3VH6A

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form ii
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
GEQRELLIQRLRAAVHYTTGALAQDVAEDKGVLFSKQTVAAISEITFRQAENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
total genus 42
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh6A00
3LZ1A 4J8XD 3X1UC 1M1AA 3B6FD 3AZGA 4JJNA 3AV1A 3AZMD 1P3GC 2NQBD 5AVCA 2RVQC 3KWQA 1BH8A 5AY8D 4J8VA 3REJA 3TU4A 4WU9C 4Z5TA 1S32B 4ZUXB 4KHAB 1P34A 2PYOD 1ID3D 4KGCA 3MVDC 1P3IB 3WTPB 1KX4A 1ZLAD 1HQ3D 2NZDB 3KXBD 5F99C 4NE3A 3RELB 1R4VA 2BYKA 5B1MC 1KU5A 3C1BC 1P3MD 1M19B 5C3IC 5B40D 1F66D 4E44A 4R8PA 5B0ZD 1P3BC 5DNNB 1BH9B 1F1EA 4WZSB 4YM6B 4AWLB 2CV5A 3C1CC 3W97C 3UTAB 1AOIB 1JFIB 3AZND 4H9QA 5AV9B 1TAFA 2CWEA 4J8WB 5FUGB 3NQUB 5B0YC 4WV4B 3MGSD 1P3GA 4XUJC 3R45B 5AV6C 4UUZB 3X1VC 5GT0B 3X1SB 3X1UD 4WU8B 1ULYA 3AN2C 4WU9A 3AFAC 3WA9B 3LELC 4QLCC 3W96B 1KX5B 1EQZB 5JA4B 5E5AB 3MGRB 5CPJB 5JRGC 5DNMD 3VH6W 1P3FC 4ZUXD 3MVDA 3X1TC 1WWSA 4H9RA 5B24A 3AYWB 3REKD 4EO5C 3VH5W 3LZ0A 3AZJA 4H9OA 1P3PB 4XZQC 3C1BA 2FJ7B 5F99D 3AZHB 2HIOD 1P3BA 4J8XC 4J8UA 2YFVA 4YS3C 3C1CA 5CPIB 3B6FC 1P3KA 3AZLB 3AZMC 2F8NG 2NQBC 3REIB 5AY8C 5B1LB 5B0YA 5B32G 4YM6D 4XUJA 5AV6A 3UTBB 3X1VA 3UTAD 2PYOC 3B0BA 1P3LB 3AZID 1N1JB 5G49A 1P3OC 3AFAA 3B6GD 4CAYB 2IO5B 5AV9D 1KX3A 4J8WD 5GSUB 3WKJB 3LJAB 1ZLAC 3AN2D 4Z66A 1HQ3C 3X1SD 5BNXA 5AV5C 3KXBC 4M6BA 1P3FA 5B31A 4G91B 3X1TA 3WA9D 3LZ1B 4QLCD 3V9RA 1M1AB 5GT3B 1M18B 3AZGB 5B2JB 3UT9A 5B40C 4Z2MH 5JRGD 4Z2MG 3AV1B 3MGRD 4XZQA 1TZYA 1BH8B 5B0ZC 3KWQB 3AV2B 1U35D 4J8VB 4NE6A 5CP6D 3AYWD 3A6ND 1P34B 3AZNC 3W99B 4KUDB 3B6FA 5CHLB 5AVBB 3AZMA 3REHB 3MGSC 2NQBA 5GXQD 3WAAD 2FJ7D 5AY8A 3AZHD 4YS3D 3AZFB 4LD9D 2PYOA 1ID3A 2AROB 2BYKB 2LY8A 3REID 5B1LD 4R8PB 4HGAB 5DNMC 5AV8D 3UTBD 4ZUXC 1ZLAA 1HQ3A 1P3OD 3VH6T 2CV5B 3O62D 3KXBA 3REKC 4X23B 3MNNA 3VH5T 3KUYB 4H9QB 5BT1D 1TAFB 1P3AB 4H9NA 1P3MA 5AV5D 5B40A 3WTPC 1P3IC 1F66A 1P3GB 5B0ZA 2HIOC 3LZ1D 3RELC 3AZED 3KSYA 