5B2I D;  4WU8 B;  3WTP C;  5BS7 A;  3AFA A;  3B6F B;  5G49 B;  1P34 A;  5CP6 A;  3AFA D;  3A6N B;  5GXQ C;  5CP6 D;  1TZY C;  2YFW A;  3O62 D;  5CPJ A;  1ULY A;  5CPJ D;  4NFT A;  3AZF A;  5B2J C;  3TU4 B;  5AVB A;  5BT1 D;  4AWL C;  2L5A A;  3AZF D;  1F66 A;  3LZ0 C;  4H9S A;  3W98 A;  5AVB D;  1KX4 B;  1F66 D;  1P3P B;  3W98 D;  1BH8 B;  5GT0 A;  1KX3 C;  5B0Y B;  1P3K B;  3B0D C;  5GT0 D;  2PYO C;  5GSU C;  3AZG B;  2G5I C;  5AV5 B;  3EPH A;  1P3B B;  3X1T C;  1M1A B;  2F8N A;  3AZE C;  1ZLA B;  2F8N D;  2NQB A;  4YM6 C;  4HGA C;  3UTA A;  2NQB D;  3B6G C;  3AZJ C;  4ZUX C;  1P34 B;  4G91 C;  3P5J B;  3V9R A;  3MGQ A;  3UTA D;  1P3L B;  1U35 A;  3MGQ D;  4LD9 C;  4H9P A;  1U35 D;  4DRB A;  4XUJ A;  3LEL A;  2NZD C;  1HTA A;  4J8V C;  3UTB C;  3MNN C;  5CPJ B;  4XUJ D;  3LEL D;  5B0Z B;  5F99 C; 
#chains in the Genus database with same CATH homology
 1EQZ C;  4EO5 B;  1T3U A;  2ZM5 A;  1WWI A;  1BH9 A;  5B32 C;  3REI A;  2Y2L A;  5GT0 B;  3REI D;  5AV9 C;  3AN2 C;  1BFM A;  3MGR C;  2CWE A;  3REK A;  4XZQ C;  2RVQ C;  5AV6 B;  3REK D;  2F8N K;  5GT3 C;  5CPK A;  1P3I C;  4Z5T B;  5AVC C;  3AV2 C;  5CPK D;  2BYM B;  4WNN A;  3AYW B;  2NQB B;  5BNX A;  3VH5 T;  3W97 B;  5B33 B;  2HIO C;  3MVD B;  3W99 C;  1HQ3 C;  5B1M B;  4UUZ B;  1P3G C;  3MGQ B;  1JFI B;  2W8S A;  4NE3 A;  4YS3 C;  1U35 B;  2F2A C;  3AZN C;  3WA9 C;  3X1S B;  4XUJ B;  1AOI B;  3REL A;  4KUD D;  3MGS C;  3IP4 C;  3REL D;  5AY8 C;  5B24 C;  5B1L A;  3UT9 B;  1M19 A;  2CV5 C;  4ZBJ C;  3KXB A;  1BH9 B;  2JSS A;  5B1L D;  4Z66 A;  1M19 D;  3KXB D;  4DQY B;  4Z66 D;  3R45 B;  5B31 C;  3C1C C;  4R8P C;  1P3A C;  2FJ7 C;  3REK B;  2ZY2 A;  4KHA A;  1TAF B;  3AZM C;  4WU8 A;  4WU9 B;  2BYK A;  5CPK B;  4WU8 D;  4WNN B;  3B6F A;  4DRA A;  2UWX A;  3A6N A;  3B6F D;  1Q9C A;  3A6N D;  3VH6 A;  5CPI B;  3AZI C;  3VH5 W;  5AV8 C;  3LJA B;  1M18 C;  3VH6 T;  2ARO C;  3AZK C;  3TU4 A;  1P3F C;  1R4V A;  3TU4 D;  1KX4 A;  4J8W C;  