2BYMB

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
AVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 28
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bymB00
1ZLAC 1P3FD 3RELD 3LZ1A 5AY8D 4R8PD 4AWLC 3X1VA 5JRGC 3LELA 1KX5C 4WU8B 4J8UC 1AOID 1EQZC 4G91B 3REJC 4J8VC 2NQBD 5B0YD 2NZDC 3VH5A 3W98D 5B0ZD 5AVBC 3C1CD 4KUDD 4XUJD 1P3GD 1P3KD 4M6BA 4NE5A 1P3LC 3LZ0B 3AV2B 4JJND 1WWSA 4KGCB 4EO5C 5B1MB 4WU9C 4ZUXB 1ID3B 3AZGB 4H9OB 3AN2D 3C1BD 4Z5TA 4Z66C 5BT1C 5CHLB 5GXQC 3B0CW 1P34B 5AV9C 3WTPC 5B31B 5B2IA 5KDMA 4UUZB 2AROB 1F66D 3AYWA 4Z66A 3KWQB 1P3PD 4YM6B 3WTPA 2PYOC 4LD9B 3VH6A 3AZJA 1M1AB 2BYKA 5CPID 5GT3C 3LZ1D 1P3MC 5AV8C 3KXBA 5B40C 1HQ3B 4QLCC 3UTBA 4H9QA 3LELD 1TZYB 3REIC 1P3BB 4H9NA 3W96B 3AZNC 1ZLAD 3W97C 1P3MA 3AZLB 1S32B 3UT9A 5F99B 3AZHA 3WTPE 1B67A 3MNNC 1KX5D 1P3IC 4J8UD 5E5AC 1EQZD 5AV5B 3REJD 2NZDD 3AZKA 3MVDB 4H9RB 1M19A 5B33A 5B1LB 5BS7C 5AVBD 3LJAB 4J8XA 3MGSA 1P3LD 5DNMA 5FUGB 5GT0A 3AFAA 3B6GC 5G49A 4WU9D 4WZSB 3KUYA 2HIOC 4HGAB 3X1SB 3TU4A 3MGQA 1KX4B 3MGPB 4Z66D 5GXQD 5BT1D 2BYMA 3WA9C 2FJ7A 5AV9D 5C3IC 3WTPD 1JFIA 4ZBJB 4YS3A 4WU8C 1P3OC 4G91C 3RELA 3W99B 4J8WB 5AY8A 3WA9A 4E45A 2PYOD 4Z5TB 2CWEA 1AOIA 3O62B 3LZ0C 3AZEB 5GT3D 5CPKC 2NQBA 5KDMB 5B0YA 1BH9A 1ID3C 3AZGC 3AYWB 5AV8D 1P3MD 5B0ZA 4KUDA 3C1CA 5B40D 5B31G 4QLCD 1P3KA 3AZMC 5DNNC 2YFWA 4H9SC 3UTAC 3AZJB 1P34C 3REID 4JJNA 3NQJB 1U35C 3AZND 3C1BA 1ULYA 3MNND 5B32B 3AZIC 5CPJB 1P3ID 4LD9C 4YM6C 2RVQC 3X1TC 3V9RA 3X1UA 4H9NB 5GSUC 5CP6B 3WAAC 1P3PA 3UT9B 3B0DB 3AZHB 3AZFC 5CPIA 1TZYC 1TAFB 3AZKB 2HIOD 3W96C 3B6FC 1M19B 3WA9D 3AZLC 1N1JA 4J8XB 4CAYA 4X23B 3AFAB 4WU8D 1P3OD 5AV5C 1ZLAA 4WNNB 5B1LC 3TU4B 1P3AB 3LJAC 2BYMB 5JRGA 1KX3B 4NE6A 1KX5A 4J8UA 1EQZA 3REJA 5CPKD 4J8VA 2F8NB 3REKC 2NZDA 3A6NC 1ID3D 3AZGD 4XZQC 4H9PB 5AVBA 1HTAA 3RELB 3X1SC 4HGAC 1P3FB 5AY8B 5B2JB 4R8PB 1KX4C 3AZMD 5DNND 1P3LA 3UTAD 1P34D 3MGRB 1U35D 3A6NA 2F8NH 4WU9A 1AOIB 4XZQA 3X1UD 5BNXA 2NQBB 1BH9B 5JA4A 3W99C 3R45B 5GXQA 4J8WC 5B0ZB 3AZID 3C1CB 3W98B 5AV9A 4XUJB 4LD9D 1P3GB 2RVQD 3X1TD 1M18C 4JJNB 3O62C 3AZEC 5GSUD 3WAAD 3AN2B 3C1BB 2PYOA 3NQUB 2CV5B 3AZFD 1TZYD 1B6WA 3B6FD 5GT3A 3W96D 5AV6C 1F66B 5B32G 5AV8A 3AZLD 5B40A 3REHC 4QLCA 1P3PB 5CPJC 5JRGD 3REIA 3AZNA 3W97A 4J8VD 5B1LD 5AVCB 3REHA 3WKJC 5CP6C 3LZ1B 3LJAD 3MNNA 1P3IA 5E5AA 3X1VB 3B0DC 3AV1C 3REKD 3A6ND 3LELB 5BS7A 4XZQD 2HUEC 4Z2MH 1ZLAB 3X1SD 4KHAA 5B24C 1KX4D 4AWLB 3B6GA 4X23C 5BNVA 4CSRA 2NZDB 2HIOA 5B24A 3W99D 4J8WD 4G92B 1P3AC 2F8NG 1KX3C 1M18D 4WU8A 3O62D 5B2IB 3AZED 1P3OA 3AV2C 4KGCC 5B1MC 4ZUXC 1P3FC 4Z66B 5B2JC 5AV9B 3WTPB 3LZ0A 1BFMA 3MGRC 4KGCA 5CPKA 5B31C 4DRBA 5AV6D 3W97D 2BYKB 4ZUXA 1ID3A 3AZGA 2AROC 4H9OA 1KU5A 3REHD 3AZMA 5DNNA 5CPJD 4H9SA 3KXBB 3UTAA 3W98C 1P34A 3KWQC 5E5AD 1U35A 1P3GC 3UTBB 4H9QB 4UUZA 1M1AC 3WKJD 2LY8A 1P3MB 3AZIA 5AV8B 3AN2C 4LD9A 4YM6A 3X1TA 3AV1D 3B6GD 2CV5C 1HQ3C 5GSUA 1P3BC 5B24D 3WAAA 5B33B 1F66C 1BH8A 3MNNB 3MGSB 1HQ3A 5F99C 4X23D 1S32C 5DNMB 3AZFA 5GT0B 4Z2MG 1TZYA 3W96A 1P3BA 3B6FA 5G49B 3MVDC 3KUYB 5AVCC 3AZLA 1P3AD 3MGQB 3LZ1C 2FJ7B 1JFIB 1R4VA 2JSSA 3X1VC 3LZ0D 3AV2D 5AV5A 4KGCD 4YS3B 4H9RA 3LELC 5BNVB 4CSRB 5B1MD 5B1LA 4ZUXD 1F1EA 3LJAA 5B2JD 3WA9B 3B0BA 5C3IB 3MGPC 5FUGA 3MGRD 5B31D 3REKA 4ZBJC 1P3OB 2AROD 2IO5B 4WV4B 3X1SA 5B0YB 1KX4A 3MGPA 4G92C 4KUDB 3KWQD 2L5AA 4YM6D 4Z5TC 1P3KB 2YFWB 5BO0A 1M1AD 5CPKB 5B2IC 1Q9CA 3W99A 4J8WA 3AYWC 3B0CT 3AZMB 5DNNB 2CV5D 1HQ3D 3UTAB 1M18A 1U35B 3O62A 3AZEA 3AZJC 1P3BD 3V9RB 3X1UB 3AZIB 1S32D 5F99D 5B32C 3KXBC 3X1TB 3NQJA 5AV5D 5AV6A 3MVDD 3UTBC 5CPIB 5GSUB 5AVCD 3WAAB 4DRAA 5CPJA 1BH8B 5B32A 1N1JB 3UT9C 4CAYB 1WWIA 3X1VD 3AZHC 3AZFB 1H3OA 3B6FB 3WKJA 3AZKC 5CP6A 1M19C 5B33C 2YFVA 4NFTA 3MGPD 3AV1A 4J8XC 5JRGB 3MGSC 1KX5B 5DNMC 4J8UB 1EQZB 5GT0C 3AFAC 1TAFA 3REJB 4J8VB 3VH5T 3KUYC 5AVBB 3VH5W 3TU4C 4Z5TD 3MGQC 4X23A 1P3LB 2FJ7C 5B2ID 3REKB 4EO5B 3A6NB 4WNNA 4WU9B 4YS3C 4E44A 4XZQB 5BNXB 3AYWD 1A7WA 1P3AA 5JA4B 3RELC 5GXQB 5AY8C 1KX3A 4R8PC 3AZJD 3AV2A 2F8NA 5BO0B 5B1MA 1AOIC 4H9PA 2IO5C 1P3FA 2NQBC 5B0YC 5B2JA 4R8PA 3VH6T 2PYOB 5B32D 3KXBD 2F8NK 5B0ZC 4KUDC 3C1CC 3VH6W 4XUJC 3MGRA 5B31A 1P3KC 1M18B 3UTBD 2AROA 4JJNC 5GT3B 3KSYA 5CP6D 3R45A 3W98A 3KWQA 4XUJA 5B40B 3C1BC 3UT9D 4QLCB 1P3GA 3AZHD 1M1AA 3REIB 5AV6B 3AZNB 3W97B 3AZKD 1M19D 5B33D 3X1UC 3AN2A 3REHB 3NQUA 4J8XD 3MGSD 2CV5A 1P3IB 5DNMD 1P3PC 5E5AB 5GT0D 3AFAD 1H3OB 1F66A 5CPIC 3KUYD 3WKJB 4KHAB 3TU4D 2YFVB 3MGQD 5F99A 1S32A 1KX3D 2FJ7D 3AV1B 3B6GB 4YS3D 2HUEB 2F8ND 3MVDA 4NE3A 5AVCA 2HIOB 5B24B