5BS7A 5GT3D 1M18D 3AZNA 5B2JD 5B2IB 3AV2D 3MGSA 4YM6C 4AWLC 3X1UA 3UTAC 1AOIC 4H9RB 3AZIC 3B6GC 3W99D 5KDMB 5B24B 4KUDD 5AV9C 3LZ0B 3W98B 5CPKB 5AVBD 4J8WC 3AZJB 3REHD 3C1BB 3MGQB 5GT0C 3X1SC 5DNMA 3AZFD 4ZUXA 1P3BB 3WA9C 4J8UB 5B33B 2YFVB 3B0DB 3NQJB 3REKA 1KX5C 2AROD 1P3KB 4H9PA 3VH6A 1S32D 3MGRC 5CPJC 1U35C 3VH5A 5B0YB 5CP6C 5F99A 3AYWC 2HIOA 3A6NC 3B0CW 3MGPB 4X23D 2F8NB 5G49B 3AFAB 5B1MA 3KUYD 1P3PC 1P3ID 3WTPD 1P3AD 5B32B 3WAAC 1KX3B 5GXQC 2NZDD 2FJ7C 2BYMB 3AZHC 4Z66B 5BNVA 3RELD 5BNXB 4YM6A 3W97A 4LD9C 5B31B 3UTAA 4ZBJC 1M19D 2F8NH 3AZIA 3V9RB 3B6GA 5AV9A 5DNND 5B2ID 3UT9B 3REIC 4J8WA 5FUGA 5B1LC 5AV8C 3UTBC 3R45A 1AOID 1TZYB 3AN2A 3X1SA 1P3LC 3O62C 3WA9A 3LELA 5B31G 4QLCA 3W98D 5CPKD 5GSUC 5BT1C 3B6FB 3WKJC 3AZKB 4CSRB 5GT0D 5JA4A 5JRGA 4WU8D 3MGQD 3AZMB 2NQBB 3MGRA 1U35A 5AY8B 3LZ1C 5B33D 5CP6A 3AZEC 3AYWA 3W96D 1KX5D 5GT3C 3A6NA 1M18C 1EQZD 4JJNB 5B2JC 5E5AD 1ID3B 2HUEC 2YFWA 5AVCB 5CPJD 3REJB 3KWQC 3TU4B 4WNNA 3AV2C 3WAAA 4Z5TB 5GXQA 2FJ7A 4J8XA 3AZHA 1Q9CA 1P34C 4YS3A 4DRBA 3W99C 3MGPD 1P3PD 2F8ND 4KGCB 4KUDC 4LD9A 4G92C 5AVBC 3MNNB 5B32D 3REHC 1KX4B 1P3MB 3REIA 1BFMA 5B1LA 1F66B 5CPID 5AV8A 3UTBA 3AZFC 4H9SC 3AZLD 1P3OA 2L5AA 3O62A 2AROC 3AZNB 3UT9D 1S32C 5AV5A 5BO0A 1P3LD 3MGSB 2CV5C 3X1UB 4X23C 5GSUD 1H3OA 3AZEA 3B0CT 3WKJD 3LJAD 3KUYC 5GT3A 1M18A 1P3AC 3AZKD 5B2JA 2NZDC 4WU9B 3AV2A 1M1AD 5DNMB 3AZGD 1M19C 4JJND 3W99A 3AV1D 4KUDA 3REKB 5AVCD 3KWQD 5DNNC 5B2IC 4H9PB 3REJD 5AVBA 4J8VD 3TU4D 3REHA 4Z5TD 3MVDB 1P34D 4KGCD 3AZFA 5B24C 5F99B 2HIOB 4H9SA 3LZ0C 4H9OB 3W98C 5CPKC 3AZJC 3MNND 4E45A 5B1MB 2AROA 5C3IB 1KX4D 4WU8C 3MGQC 1S32A 4KHAA 5BNVB 4J8UC 5B33C 3C1CB 3W97B 3W96C 1EQZC 3B0DC 1P3KC 4X23A 5E5AC 3AZIB 3B6GB 4R8PD 3KUYA 1P3IA 3WTPA 1P3AA 2CV5D 2NZDA 4XUJB 5AV6B 3X1VB 1B67A 1B6WA 3AN2B 3RELA 3MGPC 3LELB 4QLCB 1M19A 5B32C 1P3GD 1KX3C 2RVQD 4NE5A 5DNNA 5B2IA 1BH9A 4WU9D 5JRGB 4Z66C 5CPIC 1P3FB 1HTAA 3X1TB 1AOIA 1U35B 1JFIA 3AZLC 2F8NK 5B31C 5CP6B 4EO5B 5KDMA 