5C3I C;  1M19 B;  2HUE C;  3KXB B;  3WKJ B;  3AZL C;  1W2E A;  1KX4 D;  3X1U B;  4M6B A;  4Z66 B;  5B0Y A;  1P3K A;  2Y2N A;  4CAY B;  5E5A B;  4KGC B;  5B0Y D;  1P3K D;  2JE5 A;  3AZG A;  5AV5 A;  5DNM C;  1P3B A;  3REH C;  3AZG D;  5AV5 D;  1M1A A;  1P3B D;  3EPK A;  1M1A D;  1ZLA A;  3C1B C;  2BYK B;  1S32 C;  1ZLA D;  1PZR A;  3KFU G;  1P3L A;  1P3M B;  1KX5 C;  1P34 D;  2IO5 C;  1P3L D;  1ID3 C;  1KU5 A;  2PYO A;  4X23 B;  5GSU A;  4JJN A;  2XD5 A;  3H0L C;  4QLC C;  5B0Z A;  5GSU D;  5JRG B;  3LZ1 C;  4JJN D;  5B0Z D;  3AV1 C;  2Y2G A;  3X1V A;  3WTP B;  4YM6 A;  3X1V D;  3W96 C;  4YM6 D;  2DQN C;  1P3P C;  5BO0 A;  1N1J B;  3H0M C;  5GXQ B;  4LD9 A;  5B40 A;  1TZY B;  5AV6 A;  3NQU B;  4LD9 D;  3UTB A;  5B40 D;  5AV6 D;  3UTB D;  4Z5T A;  5B2I C;  2BYM A;  5B2J B;  3AYW A;  1EQZ A;  4AWL B;  3W97 A;  4Z5T D;  5B33 A;  3NQJ B;  3MVD A;  3LZ0 B;  5B1M A;  3AYW D;  1EQZ D;  4UUZ A;  3W97 D;  3REJ A;  5B33 D;  3MVD D;  1JFI A;  5B1M D;  5BS7 C;  3AFA C;  1B6W A;  2FFF B;  2LY8 A;  4J8X C;  3REJ D;  2BG1 A;  5CP6 C;  3B0D B;  3X1S A;  3AZH C;  3B0C T;  2PYO B;  5GSU B;  4JJN B;  1AOI A;  1H3O B;  3X1S D;  3O62 C;  3X1T B;  1AOI D;  3UT9 A;  5BT1 C;  3AZE B;  5AVC A;  3AZF C;  3AV2 A;  3UT9 D;  3X1V B;  5AVB C;  4YM6 B;  5AVC D;  3AV2 D;  4HGA B;  1F66 C;  3W98 C;  3R45 A;  3B6G B;  4ZUX B;  1P3G A;  3WAA A;  4G91 B;  3KWQ C;  5BO0 B;  4H9R A;  5GT0 C;  4YS3 A;  1P3G D;  3WAA D;  4LD9 B;  1TAF A;  5B40 B;  4YS3 D;  3WTP E;  2NZD B;  4WU9 A;  3UTB B;  3MNN B;  2JCH A;  4H9Q A;  4WU9 D;  5F99 B;  1EQZ B;  4J8U C;  1P3O A;  3REJ B;  3UTA C;  3EPJ A;  5CPI A;  1P3O D;  3LJA A;  3A1K A;  5AV9 B;  3AL0 C;  3KUY C;  5CPI D;  3MGR B;  1U35 C;  4R8P A;  3LJA D;  1P3A A;  3F6T A;  4XUJ C;  4XZQ B;  4R8P D;  3LEL C;  1P3A D;  5DNN A;  5GT3 B;  3B0C W;  3WKJ A;  1P3I B;  5AVC B;  5DNN D;  3X1U A;  3AV2 B;  3WKJ D;  2RIQ A;  4CAY A;  2HIO B;  5E5A A;  3X1U D;  3MGP C;  3W99 B;  4KGC A;  1P3G