chains in the Genus database with same CATH superfamily
1ZLAC 1P3FD 3RELD 3LZ1A 5AY8D 4R8PD 4AWLC 3X1VA 5JRGC 3LELA 1KX5C 4WU8B 4J8UC 1AOID 1EQZC 4G91B 3REJC 4J8VC 2NQBD 5B0YD 2NZDC 3P5JB 3VH5A 3W98D 5B0ZD 5AVBC 3C1CD 4KUDD 4XUJD 3AL0C 3EG5B 1P3GD 1P3KD 4M6BA 2ZY4A 4NE5A 1P3LC 3LZ0B 3AV2B 4JJND 1WWSA 4KGCB 4EO5C 3FDDA 5B1MB 4ZUXB 4WU9C 1ID3B 3AZGB 4H9OB 3AN2D 3C1BD 4Z5TA 4Z66C 5BT1C 5CHLB 5GXQC 3B0CW 1P34B 5AV9C 3WTPC 5B31B 5B2IA 2Y2KA 4UUZB 2AROB 3H0RC 5KDMA 2Y2JA 1F66D 3AYWA 4Z66A 3KWQB 1P3PD 4YM6B 3WTPA 2PYOC 4LD9B 3VH6A 3AZJA 1M1AB 2BYKA 5CPID 5GT3C 3LZ1D 1P3MC 5AV8C 3KXBA 4DQYB 5B40C 1HQ3B 4QLCC 4WJ3C 3UTBA 4H9QA 3LELD 1TZYB 3REIC 1P3BB 4H9NA 3W96B 2F2AC 3AZNC 1ZLAD 3W97C 2JE5A 1P3MA 3AZLB 1S32B 3UT9A 5F99B 3AZHA 3WTPE 1B67A 3MNNC 1KX5D 1P3IC 4J8UD 5E5AC 1EQZD 5AV5B 3REJD 2NZDD 3AZKA 3MVDB 4H9RB 1M19A 5B33A 5B1LB 5BS7C 5AVBD 3LJAB 4J8XA 3MGSA 1P3LD 5DNMA 5FUGB 5GT0A 3AFAA 3B6GC 3KFUG 5G49A 4WU9D 4WZSB 3KUYA 2HIOC 4HGAB 3X1SB 3TU4A 2Y2HA 3MGQA 3MGPB 1KX4B 4Z66D 5GXQD 5BT1D 2BYMA 3WA9C 2FJ7A 5AV9D 5C3IC 3WTPD 1JFIA 2Y2QA 4ZBJB 2ZY5A 4YS3A 2JCHA 4WU8C 1P3OC 4G91C 3RELA 3W99B 4J8WB 5AY8A 3WA9A 4E45A 2PYOD 4Z5TB 2CWEA 1T3UA 1AOIA 3O62B 3LZ0C 3AZEB 5GT3D 4UPKA 5CPKC 5KDMB 5B0YA 2NQBA 1BH9A 1ID3C 3AZGC 3AYWB 5AV8D 1P3MD 5B0ZA 4KUDA 3C1CA 5B40D 5B31G 4QLCD 2Y2GA 1P3KA 3AZMC 5DNNC 2YFWA 4H9SC 3UTAC 3AZJB 1P34C 3REID 4JJNA 3NQJB 1U35C 3AZND 3C1BA 1ULYA 2Y2LA 3MNND 5B32B 3AZIC 5CPJB 1P3ID 4LD9C 4YM6C 2RVQC 3X1TC 3V9RA 3X1UA 4H9NB 5GSUC 5CP6B 3WAAC 1P3PA 3UT9B 3B0DB 3AZHB 3AZFC 5CPIA 1TZYC 1TAFB 3AZKB 2HIOD 3W96C 3B6FC 1M19B 3WA9D 3AZLC 1N1JA 4J8XB 4CAYA 4X23B 3AFAB 4WU8D 1P3OD 5AV5C 1ZLAA 4WNNB 5B1LC 3TU4B 1P3AB 3LJAC 2BYMB 5JRGA 1KX3B 4NE6A 1KX5A 4J8UA 1EQZA 3REJA 5CPKD 4J8VA 2F8NB 3REKC 2NZDA 3A6NC 1ID3D 3AZGD 4XZQC 4H9PB 5AVBA 1HTAA 3RELB 3X1SC 4HGAC 1P3FB 5AY8B 5B2JB 4R8PB 1KX4C 3AZMD 5DNND 1P3LA 3UTAD 2XD5A 1P34D 2Y2NA 3MGRB 1U35D 3A6NA 2F8NH 4WU9A 1AOIB 4XZQA 3X1UD 5BNXA 2NQBB 1BH9B 5JA4A 3W99C 3R45B 5GXQA 4J8WC 5B0ZB 2RIQA 3C1CB 3AZID 5AV9A 4XUJB 3W98B 4LD9D 1P3GB 2RVQD 3X1TD 1M18C 4JJNB 3O62C 3AZEC 5GSUD 3WAAD 3AN2B 2Y2MA 3C1BB 2PYOA 3NQUB 3A1KA 2CV5B 3AZFD 1TZYD 1B6WA 3B6FD 5GT3A 3W96D 5AV6C 1F66B 5B32G 5AV8A 3AZLD 5B40A 3REHC 4QLCA 1P3PB 5CPJC 5JRGD 3REIA 3AZNA 3W97A 4J8VD 5B1LD 5AVCB 2G5HC 3REHA 3WKJC 5CP6C 3LZ1B 3LJAD 3MNNA 1P3IA 5E5AA 3X1VB 2Y2IA 3B0DC 3A1IA 3AV1C 3REKD 2VQRA 3A6ND 3LELB 1W2EA 5BS7A 2HUEC 4Z2MH 4XZQD 1ZLAB 3X1SD 4KHAA 5B24C 1KX4D 4AWLB 3B6GA 4X23C 5BNVA 4CSRA 2NZDB 2HIOA 5B24A 3W99D 4J8WD 4G92B 1P3AC 2J8PA 2F8NG 1KX3C 1M18D 4WU8A 3O62D 5B2IB 3AZED 1P3OA 3AV2C 3EPKA 4KGCC 5B1MC 4ZUXC 1P3FC 4Z66B 5B2JC 5AV9B 3WTPB 2Y2PA 3LZ0A 1BFMA 3MGRC 4KGCA 5CPKA 5B31C 4DRBA 5AV6D 3W97D 2BYKB 4ZUXA 1ID3A 3AZGA 2AROC 4H9OA 1KU5A 3REHD 3H0LC 3AZMA 5DNNA 5CPJD 4H9SA 3KXBB 3UTAA 3W98C 1P34A 3KWQC 5E5AD 1U35A 1P3GC 2XD1A 3UTBB 4H9QB 4UUZA 1M1AC 3WKJD 2LY8A 1P3MB 3AZIA 5AV8B 3AN2C 4LD9A 4YM6A 3X1TA 3AV1D 3B6GD 3EPJA 2CV5C 1HQ3C 2G5IC 5GSUA 1P3BC 5B24D 3WAAA 5B33B 1F66C 1BH8A 3F6TA 2ZY3A 3MNNB 3MGSB 1HQ3A 5F99C 4X23D 1S32C 5DNMB 3AZFA 5GT0B 4Z2MG 1TZYA 3W96A 1P3BA 3B6FA 5G49B 3MVDC 3KUYB 5AVCC 3AZLA 1P3AD 3MGQB 3LZ1C 2FJ7B 1JFIB 1R4VA 2JSSA 3X1VC 3LZ0D 3AV2D 2DF4C 5AV5A 4KGCD 4YS3B 4H9RA 3LELC 5BNVB 4CSRB 5B1MD 5B1LA 4ZUXD 1F1EA 1PZRA 3LJAA 5B2JD 3WA9B 3B0BA 2Y2OA 5C3IB 3MGPC 2ZM5A 5FUGA 3MGRD 5B31D 3REKA 4ZBJC 1P3OB 2AROD 2BG1A 2IO5B 4WV4B 3X1SA 5B0YB 1KX4A 3MGPA 4G92C 4KUDB 3KWQD 2L5AA 4YM6D 4Z5TC 1P3KB 2YFWB 5BO0A 1M1AD 5CPKB 5B2IC 1Q9CA 3W99A 4J8WA 3AYWC 3B0CT 3AZMB 5DNNB 2W8SA 2CV5D 1HQ3D 3UTAB 1M18A 1U35B 3O62A 3AZEA 3AZJC 1P3BD 3V9RB 3X1UB 3AZIB 1S32D 5F99D 5B32C 3KXBC 3X1TB 3NQJA 5AV5D 5AV6A 3MVDD 3UTBC 5CPIB 5GSUB 5AVCD 3WAAB 4DRAA 5CPJA 1BH8B 5B32A 1N1JB 3UT9C 4CAYB 1WWIA 3X1VD 3IP4C 3AZHC 3AZFB 1H3OA 3B6FB 3WKJA 3AZKC 5CP6A 1M19C 5B33C 2YFVA 4NFTA 3MGPD 3AV1A 4J8XC 5JRGB 3MGSC 1KX5B 5DNMC 4J8UB 1EQZB 5GT0C 3AFAC 1TAFA 3REJB 4J8VB 3VH5T 3KUYC 5AVBB 3VH5W 3TU4C 4Z5TD 3MGQC 4X23A 1P3LB 2FJ7C 5B2ID 3REKB 4EO5B 3A6NB 4WNNA 4WU9B 4YS3C 4E44A 4XZQB 5BNXB 3AYWD 1A7WA 1P3AA 5JA4B 3RELC 5GXQB 5AY8C 1KX3A 4R8PC 3AZJD 2ZY2A 3AV2A 2F8NA 5BO0B 5B1MA 3EPLA 1AOIC 4H9PA 2IO5C 1P3FA 2NQBC 3H0MC 5B0YC 5B2JA 4R8PA 3VH6T 2PYOB 5B32D 3KXBD 2F8NK 5B0ZC 4KUDC 3C1CC 3VH6W 4XUJC 3MGRA 5B31A 1P3KC 1M18B 3UTBD 2AROA 4JJNC 5GT3B 3KSYA 5CP6D 3R45A 3W98A 3KWQA 4XUJA 5B40B 3C1BC 3UT9D 4QLCB 1P3GA 3AZHD 1M1AA 3REIB 2FFFB 5AV6B 3AZNB 3W97B 3AZKD 1M19D 5B33D 3X1UC 3AN2A 3REHB 3NQUA 4J8XD 3MGSD 2CV5A 1P3IB 5DNMD 1P3PC 5E5AB 5GT0D 3AFAD 1Z2CB 1H3OB 1F66A 5CPIC 3KUYD 3WKJB 4KHAB 2DQNC 3TU4D 2YFVB 3MGQD 5F99A 1S32A 3EPHA 1KX3D 2FJ7D 3AV1B 3B6GB 2UWXA 4YS3D 2HUEB 2F8ND 3MVDA 4NE3A 5AVCA 2HIOB 5B24B