3A6NB 3NQUA 3UT9C 5CPKA 3W98A 2YFWB 4XZQB 1A7WA 4UUZA 4NFTA 5GT0A 1TZYC 3MVDD 4WU8A 4WNNB 3MGQA 3WAAB 5GXQB 5B24D 4J8XB 2IO5C 3LZ0D 5B33A 3AZJD 4YS3B 3LJAC 3W96A 1KX5A 1EQZA 3NQJA 4LD9B 5B1MD 4ZBJB 3C1BD 3AZKC 5E5AA 5CPJA 4G91C 1P3BD 4J8UD 1M1AC 3C1CD 5AV8B 3W97D 3AZGC 1P3KD 2PYOB 1P3OB 3MGPA 4JJNC 2F8NA 3AV1C 1P3PA 1ID3C 3O62B 5AVCC 3REJC 4J8VC 5B32A 5B0YD 3TU4C 4Z5TC 4XUJD 5AV6D 1ZLAB 2BYMA 1HQ3B 3X1VD 5AV5B 5BO0B 3WTPE 3KXBB 5CPIA 4KGCC 3AFAD 3AZLA 3LELD 1KX3D 3AZEB 1H3OB 2JSSA 3MNNC 4H9NB 1KX4C 5B40B 4Z66D 1P3MC 1WWIA 2HUEB 1F66C 5B0ZB 1P3FD 5B31D 3X1TD 1P3LA 1N1JA 4CAYA 4DRAA 5BS7C 5GSUA 3WKJA 3LJAA 4R8PC 4HGAC 4XZQD 1TZYD 4G92B 3AZKA 4CSRA
chains in the Genus database with same CATH superfamily
2ZY4A 3LZ1A 4J8XD 3X1UC 1M1AA 3B6FD 3AZGA 4JJNA 3AV1A 3AZMD 1P3GC 2NQBD 5AVCA 2RVQC 3KWQA 1BH8A 5AY8D 4J8VA 3REJA 3TU4A 4WU9C 4Z5TA 1S32B 4ZUXB 4KHAB 1P34A 2PYOD 1ID3D 2RIQA 4KGCA 3MVDC 1P3IB 3WTPB 1KX4A 1ZLAD 1HQ3D 2NZDB 3KXBD 5F99C 2VQRA 4NE3A 3RELB 1R4VA 2BYKA 5B1MC 1KU5A 3C1BC 1P3MD 1M19B 5C3IC 5B40D 1F66D 4E44A 4R8PA 5B0ZD 1P3BC 5DNNB 1BH9B 1F1EA 4WZSB 4YM6B 4AWLB 2CV5A 3C1CC 3W97C 3UTAB 1AOIB 1JFIB 3AZND 4H9QA 5AV9B 1TAFA 2CWEA 4J8WB 5FUGB 3NQUB 2BG1A 5B0YC 4WV4B 3MGSD 1P3GA 4XUJC 3R45B 5AV6C 4UUZB 3H0LC 5GT0B 3X1SB 3X1UD 3X1VC 4WU8B 1ULYA 3AN2C 4WU9A 3AFAC 3WA9B 3LELC 4QLCC 3W96B 1KX5B 1EQZB 5JA4B 5E5AB 3MGRB 5CPJB 5JRGC 5DNMD 3VH6W 1P3FC 4ZUXD 3MVDA 3X1TC 1WWSA 4H9RA 5B24A 3AYWB 3REKD 4EO5C 3VH5W 3LZ0A 3AZJA 4H9OA 1P3PB 3P5JB 4XZQC 3C1BA 2FJ7B 5F99D 3AZHB 2HIOD 1P3BA 4J8XC 4J8UA 2YFVA 4YS3C 3C1CA 5CPIB 3B6FC 1P3KA 3AZLB 3AZMC 2F8NG 2NQBC 3REIB 5AY8C 5B1LB 5B0YA 5B32G 4YM6D 4XUJA 5AV6A 3UTBB 3X1VA 3UTAD 2PYOC 3B0BA 1P3LB 3AZID 1N1JB 5G49A 1P3OC 3AFAA 3B6GD 4CAYB 2IO5B 5AV9D 1KX3A 4J8WD 5GSUB 3WKJB 3LJAB 1ZLAC 3AN2D 4Z66A 1HQ3C 3X1SD 5BNXA 5AV5C 3KXBC 4M6BA 1P3FA 5B31A 4G91B 3X1TA 3WA9D 3LZ1B 4QLCD 3V9RA 1M1AB 5GT3B 1M18B 3AZGB 5B2JB 3UT9A 5B40C 4Z2MH 5JRGD 4Z2MG 3AV1B 