B;  3WAA B;  3REI C;  5E5A D;  4H9R B;  4YS3 B;  4KGC D;  3AZN B;  3WA9 B;  1B67 A;  2ARO A;  2Y2M A;  3REK C;  3EG5 B;  2ARO D;  4H9N A;  4H9Q B;  3MGS B;  5AY8 B;  5B24 B;  4ZBJ B;  1P3M A;  3H0R C;  4WZS B;  1P3O B;  2VQR A;  1P3M D;  5B31 B;  4X23 A;  4X23 D;  5JRG A;  4R8P B;  1P3A B;  2FJ7 B;  5JRG D;  4KUD C;  3AZM B;  5DNN B;  3REL C;  3WTP A;  5B1L C;  3WTP D;  3KXB C;  1N1J A;  5GXQ A;  2Y2H A;  4G92 B;  1TZY A;  5GXQ D;  3NQU A;  3AZI B;  5AV8 B;  1M18 B;  5FUG B;  1TZY D;  2ARO B;  2ZY5 A;  5B2J A;  4H9N B;  1P3F B;  4WU8 C;  3NQJ A;  5B2J D;  3LZ0 A;  2YFV B;  4Z2M G;  4J8W B;  5C3I B;  2HUE B;  3LZ0 D;  3AZL B;  3B6F C;  1KX3 A;  3A6N C;  1F1E A;  1KX3 D;  1H3O A;  5DNM B;  2PYO D;  3REH B;  3X1T A;  3X1T D;  2G5H C;  3AZE A;  3VH6 W;  3C1B B;  3TU4 C;  2ZY4 A;  3AZE D;  1S32 B;  4NE5 A;  1KX4 C;  3B6G A;  3AZJ A;  4ZUX A;  5JA4 B;  3EPL A;  3B6G D;  3AZJ D;  4ZUX D;  1KX5 B;  2IO5 B;  5B0Y C;  4J8X A;  5B32 G;  3AZH A;  1P3K C;  2Y2O A;  1ID3 B;  4WJ3 C;  3AZH D;  4J8X D;  3B0B A;  2NZD A;  4J8V A;  3MNN A;  5AV5 C;  3O62 A;  3AZG C;  1P3B C;  2NZD D;  4QLC B;  3LZ1 B;  4J8V D;  5F99 A;  3MNN D;  1M1A C;  3AV1 B;  5F99 D;  5B32 A;  1ZLA C;  5B32 D;  3W96 B;  1P34 C;  1KX3 B;  3AN2 A;  5AV9 A;  1P3L C;  3KWQ A;  2F8N G;  3MGR A;  3AN2 D;  5AV9 D;  3KWQ D;  3MGR D;  4XZQ A;  4CSR B;  4JJN C;  5CPJ C;  5GT3 A;  4XZQ D;  2RVQ D;  5B0Z C;  1P3I A;  2F8N H;  5GT3 D;  4EO5 C;  5B2I B;  4E44 A;  1P3I D;  1WWS A;  2HIO A;  4H9S C;  3X1V C;  3W99 A;  1HQ3 A;  3AZJ B;  4J8U A;  4E45 A;  2HIO D;  3W99 D;  1HQ3 D;  3AFA B;  4J8U D;  3AZN A;  3WA9 A;  3AZH B;  4J8X B;  5CP6 B;  3KUY A;  3AZN D;  3WA9 D;  4J8V B;  2ZY3 A;  3O62 B;  3KUY D;  5B31 G;  5B40 C;  2YFW B;  5AV6 C;  5KDM A;  3MGS A;  5AY8 A;  5B24 A;  2CV5 A;  4Z5T C;  3MGS D;  5B32 B;  3AZF B;  5AY8 D;  5B24 D;  3AYW C;  2NQB C;  5AVB B;  2CV5 D;  3W97 C;  3MVD C;  5B33 C;  1F66 B;  3W98 B;  5B1M C;  5B31 A;  4H9O A;  3MGP