chains in the Genus database with same CATH topology
1ZLAC 1P3FD 3RELD 3LZ1A 5AY8D 4R8PD 4AWLC 3X1VA 5JRGC 3LELA 1KX5C 4WU8B 4J8UC 1AOID 1EQZC 4G91B 3REJC 4J8VC 2NQBD 5B0YD 2NZDC 3P5JB 3VH5A 3W98D 5B0ZD 5AVBC 3C1CD 4KUDD 4XUJD 3AL0C 3EG5B 1P3GD 1P3KD 4M6BA 2ZY4A 4NE5A 1P3LC 3LZ0B 3AV2B 4JJND 1WWSA 4KGCB 4EO5C 3FDDA 5B1MB 4ZUXB 4WU9C 1ID3B 3AZGB 4H9OB 3AN2D 3C1BD 4Z5TA 4Z66C 5BT1C 5CHLB 5GXQC 3B0CW 1P34B 5AV9C 3WTPC 5B31B 5B2IA 2Y2KA 4UUZB 2AROB 3H0RC 5KDMA 2Y2JA 1F66D 3AYWA 4Z66A 3KWQB 1P3PD 4YM6B 3WTPA 2PYOC 4LD9B 3VH6A 3AZJA 1M1AB 2BYKA 5CPID 5GT3C 3LZ1D 1P3MC 5AV8C 3KXBA 4DQYB 5B40C 1HQ3B 4QLCC 4WJ3C 3UTBA 4H9QA 3LELD 1TZYB 3REIC 1P3BB 4H9NA 3W96B 2F2AC 3AZNC 1ZLAD 3W97C 2JE5A 1P3MA 3AZLB 1S32B 3UT9A 5F99B 3AZHA 3WTPE 1B67A 3MNNC 1KX5D 1P3IC 4J8UD 5E5AC 1EQZD 5AV5B 3REJD 2NZDD 3AZKA 3MVDB 4H9RB 1M19A 5B33A 5B1LB 5BS7C 5AVBD 3LJAB 4J8XA 3MGSA 1P3LD 5DNMA 5FUGB 5GT0A 3AFAA 3B6GC 3KFUG 5G49A 4WU9D 4WZSB 3KUYA 2HIOC 4HGAB 3X1SB 3TU4A 2Y2HA 3MGQA 3MGPB 1KX4B 4Z66D 5GXQD 5BT1D 2BYMA 3WA9C 2FJ7A 5AV9D 5C3IC 3WTPD 1JFIA 2Y2QA 4ZBJB 2ZY5A 4YS3A 2JCHA 4WU8C 1P3OC 4G91C 3RELA 3W99B 4J8WB 5AY8A 3WA9A 4E45A 2PYOD 4Z5TB 2CWEA 1T3UA 1AOIA 3O62B 3LZ0C 3AZEB 5GT3D 4UPKA 5CPKC 5KDMB 5B0YA 2NQBA 1BH9A 1ID3C 3AZGC 3AYWB 5AV8D 1P3MD 5B0ZA 4KUDA 3C1CA 5B40D 5B31G 4QLCD 2Y2GA 1P3KA 3AZMC 5DNNC 2YFWA 4H9SC 3UTAC 3AZJB 1P34C 3REID 4JJNA 3NQJB 1U35C 3AZND 3C1BA 1ULYA 2Y2LA 3MNND 5B32B 3AZIC 5CPJB 1P3ID 4LD9C 4YM6C 2RVQC 3X1TC 3V9RA 3X1UA 4H9NB 5GSUC 5CP6B 3WAAC 1P3PA 3UT9B 3B0DB 3AZHB 3AZFC 5CPIA 1TZYC 1TAFB 3AZKB 2HIOD 3W96C 3B6FC 1M19B 3WA9D 3AZLC 1N1JA 4J8XB 4CAYA 4X23B 3AFAB 4WU8D 1P3OD 5AV5C 1ZLAA 4WNNB 5B1LC 3TU4B 1P3AB 3LJAC 2BYMB 5JRGA 1KX3B 4NE6A 1KX5A 4J8UA 1EQZA 3REJA 5CPKD 4J8VA 2F8NB 3REKC 2NZDA 3A6NC 1ID3D 3AZGD 4XZQC 4H9PB 5AVBA 1HTAA 3RELB 3X1SC 4HGAC 1P3FB 5AY8B 5B2JB 4R8PB 1KX4C 3AZMD 5DNND 1P3LA 3UTAD 2XD5A 1P34D 2Y2NA 3MGRB 1U35D 3A6NA 2F8NH 4WU9A 1AOIB 4XZQA 3X1UD 5BNXA 2NQBB 1BH9B 5JA4A 3W99C 3R45B 5GXQA 4J8WC 5B0ZB 2RIQA 3C1CB 3AZID 5AV9A 4XUJB 3W98B 4LD9D 1P3GB 2RVQD 3X1TD 1M18C 4JJNB 3O62C 3AZEC 5GSUD 3WAAD 3AN2B 2Y2MA 3C1BB 2PYOA 3NQUB 3A1KA 2CV5B 3AZFD 1TZYD 1B6WA 3B6FD 5GT3A 3W96D 5AV6C 1F66B 5B32G 5AV8A 3AZLD 5B40A 3REHC 4QLCA 1P3PB 5CPJC 5JRGD 3REIA 3AZNA 3W97A 4J8VD 5B1LD 5AVCB 2G5HC 3REHA 3WKJC 5CP6C 3LZ1B 3LJAD 3MNNA 1P3IA 5E5AA 3X1VB 2Y2IA 3B0DC 3A1IA 3AV1C 3REKD 2VQRA 3A6ND 3LELB 1W2EA 5BS7A 2HUEC 4Z2MH 4XZQD 1ZLAB 3X1SD 4KHAA 5B24C 1KX4D 4AWLB 3B6GA 4X23C 5BNVA 4CSRA 2NZDB 2HIOA 5B24A 3W99D 4J8WD 4G92B 1P3AC 2J8PA 2F8NG 1KX3C 1M18D 4WU8A 3O62D 5B2IB 3AZED 1P3OA 3AV2C 3EPKA 4KGCC 5B1MC 4ZUXC 1P3FC 4Z66B 5B2JC 5AV9B 3WTPB 2Y2PA 3LZ0A 1BFMA 3MGRC 4KGCA 5CPKA 5B31C 4DRBA 5AV6D 3W97D 2BYKB 4ZUXA 1ID3A 3AZGA 2AROC 4H9OA 1KU5A 3REHD 3H0LC 3AZMA 5DNNA 5CPJD 4H9SA 3KXBB 3UTAA 3W98C 1P34A 3KWQC 5E5AD 1U35A 1P3GC 2XD1A 3UTBB 4H9QB 4UUZA 1M1AC 3WKJD 2LY8A 1P3MB 3AZIA 5AV8B 3AN2C 4LD9A 4YM6A 3X1TA 3AV1D 3B6GD 3EPJA 2CV5C 1HQ3C 2G5IC 5GSUA 1P3BC 5B24D 3WAAA 5B33B 1F66C 1BH8A 3F6TA 2ZY3A 3MNNB 3MGSB 1HQ3A 5F99C 4X23D 1S32C 5DNMB 3AZFA 5GT0B 4Z2MG 1TZYA 3W96A 1P3BA 3B6FA 5G49B 3MVDC 3KUYB 5AVCC 3AZLA 1P3AD 3MGQB 3LZ1C 2FJ7B 1JFIB 1R4VA 2JSSA 3X1VC 3LZ0D 3AV2D 2DF4C 5AV5A 4KGCD 4YS3B 4H9RA 3LELC 5BNVB 4CSRB 5B1MD 5B1LA 4ZUXD 1F1EA 1PZRA 3LJAA 5B2JD 3WA9B 3B0BA 2Y2OA 5C3IB 3MGPC 2ZM5A 5FUGA 3MGRD 5B31D 3REKA 4ZBJC 1P3OB 2AROD 2BG1A 2IO5B 4WV4B 3X1SA 5B0YB 1KX4A 3MGPA 4G92C 4KUDB 3KWQD 2L5AA 4YM6D 4Z5TC 1P3KB 2YFWB 5BO0A 1M1AD 5CPKB 5B2IC 1Q9CA 3W99A 4J8WA 3AYWC 3B0CT 3AZMB 5DNNB 2W8SA 2CV5D 1HQ3D 3UTAB 1M18A 1U35B 3O62A 3AZEA 3AZJC 1P3BD 3V9RB 3X1UB 3AZIB 1S32D 5F99D 5B32C 3KXBC 3X1TB 3NQJA 5AV5D 5AV6A 3MVDD 3UTBC 5CPIB 5GSUB 5AVCD 3WAAB 4DRAA 5CPJA 1BH8B 5B32A 1N1JB 