3MGRD 2ZY5A 4XZQA 1TZYA 1BH8B 5B0ZC 3KWQB 3AV2B 1U35D 4J8VB 4NE6A 5CP6D 3AYWD 3A6ND 1P34B 3AZNC 3W99B 4KUDB 3B6FA 5CHLB 5AVBB 3AZMA 3REHB 3MGSC 2NQBA 5GXQD 3WAAD 2FJ7D 3EPKA 5AY8A 3AZHD 4YS3D 3AZFB 4LD9D 2PYOA 1ID3A 2AROB 2Y2QA 2BYKB 2LY8A 3REID 5B1LD 4R8PB 4HGAB 5DNMC 5AV8D 3UTBD 4ZUXC 1ZLAA 1HQ3A 1P3OD 3VH6T 2CV5B 3O62D 2Y2IA 3KXBA 3REKC 4X23B 3MNNA 3VH5T 3KUYB 4H9QB 5BT1D 1TAFB 3EPLA 3EPJA 1P3AB 4H9NA 1P3MA 2Y2KA 5AV5D 5B40A 3WTPC 1P3IC 1F66A 1P3GB 5B0ZA 2HIOC 3LZ1D 3RELC 3AZED 3KSYA 5BS7A 5GT3D 1M18D 2XD5A 3AZNA 5B2JD 5B2IB 3IP4C 3AV2D 3MGSA 4YM6C 4AWLC 3X1UA 3UTAC 1AOIC 4H9RB 3AZIC 3B6GC 3W99D 5KDMB 5B24B 4KUDD 5AV9C 3A1KA 3LZ0B 3W98B 5CPKB 5AVBD 4J8WC 3AZJB 3REHD 3AL0C 3C1BB 3MGQB 5GT0C 3X1SC 5DNMA 3AZFD 4ZUXA 1P3BB 3WA9C 4J8UB 5B33B 2YFVB 3B0DB 3NQJB 3REKA 2W8SA 1KX5C 2AROD 1PZRA 4H9PA 1P3KB 3VH6A 1S32D 3MGRC 5CPJC 1U35C 2DF4C 3VH5A 5B0YB 5CP6C 5F99A 3AYWC 2HIOA 3A6NC 2Y2GA 3B0CW 3MGPB 4X23D 2F8NB 5G49B 2Y2LA 5B1MA 2DQNC 3AFAB 3KUYD 1P3PC 1P3ID 3WTPD 1P3AD 5B32B 3WAAC 2JE5A 1KX3B 5GXQC 2NZDD 2FJ7C 2BYMB 3AZHC 4Z66B 5BNVA 3RELD 5BNXB 3H0RC 3W97A 4YM6A 4LD9C 5B31B 3UTAA 4ZBJC 1M19D 2F8NH 3AZIA 3V9RB 3B6GA 2XD1A 5AV9A 5DNND 5B2ID 3UT9B 3REIC 4J8WA 5FUGA 5B1LC 5AV8C 3UTBC 3R45A 1AOID 1TZYB 3AN2A 3X1SA 3F6TA 1P3LC 3O62C 2G5IC 3WA9A 3LELA 5B31G 4QLCA 3W98D 5CPKD 5GSUC 5BT1C 3B6FB 3WKJC 3AZKB 4CSRB 1W2EA 5GT0D 5JA4A 5JRGA 4WU8D 3MGQD 3AZMB 2NQBB 3MGRA 1U35A 5AY8B 3LZ1C 5B33D 5CP6A 3AZEC 3AYWA 3W96D 1KX5D 5GT3C 3A6NA 1M18C 1EQZD 4JJNB 5B2JC 5E5AD 1ID3B 2HUEC 2YFWA 5AVCB 5CPJD 3REJB 3KWQC 3FDDA 4WNNA 3TU4B 3AV2C 3WAAA 4Z5TB 5GXQA 2FJ7A 4J8XA 3AZHA 1Q9CA 1P34C 4YS3A 4DRBA 3W99C 3MGPD 1P3PD 2F8ND 3A1IA 4KGCB 4KUDC 4LD9A 4G92C 5AVBC 3MNNB 5B32D 2Y2JA 2Y2OA 3REHC 1KX4B 1P3MB 3REIA 1BFMA 3EG5B 5B1LA 1F66B 5CPID 2ZY2A 5AV8A 3UTBA 3AZFC 4H9SC 3AZLD 1P3OA 2L5AA 3O62A 2AROC 3AZNB 3UT9D 1S32C 5AV5A 5BO0A 1P3LD 3MGSB 2CV5C 1T3UA 2Y2NA 3X1UB 4X23C 5GSUD 1H3OA 3AZEA 3B0CT 3WKJD 3LJAD 3KUYC 