A;  3REJ C;  3AN2 B;  3MGQ C;  3KWQ B;  3C1C A;  5B31 D;  3MGP D;  4NE6 A;  2FJ7 A;  3C1C D;  3X1S C;  2FJ7 D;  3AZM A;  1AOI C;  3AZM D;  2J8P A;  3A1I A;  2F8N B;  3UT9 C;  1Z2C B;  3VH5 A;  1HQ3 B;  4J8U B;  3UTA B;  3AZI A;  3WAA C;  5AV8 A;  2Y2K A;  1M18 A;  3V9R B;  5FUG A;  3KUY B;  3AZI D;  5AV8 D;  3AZK A;  1M18 D;  4H9P B;  3AZK D;  1P3F A;  3LEL B;  4KUD A;  5KDM B;  4WU9 C;  2YFV A;  5CPK C;  3FDD A;  1P3F D;  4J8W A;  2CV5 B;  3AZL A;  4J8W D;  3AZL D;  1A7W A;  4H9O B;  4WV4 B;  3MGP B;  1P3O C;  3REI B;  3C1C B;  5DNM A;  5CPI C;  3REH A;  3LJA C;  5DNM D;  3REH D;  5BNV A;  3C1B A;  1S32 A;  3C1B D;  5DNN C;  1S32 D;  1M19 C;  3WKJ C;  5CHL B;  5JA4 A;  3X1U C;  1KX5 A;  4Z66 C;  5G49 A;  5BNX B;  1ID3 A;  5E5A C;  2Y2J A;  1KX5 D;  4KGC C;  1ID3 D;  4G92 C;  4QLC A;  3LZ1 A;  3AZK B;  4QLC D;  3AV1 A;  3LZ1 D;  4KUD B;  3AV1 D;  3REL B;  2Y2P A;  3W96 A;  5B1L B;  1P3P A;  1P3M C;  1BH8 A;  3W96 D;  3KSY A;  1P3P D;  4Z2M H;  2XD1 A;  4CSR A;  4X23 C;  2Y2I A;  5JRG C;  2Y2Q A;  5BNV B;  5B2I A;  4KHA B;  2DF4 C;  4UPK A;  5B2I D;  4WU8 B;  3WTP C;  5BS7 A;  3AFA A;  3B6F B;  5G49 B;  1P34 A;  5CP6 A;  3AFA D;  3A6N B;  5GXQ C;  5CP6 D;  1TZY C;  2YFW A;  3O62 D;  5CPJ A;  1ULY A;  5CPJ D;  4NFT A;  3AZF A;  5B2J C;  3TU4 B;  5AVB A;  5BT1 D;  4AWL C;  2L5A A;  3AZF D;  1F66 A;  3LZ0 C;  4H9S A;  3W98 A;  5AVB D;  1KX4 B;  1F66 D;  1P3P B;  3W98 D;  1BH8 B;  5GT0 A;  1KX3 C;  5B0Y B;  1P3K B;  3B0D C;  5GT0 D;  2PYO C;  5GSU C;  3AZG B;  2G5I C;  5AV5 B;  3EPH A;  1P3B B;  3X1T C;  1M1A B;  2F8N A;  3AZE C;  1ZLA B;  2F8N D;  2NQB A;  4YM6 C;  4HGA C;  3UTA A;  2NQB D;  3B6G C;  3AZJ C;  4ZUX C;  1P34 B;  4G91 C;  3P5J B;  3V9R A;  3MGQ A;  3UTA D;  1P3L B;  1U35 A;  3MGQ D;  4LD9 C;  4H9P A;  1U35 D;  4DRB A;  4XUJ A;  3LEL A;  2NZD C;  1HTA A;  4J8V C;  3UTB C;  3MNN C;  5CPJ B;  4XUJ D;  3LEL D;  5B0Z B;  5F99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...