3UT9C 4CAYB 1WWIA 3X1VD 3IP4C 3AZHC 3AZFB 1H3OA 3B6FB 3WKJA 3AZKC 5CP6A 1M19C 5B33C 2YFVA 4NFTA 3MGPD 3AV1A 4J8XC 5JRGB 3MGSC 1KX5B 5DNMC 4J8UB 1EQZB 5GT0C 3AFAC 1TAFA 3REJB 4J8VB 3VH5T 3KUYC 5AVBB 3VH5W 3TU4C 4Z5TD 3MGQC 4X23A 1P3LB 2FJ7C 5B2ID 3REKB 4EO5B 3A6NB 4WNNA 4WU9B 4YS3C 4E44A 4XZQB 5BNXB 3AYWD 1A7WA 1P3AA 5JA4B 3RELC 5GXQB 5AY8C 1KX3A 4R8PC 3AZJD 2ZY2A 3AV2A 2F8NA 5BO0B 5B1MA 3EPLA 1AOIC 4H9PA 2IO5C 1P3FA 2NQBC 3H0MC 5B0YC 5B2JA 4R8PA 3VH6T 2PYOB 5B32D 3KXBD 2F8NK 5B0ZC 4KUDC 3C1CC 3VH6W 4XUJC 3MGRA 5B31A 1P3KC 1M18B 3UTBD 2AROA 4JJNC 5GT3B 3KSYA 5CP6D 3R45A 3W98A 3KWQA 4XUJA 5B40B 3C1BC 3UT9D 4QLCB 1P3GA 3AZHD 1M1AA 3REIB 2FFFB 5AV6B 3AZNB 3W97B 3AZKD 1M19D 5B33D 3X1UC 3AN2A 3REHB 3NQUA 4J8XD 3MGSD 2CV5A 1P3IB 5DNMD 1P3PC 5E5AB 5GT0D 3AFAD 1Z2CB 1H3OB 1F66A 5CPIC 3KUYD 3WKJB 4KHAB 2DQNC 3TU4D 2YFVB 3MGQD 5F99A 1S32A 3EPHA 1KX3D 2FJ7D 3AV1B 3B6GB 2UWXA 4YS3D 2HUEB 2F8ND 3MVDA 4NE3A 5AVCA 2HIOB 5B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA C;  1P3F D;  3REL D;  3LZ1 A;  5AY8 D;  4R8P D;  4AWL C;  3X1V A;  5JRG C;  3LEL A;  1KX5 C;  4WU8 B;  4J8U C;  1AOI D;  1EQZ C;  4G91 B;  3REJ C;  4J8V C;  2NQB D;  5B0Y D;  2NZD C;  3VH5 A;  3W98 D;  5B0Z D;  5AVB C;  3C1C D;  4KUD D;  4XUJ D;  1P3G D;  1P3K D;  4M6B A;  4NE5 A;  1P3L C;  3LZ0 B;  3AV2 B;  4JJN D;  1WWS A;  4KGC B;  4EO5 C;  5B1M B;  4WU9 C;  4ZUX B;  1ID3 B;  3AZG B;  4H9O B;  3AN2 D;  3C1B D;  4Z5T A;  4Z66 C;  5BT1 C;  5CHL B;  5GXQ C;  3B0C W;  1P34 B;  5AV9 C;  3WTP C;  5B31 B;  5B2I A;  5KDM A;  4UUZ B;  2ARO B;  1F66 D;  3AYW A;  4Z66 A;  3KWQ B;  1P3P D;  4YM6 B;  3WTP A;  2PYO C;  4LD9 B;  3VH6 A;  3AZJ A;  1M1A B;  2BYK A;  5CPI D;  5GT3 C;  3LZ1 D;  1P3M C;  5AV8 C;  3KXB A;  5B40 C;  1HQ3 B;  4QLC C;  3UTB A;  4H9Q A;  3LEL D;  1TZY B;  3REI C;  1P3B B;  4H9N A;  3W96 B;  3AZN C;  1ZLA D;  3W97 C;  1P3M A;  3AZL B;  1S32 B;  3UT9 A;  5F99 B;  3AZH A;  3WTP E;  1B67 A;  3MNN C;  1KX5 D;  1P3I C;  4J8U D;  5E5A C;  1EQZ D;  5AV5 B;  3REJ D;  2NZD D;  3AZK A;  3MVD B;  4H9R B;  1M19 A;  5B33 A;  5B1L B;  5BS7 C;  5AVB D;  3LJA B;  4J8X A;  3MGS A;  1P3L D;  5DNM A;  5FUG B;  5GT0 A;  3AFA A;  3B6G C;  5G49 A;  4WU9 D;  4WZS B;  3KUY A;  2HIO C;  4HGA B;  3X1S B;  3TU4 A;  3MGQ A;  1KX4 B;  3MGP B;  4Z66 D;  5GXQ D;  5BT1 D;  2BYM A;  3WA9 C;  2FJ7 A;  5AV9 D;  5C3I C;  3WTP D;  1JFI A;  4ZBJ B;  4YS3 A;  4WU8 C;  1P3O C;  4G91 C;  3REL A;  3W99 B;  4J8W B;  5AY8 A;  3WA9 A;  4E45 A;  2PYO D;  4Z5T B;  2CWE A;  1AOI A;  3O62 B;  3LZ0 C;  3AZE B;  5GT3 D;  5CPK C;  2NQB A;  5KDM B;  5B0Y A;  1BH9 A;  1ID3 C;  3AZG C;  3AYW B;  5AV8 D;  1P3M D;  5B0Z A;  4KUD A;  3C1C A;  5B40 D;  5B31 G;  4QLC D;  1P3K A;  3AZM C;  5DNN C;  2YFW A;  4H9S C;  3UTA C;  3AZJ B;  1P34 C;  3REI D;  4JJN A;  3NQJ B;  1U35 C;  3AZN D;  3C1B A;  1ULY A;  3MNN D;  5B32 B;  3AZI C;  5CPJ B;  1P3I D;  4LD9 C;  4YM6 C;  2RVQ C;  3X1T C;  3V9R A;  3X1U A;  4H9N B;  5GSU C;  5CP6 B;  3WAA C;  1P3P A;  3UT9 B;  3B0D B;  3AZH B;  3AZF C;  5CPI A;  1TZY C;  1TAF B;  3AZK B;  2HIO D;  3W96 C;  3B6F C;  1M19 B;  3WA9 D;  3AZL C;  1N1J A;  4J8X B;  4CAY A;  4X23 B;  3AFA B;  4WU8 D;  1P3O D;  5AV5 C;  1ZLA A;  4WNN B;  5B1L C;  3TU4 B;  1P3A B;  3LJA C;  2BYM B;  5JRG A;  1KX3 B;  4NE6 A;  1KX5 A;  4J8U A;  1EQZ A;  3REJ A;  5CPK D;  4J8V A;  2F8N B;  3REK C;  2NZD A;  3A6N C;  1ID3 D;  3AZG D;  4XZQ C;  4H9P B;  5AVB A;  1HTA A;  3REL B;  3X1S C;  4HGA C;  1P3F B;  5AY8 B;  5B2J B;  4R8P B;  1KX4 C;  3AZM D;  5DNN D;  1P3L A;  3UTA D;  1P34 D;  3MGR B;  1U35 D;  3A6N A;  2F8N H;  4WU9 A;  1AOI B;  4XZQ A;  3X1U D;  5BNX A;  2NQB B;  1BH9 B;  5JA4 A;  3W99 C;  3R45 B;  5GXQ A;  4J8W C;  5B0Z B;  3AZI D;  3C1C B;  3W98 B;  5AV9 A;  4XUJ B;  4LD9 D;  1P3G B;  2RVQ D;  3X1T D;  1M18 C;  4JJN B;  3O62 C;  3AZE C;  5GSU D;  3WAA D;  3AN2 B;  3C1B B;  2PYO A;  3NQU B;  2CV5 B;  3AZF D;  1TZY D;  1B6W A;  3B6F D;  5GT3 A;  3W96 D;  5AV6 C;  1F66 B;  5B32 G;  5AV8 A;  3AZL D;  5B40 A;  3REH C;  4QLC A;  1P3P B;  5CPJ C;  5JRG D;  3REI A;  3AZN A;  3W97 A;  4J8V D;  5B1L D;  5AVC B;  3REH A;  3WKJ C;  5CP6 C;  3LZ1 B;  3LJA D;  3MNN A;  1P3I A;  5E5A A;  3X1V B;  3B0D C;  3AV1 C;  3REK D;  3A6N D;  3LEL B;  5BS7 A;  4XZQ D;  2HUE C;  4Z2M H;  1ZLA B;  3X1S D;  4KHA A;  5B24 C;  1KX4 D;  4AWL B;  3B6G A;  4X23 C;  5BNV A;  4CSR A;  2NZD B;  2HIO A;  5B24 A;  3W99 D;  4J8W D;  4G92 B;  1P3A C;  2F8N G;  1KX3 C;  1M18 D;  4WU8 A;  3O62 D;  5B2I B;  3AZE D;  1P3O A;  3AV2 C;  4KGC C;  5B1M C;  4ZUX C;  1P3F C;  4Z66 B;  5B2J C;  5AV9 B;  3WTP B;  3LZ0 A;  1BFM A;  3MGR C;  4KGC A;  5CPK A;  5B31 C;  4DRB A;  5AV6 D;  3W97 D;  2BYK B;  4ZUX A;  1ID3 A;  3AZG A;  2ARO C;  4H9O A;  1KU5 A;  3REH D;  3AZM A;  5DNN A;  5CPJ D;  4H9S A;  3KXB B;  3UTA A;  3W98 C;  1P34 A;  3KWQ C;  5E5A D;  1U35 A;  1P3G C;  3UTB B;  4H9Q B;  4UUZ A;  1M1A C;  3WKJ D;  2LY8 A;  1P3M B;  3AZI A;  5AV8 B;  3AN2 C;  4LD9 A;  4YM6 A;  3X1T A;  3AV1 D;  3B6G D;  2CV5 C;  1HQ3 C;  5GSU A;  1P3B C;  5B24 D;  3WAA A;  5B33 B;  1F66 C;  1BH8 A;  3MNN B;  3MGS B;  1HQ3 A;  5F99 C;  4X23 D;  1S32 C;  5DNM B;  3AZF A;  5GT0 B;  4Z2M G;  1TZY A;  3W96 A;  1P3B A;  3B6F A;  5G49 B;  3MVD C;  3KUY B;  5AVC C;  3AZL A;  1P3A D;  3MGQ B;  3LZ1 C;  2FJ7 B;  1JFI B;  1R4V A;  2JSS A;  3X1V C;  3LZ0 D;  3AV2 D;  5AV5 A;  4KGC D;  4YS3 B;  4H9R A;  3LEL C;  5BNV B;  4CSR B;  5B1M D;  5B1L A;  4ZUX D;  1F1E A;  3LJA A;  5B2J D;  3WA9 B;  3B0B A;  5C3I B;  3MGP C;  5FUG A;  3MGR D;  5B31 D;  3REK A;  4ZBJ C;  1P3O B;  2ARO D;  2IO5 B;  4WV4 B;  3X1S A;  5B0Y B;  1KX4 A;  3MGP A;  4G92 C;  4KUD B;  3KWQ D;  2L5A A;  4YM6 D;  4Z5T C;  1P3K B;  2YFW B;  5BO0 A;  1M1A D;  5CPK B;  5B2I C;  1Q9C A;  3W99 A;  4J8W A;  3AYW C;  3B0C T;  3AZM B;  5DNN B;  2CV5 D;  1HQ3 D;  3UTA B;  1M18 A;  1U35 B;  3O62 A;  3AZE A;  3AZJ C;  1P3B D;  3V9R B;  3X1U B;  3AZI B;  1S32 D;  5F99 D;  5B32 C;  3KXB C;  3X1T B;  3NQJ A;  5AV5 D;  5AV6 A;  3MVD D;  3UTB C;  5CPI B;  5GSU B;  5AVC D;  3WAA B;  4DRA A;  5CPJ A;  1BH8 B;  5B32 A;  1N1J B;  3UT9 C;  4CAY B;  1WWI A;  3X1V D;  3AZH C;  3AZF B;  1H3O A;  3B6F B;  3WKJ A;  3AZK C;  5CP6 A;  1M19 C;  5B33 C;  2YFV A;  4NFT A;  3MGP D;  3AV1 A;  4J8X C;  5JRG B;  3MGS C;  1KX5 B;  5DNM C;  4J8U B;  1EQZ B;  5GT0 C;  3AFA C;  1TAF A;  3REJ B;  4J8V B;  3VH5 T;  3KUY C;  5AVB B;  3VH5 W;  3TU4 C;  4Z5T D;  3MGQ C;  4X23 A;  1P3L B;  2FJ7 C;  5B2I D;  3REK B;  4EO5 B;  3A6N B;  4WNN A;  4WU9 B;  4YS3 C;  4E44 A;  4XZQ B;  5BNX B;  3AYW D;  1A7W A;  1P3A A;  5JA4 B;  3REL C;  5GXQ B;  5AY8 C;  1KX3 A;  4R8P C;  3AZJ D;  3AV2 A;  2F8N A;  5BO0 B;  5B1M A;  1AOI C;  4H9P A;  2IO5 C;  1P3F A;  2NQB C;  5B0Y C;  5B2J A;  4R8P A;  3VH6 T;  2PYO B;  5B32 D;  3KXB D;  2F8N K;  5B0Z C;  4KUD C;  3C1C C;  3VH6 W;  4XUJ C;  3MGR A;  5B31 A;  1P3K C;  1M18 B;  3UTB D;  2ARO A;  4JJN C;  5GT3 B;  3KSY A;  5CP6 D;  3R45 A;  3W98 A;  3KWQ A;  4XUJ A;  5B40 B;  3C1B C;  3UT9 D;  4QLC B;  1P3G A;  3AZH D;  1M1A A;  3REI B;  5AV6 B;  3AZN B;  3W97 B;  3AZK D;  1M19 D;  5B33 D;  3X1U C;  3AN2 A;  3REH B;  3NQU A;  4J8X D;  3MGS D;  2CV5 A;  1P3I B;  5DNM D;  1P3P C;  5E5A B;  5GT0 D;  3AFA D;  1H3O B;  1F66 A;  5CPI C;  3KUY D;  3WKJ B;  4KHA B;  3TU4 D;  2YFV B;  3MGQ D;  5F99 A;  1S32 A;  1KX3 D;  2FJ7 D;  3AV1 B;  3B6G B;  4YS3 D;  2HUE B;  2F8N D;  3MVD A;  4NE3 A;  5AVC A;  2HIO B;  5B24 B; 
#chains in the Genus database with same CATH topology
 1ZLA C;  1P3F D;  3REL D;  3LZ1 A;  5AY8 D;  4R8P D;  4AWL C;  3X1V A;  5JRG C;  3LEL A;  1KX5 C;  4WU8 B;  4J8U C;  1AOI D;  1EQZ C;  4G91 B;  3REJ C;  4J8V C;  2NQB D;  5B0Y D;  2NZD C;  3P5J B;  3VH5 A;  3W98 D;  5B0Z D;  5AVB C;  3C1C D;  4KUD D;  4XUJ D;  3AL0 C;  3EG5 B;  1P3G D;  1P3K D;  4M6B A;  2ZY4 A;  4NE5 A;  1P3L C;  3LZ0 B;  3AV2 B;  4JJN D;  1WWS A;  4KGC B;  4EO5 C;  3FDD A;  5B1M B;  4ZUX B;  4WU9 C;  1ID3 B;  3AZG B;  4H9O B;  3AN2 D;  3C1B D;  4Z5T A;  4Z66 C;  5BT1 C;  5CHL B;  5GXQ C;  3B0C W;  1P34 B;  5AV9 C;  3WTP C;  5B31 B;  5B2I A;  2Y2K A;  4UUZ B;  2ARO B;  3H0R C;  5KDM A;  2Y2J A;  1F66 D;  3AYW A;  4Z66 A;  3KWQ B;  1P3P D;  4YM6 B;  3WTP A;  2PYO C;  4LD9 B;  3VH6 A;  3AZJ A;  1M1A B;  2BYK A;  5CPI D;  5GT3 C;  3LZ1 D;  1P3M C;  5AV8 C;  3KXB A;  4DQY B;  5B40 C;  1HQ3 B;  4QLC C;  4WJ3 C;  3UTB A;  4H9Q A;  3LEL D;  1TZY B;  3REI C;  1P3B B;  4H9N A;  3W96 B;  2F2A C;  3AZN C;  1ZLA D;  3W97 C;  2JE5 A;  1P3M A;  3AZL B;  1S32 B;  3UT9 A;  5F99 B;  3AZH A;  3WTP E;  1B67 A;  3MNN C;  1KX5 D;  1P3I C;  4J8U D;  5E5A C;  1EQZ D;  5AV5 B;  3REJ D;  2NZD D;  3AZK A;  3MVD B;  4H9R B;  1M19 A;  5B33 A;  5B1L B;  5BS7 C;  5AVB D;  3LJA B;  4J8X A;  3MGS A;  1P3L D;  5DNM A;  5FUG B;  5GT0 A;  3AFA A;  3B6G C;  3KFU G;  5G49 A;  4WU9 D;  4WZS B;  3KUY A;  2HIO C;  4HGA B;  3X1S B;  3TU4 A;  2Y2H A;  3MGQ A;  3MGP B;  1KX4 B;  4Z66 D;  5GXQ D;  5BT1 D;  2BYM A;  3WA9 C;  2FJ7 A;  5AV9 D;  5C3I C;  3WTP D;  1JFI A;  2Y2Q A;  4ZBJ B;  2ZY5 A;  4YS3 A;  2JCH A;  4WU8 C;  1P3O C;  4G91 C;  3REL A;  3W99 B;  4J8W B;  5AY8 A;  3WA9 A;  4E45 A;  2PYO D;  4Z5T B;  2CWE A;  1T3U A;  1AOI A;  3O62 B;  3LZ0 C;  3AZE B;  5GT3 D;  4UPK A;  5CPK C;  5KDM B;  5B0Y A;  2NQB A;  1BH9 A;  1ID3 C;  3AZG C;  3AYW B;  5AV8 D;  1P3M D;  5B0Z A;  4KUD A;  3C1C A;  5B40 D;  5B31 G;  4QLC D;  2Y2G A;  1P3K A;  3AZM C;  5DNN C;  2YFW A;  4H9S C;  3UTA C;  3AZJ B;  1P34 C;  3REI D;  4JJN A;  3NQJ B;  1U35 C;  3AZN D;  3C1B A;  1ULY A;  2Y2L A;  3MNN D;  5B32 B;  3AZI C;  5CPJ B;  1P3I D;  4LD9 C;  4YM6 C;  2RVQ C;  3X1T C;  3V9R A;  3X1U A;  4H9N B;  5GSU C;  5CP6 B;  3WAA C;  1P3P A;  3UT9 B;  3B0D B;  3AZH B;  3AZF C;  5CPI A;  1TZY C;  1TAF B;  3AZK B;  2HIO D;  3W96 C;  3B6F C;  1M19 B;  3WA9 D;  3AZL C;  1N1J A;  4J8X B;  4CAY A;  4X23 B;  3AFA B;  4WU8 D;  1P3O D;  5AV5 C;  1ZLA A;  4WNN B;  5B1L C;  3TU4 B;  1P3A B;  3LJA C;  2BYM B;  5JRG A;  1KX3 B;  4NE6 A;  1KX5 A;  4J8U A;  1EQZ A;  3REJ A;  5CPK D;  4J8V A;  2F8N B;  3REK C;  2NZD A;  3A6N C;  1ID3 D;  3AZG D;  4XZQ C;  4H9P B;  5AVB A;  1HTA A;  3REL B;  3X1S C;  4HGA C;  1P3F B;  5AY8 B;  5B2J B;  4R8P B;  1KX4 C;  3AZM D;  5DNN D;  1P3L A;  3UTA D;  2XD5 A;  1P34 D;  2Y2N A;  3MGR B;  1U35 D;  3A6N A;  2F8N H;  4WU9 A;  1AOI B;  4XZQ A;  3X1U D;  5BNX A;  2NQB B;  1BH9 B;  5JA4 A;  3W99 C;  3R45 B;  5GXQ A;  4J8W C;  5B0Z B;  2RIQ A;  3C1C B;  3AZI D;  5AV9 A;  4XUJ B;  3W98 B;  4LD9 D;  1P3G B;  2RVQ D;  3X1T D;  1M18 C;  4JJN B;  3O62 C;  3AZE C;  5GSU D;  3WAA D;  3AN2 B;  2Y2M A;  3C1B B;  2PYO A;  3NQU B;  3A1K A;  2CV5 B;  3AZF D;  1TZY D;  1B6W A;  3B6F D;  5GT3 A;  3W96 D;  5AV6 C;  1F66 B;  5B32 G;  5AV8 A;  3AZL D;  5B40 A;  3REH C;  4QLC A;  1P3P B;  5CPJ C;  5JRG D;  3REI A;  3AZN A;  3W97 A;  4J8V D;  5B1L D;  5AVC B;  2G5H C;  3REH A;  3WKJ C;  5CP6 C;  3LZ1 B;  3LJA D;  3MNN A;  1P3I A;  5E5A A;  3X1V B;  2Y2I A;  3B0D C;  3A1I A;  3AV1 C;  3REK D;  2VQR A;  3A6N D;  3LEL B;  1W2E A;  5BS7 A;  2HUE C;  4Z2M H;  4XZQ D;  1ZLA B;  3X1S D;  4KHA A;  5B24 C;  1KX4 D;  4AWL B;  3B6G A;  4X23 C;  5BNV A;  4CSR A;  2NZD B;  2HIO A;  5B24 A;  3W99 D;  4J8W D;  4G92 B;  1P3A C;  2J8P A;  2F8N G;  1KX3 C;  1M18 D;  4WU8 A;  3O62 D;  5B2I B;  3AZE D;  1P3O A;  3AV2 C;  3EPK A;  4KGC C;  5B1M C;  4ZUX C;  1P3F C;  4Z66 B;  5B2J C;  5AV9 B;  3WTP B;  2Y2P A;  3LZ0 A;  1BFM A;  3MGR C;  4KGC A;  5CPK A;  5B31 C;  4DRB A;  5AV6 D;  3W97 D;  2BYK B;  4ZUX A;  1ID3 A;  3AZG A;  2ARO C;  4H9O A;  1KU5 A;  3REH D;  3H0L C;  3AZM A;  5DNN A;  5CPJ D;  4H9S A;  3KXB B;  3UTA A;  3W98 C;  1P34 A;  3KWQ C;  5E5A D;  1U35 A;  1P3G C;  2XD1 A;  3UTB B;  4H9Q B;  4UUZ A;  1M1A C;  3WKJ D;  2LY8 A;  1P3M B;  3AZI A;  5AV8 B;  3AN2 C;  4LD9 A;  4YM6 A;  3X1T A;  3AV1 D;  3B6G D;  3EPJ A;  2CV5 C;  1HQ3 C;  2G5I C;  5GSU A;  1P3B C;  5B24 D;  3WAA A;  5B33 B;  1F66 C;  1BH8 A;  3F6T A;  2ZY3 A;  3MNN B;  3MGS B;  1HQ3 A;  5F99 C;  4X23 D;  1S32 C;  5DNM B;  3AZF A;  5GT0 B;  4Z2M G;  1TZY A;  3W96 A;  1P3B A;  3B6F A;  5G49 B;  3MVD C;  3KUY B;  5AVC C;  3AZL A;  1P3A D;  3MGQ B;  3LZ1 C;  2FJ7 B;  1JFI B;  1R4V A;  2JSS A;  3X1V C;  3LZ0 D;  3AV2 D;  2DF4 C;  5AV5 A;  4KGC D;  4YS3 B;  4H9R A;  3LEL C;  5BNV B;  4CSR B;  5B1M D;  5B1L A;  4ZUX D;  1F1E A;  1PZR A;  3LJA A;  5B2J D;  3WA9 B;  3B0B A;  2Y2O A;  5C3I B;  3MGP C;  2ZM5 A;  5FUG A;  3MGR D;  5B31 D;  3REK A;  4ZBJ C;  1P3O B;  2ARO D;  2BG1 A;  2IO5 B;  4WV4 B;  3X1S A;  5B0Y B;  1KX4 A;  3MGP A;  4G92 C;  4KUD B;  3KWQ D;  2L5A A;  4YM6 D;  4Z5T C;  1P3K B;  2YFW B;  5BO0 A;  1M1A D;  5CPK B;  5B2I C;  1Q9C A;  3W99 A;  4J8W A;  3AYW C;  3B0C T;  3AZM B;  5DNN B;  2W8S A;  2CV5 D;  1HQ3 D;  3UTA B;  1M18 A;  1U35 B;  3O62 A;  3AZE A;  3AZJ C;  1P3B D;  3V9R B;  3X1U B;  3AZI B;  1S32 D;  5F99 D;  5B32 C;  3KXB C;  3X1T B;  3NQJ A;  5AV5 D;  5AV6 A;  3MVD D;  3UTB C;  5CPI B;  5GSU B;  5AVC D;  3WAA B;  4DRA A;  5CPJ A;  1BH8 B;  5B32 A;  1N1J B;  3UT9 C;  4CAY B;  1WWI A;  3X1V D;  3IP4 C;  3AZH C;  3AZF B;  1H3O A;  3B6F B;  3WKJ A;  3AZK C;  5CP6 A;  1M19 C;  5B33 C;  2YFV A;  4NFT A;  3MGP D;  3AV1 A;  4J8X C;  5JRG B;  3MGS C;  1KX5 B;  5DNM C;  4J8U B;  1EQZ B;  5GT0 C;  3AFA C;  1TAF A;  3REJ B;  4J8V B;  3VH5 T;  3KUY C;  5AVB B;  3VH5 W;  3TU4 C;  4Z5T D;  3MGQ C;  4X23 A;  1P3L B;  2FJ7 C;  5B2I D;  3REK B;  4EO5 B;  3A6N B;  4WNN A;  4WU9 B;  4YS3 C;  4E44 A;  4XZQ B;  5BNX B;  3AYW D;  1A7W A;  1P3A A;  5JA4 B;  3REL C;  5GXQ B;  5AY8 C;  1KX3 A;  4R8P C;  3AZJ D;  2ZY2 A;  3AV2 A;  2F8N A;  5BO0 B;  5B1M A;  3EPL A;  1AOI C;  4H9P A;  2IO5 C;  1P3F A;  2NQB C;  3H0M C;  5B0Y C;  5B2J A;  4R8P A;  3VH6 T;  2PYO B;  5B32 D;  3KXB D;  2F8N K;  5B0Z C;  4KUD C;  3C1C C;  3VH6 W;  4XUJ C;  3MGR A;  5B31 A;  1P3K C;  1M18 B;  3UTB D;  2ARO A;  4JJN C;  5GT3 B;  3KSY A;  5CP6 D;  3R45 A;  3W98 A;  3KWQ A;  4XUJ A;  5B40 B;  3C1B C;  3UT9 D;  4QLC B;  1P3G A;  3AZH D;  1M1A A;  3REI B;  2FFF B;  5AV6 B;  3AZN B;  3W97 B;  3AZK D;  1M19 D;  5B33 D;  3X1U C;  3AN2 A;  3REH B;  3NQU A;  4J8X D;  3MGS D;  2CV5 A;  1P3I B;  5DNM D;  1P3P C;  5E5A B;  5GT0 D;  3AFA D;  1Z2C B;  1H3O B;  1F66 A;  5CPI C;  3KUY D;  3WKJ B;  4KHA B;  2DQN C;  3TU4 D;  2YFV B;  3MGQ D;  5F99 A;  1S32 A;  3EPH A;  1KX3 D;  2FJ7 D;  3AV1 B;  3B6G B;  2UWX A;  4YS3 D;  2HUE B;  2F8N D;  3MVD A;  4NE3 A;  5AVC A;  2HIO B;  5B24 B; 
#chains in the Genus database with same CATH homology
 1ZLA C;  1P3F D;  3REL D;  3LZ1 A;  5AY8 D;  4R8P D;  4AWL C;  3X1V A;  5JRG C;  3LEL A;  1KX5 C;  4WU8 B;  4J8U C;  1AOI D;  1EQZ C;  4G91 B;  3REJ C;  4J8V C;  2NQB D;  5B0Y D;  2NZD C;  3P5J B;  3VH5 A;  3W98 D;  5B0Z D;  5AVB C;  3C1C D;  4KUD D;  4XUJ D;  3AL0 C;  3EG5 B;  1P3G D;  1P3K D;  4M6B A;  2ZY4 A;  4NE5 A;  1P3L C;  3LZ0 B;  3AV2 B;  4JJN D;  1WWS A;  4KGC B;  4EO5 C;  3FDD A;  5B1M B;  4ZUX B;  4WU9 C;  1ID3 B;  3AZG B;  4H9O B;  3AN2 D;  3C1B D;  4Z5T A;  4Z66 C;  5BT1 C;  5CHL B;  5GXQ C;  3B0C W;  1P34 B;  5AV9 C;  3WTP C;  5B31 B;  5B2I A;  2Y2K A;  4UUZ B;  2ARO B;  3H0R C;  5KDM A;  2Y2J A;  1F66 D;  3AYW A;  4Z66 A;  3KWQ B;  1P3P D;  4YM6 B;  3WTP A;  2PYO C;  4LD9 B;  3VH6 A;  3AZJ A;  1M1A B;  2BYK A;  5CPI D;  5GT3 C;  3LZ1 D;  1P3M C;  5AV8 C;  3KXB A;  4DQY B;  5B40 C;  1HQ3 B;  4QLC C;  4WJ3 C;  3UTB A;  4H9Q A;  3LEL D;  1TZY B;  3REI C;  1P3B B;  4H9N A;  3W96 B;  2F2A C;  3AZN C;  1ZLA D;  3W97 C;  2JE5 A;  1P3M A;  3AZL B;  1S32 B;  3UT9 A;  5F99 B;  3AZH A;  3WTP E;  1B67 A;  3MNN C;  1KX5 D;  1P3I C;  4J8U D;  5E5A C;  1EQZ D;  5AV5 B;  3REJ D;  2NZD D;  3AZK A;  3MVD B;  4H9R B;  1M19 A;  5B33 A;  5B1L B;  5BS7 C;  5AVB D;  3LJA B;  4J8X A;  3MGS A;  1P3L D;  5DNM A;  5FUG B;  5GT0 A;  3AFA A;  3B6G C;  3KFU G;  5G49 A;  4WU9 D;  4WZS B;  3KUY A;  2HIO C;  4HGA B;  3X1S B;  3TU4 A;  2Y2H A;  3MGQ A;  3MGP B;  1KX4 B;  4Z66 D;  5GXQ D;  5BT1 D;  2BYM A;  3WA9 C;  2FJ7 A;  5AV9 D;  5C3I C;  3WTP D;  1JFI A;  2Y2Q A;  4ZBJ B;  2ZY5 A;  4YS3 A;  2JCH A;  4WU8 C;  1P3O C;  4G91 C;  3REL A;  3W99 B;  4J8W B;  5AY8 A;  3WA9 A;  4E45 A;  2PYO D;  4Z5T B;  2CWE A;  1T3U A;  1AOI A;  3O62 B;  3LZ0 C;  3AZE B;  5GT3 D;  4UPK A;  5CPK C;  5KDM B;  5B0Y A;  2NQB A;  1BH9 A;  1ID3 C;  3AZG C;  3AYW B;  5AV8 D;  1P3M D;  5B0Z A;  4KUD A;  3C1C A;  5B40 D;  5B31 G;  4QLC D;  2Y2G A;  1P3K A;  3AZM C;  5DNN C;  2YFW A;  4H9S C;  3UTA C;  3AZJ B;  1P34 C;  3REI D;  4JJN A;  3NQJ B;  1U35 C;  3AZN D;  3C1B A;  1ULY A;  2Y2L A;  3MNN D;  5B32 B;  3AZI C;  5CPJ B;  1P3I D;  4LD9 C;  4YM6 C;  2RVQ C;  3X1T C;  3V9R A;  3X1U A;  4H9N B;  5GSU C;  5CP6 B;  3WAA C;  1P3P A;  3UT9 B;  3B0D B;  3AZH B;  3AZF C;  5CPI A;  1TZY C;  1TAF B;  3AZK B;  2HIO D;  3W96 C;  3B6F C;  1M19 B;  3WA9 D;  3AZL C;  1N1J A;  4J8X B;  4CAY A;  4X23 B;  3AFA B;  4WU8 D;  1P3O D;  5AV5 C;  1ZLA A;  4WNN B;  5B1L C;  3TU4 B;  1P3A B;  3LJA C;  2BYM B;  5JRG A;  1KX3 B;  4NE6 A;  1KX5 A;  4J8U A;  1EQZ A;  3REJ A;  5CPK D;  4J8V A;  2F8N B;  3REK C;  2NZD A;  3A6N C;  1ID3 D;  3AZG D;  4XZQ C;  4H9P B;  5AVB A;  1HTA A;  3REL B;  3X1S C;  4HGA C;  1P3F B;  5AY8 B;  5B2J B;  4R8P B;  1KX4 C;  3AZM D;  5DNN D;  1P3L A;  3UTA D;  2XD5 A;  1P34 D;  2Y2N A;  3MGR B;  1U35 D;  3A6N A;  2F8N H;  4WU9 A;  1AOI B;  4XZQ A;  3X1U D;  5BNX A;  2NQB B;  1BH9 B;  5JA4 A;  3W99 C;  3R45 B;  5GXQ A;  4J8W C;  5B0Z B;  2RIQ A;  3C1C B;  3AZI D;  5AV9 A;  4XUJ B;  3W98 B;  4LD9 D;  1P3G B;  2RVQ D;  3X1T D;  1M18 C;  4JJN B;  3O62 C;  3AZE C;  5GSU D;  3WAA D;  3AN2 B;  2Y2M A;  3C1B B;  2PYO A;  3NQU B;  3A1K A;  2CV5 B;  3AZF D;  1TZY D;  1B6W A;  3B6F D;  5GT3 A;  3W96 D;  5AV6 C;  1F66 B;  5B32 G;  5AV8 A;  3AZL D;  5B40 A;  3REH C;  4QLC A;  1P3P B;  5CPJ C;  5JRG D;  3REI A;  3AZN A;  3W97 A;  4J8V D;  5B1L D;  5AVC B;  2G5H C;  3REH A;  3WKJ C;  5CP6 C;  3LZ1 B;  3LJA D;  3MNN A;  1P3I A;  5E5A A;  3X1V B;  2Y2I A;  3B0D C;  3A1I A;  3AV1 C;  3REK D;  2VQR A;  3A6N D;  3LEL B;  1W2E A;  5BS7 A;  2HUE C;  4Z2M H;  4XZQ D;  1ZLA B;  3X1S D;  4KHA A;  5B24 C;  1KX4 D;  4AWL B;  3B6G A;  4X23 C;  5BNV A;  4CSR A;  2NZD B;  2HIO A;  5B24 A;  3W99 D;  4J8W D;  4G92 B;  1P3A C;  2J8P A;  2F8N G;  1KX3 C;  1M18 D;  4WU8 A;  3O62 D;  5B2I B;  3AZE D;  1P3O A;  3AV2 C;  3EPK A;  4KGC C;  5B1M C;  4ZUX C;  1P3F C;  4Z66 B;  5B2J C;  5AV9 B;  3WTP B;  2Y2P A;  3LZ0 A;  1BFM A;  3MGR C;  4KGC A;  5CPK A;  5B31 C;  4DRB A;  5AV6 D;  3W97 D;  2BYK B;  4ZUX A;  1ID3 A;  3AZG A;  2ARO C;  4H9O A;  1KU5 A;  3REH D;  3H0L C;  3AZM A;  5DNN A;  5CPJ D;  4H9S A;  3KXB B;  3UTA A;  3W98 C;  1P34 A;  3KWQ C;  5E5A D;  1U35 A;  1P3G C;  2XD1 A;  3UTB B;  4H9Q B;  4UUZ A;  1M1A C;  3WKJ D;  2LY8 A;  1P3M B;  3AZI A;  5AV8 B;  3AN2 C;  4LD9 A;  4YM6 A;  3X1T A;  3AV1 D;  3B6G D;  3EPJ A;  2CV5 C;  1HQ3 C;  2G5I C;  5GSU A;  1P3B C;  5B24 D;  3WAA A;  5B33 B;  1F66 C;  1BH8 A;  3F6T A;  2ZY3 A;  3MNN B;  3MGS B;  1HQ3 A;  5F99 C;  4X23 D;  1S32 C;  5DNM B;  3AZF A;  5GT0 B;  4Z2M G;  1TZY A;  3W96 A;  1P3B A;  3B6F A;  5G49 B;  3MVD C;  3KUY B;  5AVC C;  3AZL A;  1P3A D;  3MGQ B;  3LZ1 C;  2FJ7 B;  1JFI B;  1R4V A;  2JSS A;  3X1V C;  3LZ0 D;  3AV2 D;  2DF4 C;  5AV5 A;  4KGC D;  4YS3 B;  4H9R A;  3LEL C;  5BNV B;  4CSR B;  5B1M D;  5B1L A;  4ZUX D;  1F1E A;  1PZR A;  3LJA A;  5B2J D;  3WA9 B;  3B0B A;  2Y2O A;  5C3I B;  3MGP C;  2ZM5 A;  5FUG A;  3MGR D;  5B31 D;  3REK A;  4ZBJ C;  1P3O B;  2ARO D;  2BG1 A;  2IO5 B;  4WV4 B;  3X1S A;  5B0Y B;  1KX4 A;  3MGP A;  4G92 C;  4KUD B;  3KWQ D;  2L5A A;  4YM6 D;  4Z5T C;  1P3K B;  2YFW B;  5BO0 A;  1M1A D;  5CPK B;  5B2I C;  1Q9C A;  3W99 A;  4J8W A;  3AYW C;  3B0C T;  3AZM B;  5DNN B;  2W8S A;  2CV5 D;  1HQ3 D;  3UTA B;  1M18 A;  1U35 B;  3O62 A;  3AZE A;  3AZJ C;  1P3B D;  3V9R B;  3X1U B;  3AZI B;  1S32 D;  5F99 D;  5B32 C;  3KXB C;  3X1T B;  3NQJ A;  5AV5 D;  5AV6 A;  3MVD D;  3UTB C;  5CPI B;  5GSU B;  5AVC D;  3WAA B;  4DRA A;  5CPJ A;  1BH8 B;  5B32 A;  1N1J B;  3UT9 C;  4CAY B;  1WWI A;  3X1V D;  3IP4 C;  3AZH C;  3AZF B;  1H3O A;  3B6F B;  3WKJ A;  3AZK C;  5CP6 A;  1M19 C;  5B33 C;  2YFV A;  4NFT A;  3MGP D;  3AV1 A;  4J8X C;  5JRG B;  3MGS C;  1KX5 B;  5DNM C;  4J8U B;  1EQZ B;  5GT0 C;  3AFA C;  1TAF A;  3REJ B;  4J8V B;  3VH5 T;  3KUY C;  5AVB B;  3VH5 W;  3TU4 C;  4Z5T D;  3MGQ C;  4X23 A;  1P3L B;  2FJ7 C;  5B2I D;  3REK B;  4EO5 B;  3A6N B;  4WNN A;  4WU9 B;  4YS3 C;  4E44 A;  4XZQ B;  5BNX B;  3AYW D;  1A7W A;  1P3A A;  5JA4 B;  3REL C;  5GXQ B;  5AY8 C;  1KX3 A;  4R8P C;  3AZJ D;  2ZY2 A;  3AV2 A;  2F8N A;  5BO0 B;  5B1M A;  3EPL A;  1AOI C;  4H9P A;  2IO5 C;  1P3F A;  2NQB C;  3H0M C;  5B0Y C;  5B2J A;  4R8P A;  3VH6 T;  2PYO B;  5B32 D;  3KXB D;  2F8N K;  5B0Z C;  4KUD C;  3C1C C;  3VH6 W;  4XUJ C;  3MGR A;  5B31 A;  1P3K C;  1M18 B;  3UTB D;  2ARO A;  4JJN C;  5GT3 B;  3KSY A;  5CP6 D;  3R45 A;  3W98 A;  3KWQ A;  4XUJ A;  5B40 B;  3C1B C;  3UT9 D;  4QLC B;  1P3G A;  3AZH D;  1M1A A;  3REI B;  2FFF B;  5AV6 B;  3AZN B;  3W97 B;  3AZK D;  1M19 D;  5B33 D;  3X1U C;  3AN2 A;  3REH B;  3NQU A;  4J8X D;  3MGS D;  2CV5 A;  1P3I B;  5DNM D;  1P3P C;  5E5A B;  5GT0 D;  3AFA D;  1Z2C B;  1H3O B;  1F66 A;  5CPI C;  3KUY D;  3WKJ B;  4KHA B;  2DQN C;  3TU4 D;  2YFV B;  3MGQ D;  5F99 A;  1S32 A;  3EPH A;  1KX3 D;  2FJ7 D;  3AV1 B;  3B6G B;  2UWX A;  4YS3 D;  2HUE B;  2F8N D;  3MVD A;  4NE3 A;  5AVC A;  2HIO B;  5B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...