5GT3A 3H0MC 1M18A 1P3AC 3AZKD 5B2JA 3KFUG 2G5HC 2NZDC 4WU9B 3AV2A 1M1AD 2J8PA 5DNMB 3AZGD 1M19C 4JJND 3W99A 3AV1D 4UPKA 4KUDA 3REKB 5AVCD 3KWQD 5DNNC 5B2IC 4H9PB 3REJD 5AVBA 4J8VD 2FFFB 3TU4D 3REHA 4Z5TD 3MVDB 1P34D 4KGCD 3AZFA 5B24C 5F99B 2HIOB 4H9SA 2F2AC 3LZ0C 4H9OB 3W98C 5CPKC 3AZJC 3MNND 4E45A 5B1MB 2AROA 1Z2CB 5C3IB 1KX4D 4WU8C 3MGQC 1S32A 4KHAA 5BNVB 4J8UC 5B33C 3C1CB 2Y2MA 4DQYB 3W96C 1EQZC 3B0DC 3W97B 1P3KC 4X23A 5E5AC 3AZIB 3B6GB 4R8PD 3KUYA 1P3IA 3WTPA 1P3AA 2CV5D 2NZDA 4XUJB 5AV6B 3X1VB 1B67A 1B6WA 3AN2B 4WJ3C 3RELA 3MGPC 3LELB 4QLCB 1M19A 2JCHA 5B32C 1P3GD 1KX3C 2RVQD 4NE5A 5DNNA 5B2IA 1BH9A 4WU9D 5JRGB 4Z66C 5CPIC 1P3FB 1HTAA 3X1TB 1AOIA 1U35B 1JFIA 3AZLC 2F8NK 5B31C 5CP6B 4EO5B 5KDMA 3A6NB 3NQUA 3UT9C 5CPKA 3W98A 2YFWB 4XZQB 1A7WA 4UUZA 2ZM5A 5GT0A 4NFTA 1TZYC 3MVDD 4WU8A 4WNNB 3MGQA 3WAAB 5GXQB 5B24D 4J8XB 2IO5C 3LZ0D 5B33A 3AZJD 4YS3B 3LJAC 3W96A 1KX5A 1EQZA 3EPHA 3NQJA 4LD9B 5B1MD 4ZBJB 3C1BD 3AZKC 5E5AA 5CPJA 4G91C 1P3BD 2ZY3A 4J8UD 1M1AC 3C1CD 5AV8B 3W97D 3AZGC 1P3KD 2PYOB 1P3OB 3MGPA 4JJNC 2F8NA 3AV1C 1P3PA 1ID3C 3O62B 5AVCC 3REJC 4J8VC 5B32A 5B0YD 3TU4C 4Z5TC 4XUJD 5AV6D 1ZLAB 2BYMA 1HQ3B 3X1VD 5AV5B 5BO0B 3WTPE 3KXBB 5CPIA 4KGCC 3AFAD 3AZLA 3LELD 2Y2HA 1KX3D 3AZEB 1H3OB 2JSSA 3MNNC 2UWXA 4H9NB 1KX4C 5B40B 4Z66D 1P3MC 1WWIA 2HUEB 1F66C 5B0ZB 1P3FD 5B31D 3X1TD 1P3LA 1N1JA 4CAYA 4DRAA 5BS7C 5GSUA 3WKJA 3LJAA 4R8PC 2Y2PA 4HGAC 4XZQD 1TZYD 4G92B 3AZKA 4CSRA
chains in the Genus database with same CATH topology
2ZY4A 3LZ1A 4J8XD 3X1UC 1M1AA 3B6FD 3AZGA 4JJNA 3AV1A 3AZMD 1P3GC 2NQBD 5AVCA 2RVQC 3KWQA 1BH8A 5AY8D 4J8VA 3REJA 3TU4A 4WU9C 4Z5TA 1S32B 4ZUXB 4KHAB 1P34A 2PYOD 1ID3D 2RIQA 4KGCA 3MVDC 1P3IB 3WTPB 1KX4A 1ZLAD 1HQ3D 2NZDB 3KXBD 5F99C 2VQRA 4NE3A 3RELB 1R4VA 2BYKA 5B1MC 1KU5A 3C1BC 1P3MD 1M19B 5C3IC 5B40D 1F66D 4E44A 4R8PA 5B0ZD 1P3BC 5DNNB 1BH9B 1F1EA 4WZSB 4YM6B 4AWLB 2CV5A 3C1CC 3W97C 3UTAB 1AOIB 1JFIB 3AZND 4H9QA 5AV9B 1TAFA 2CWEA 4J8WB 5FUGB 3NQUB 2BG1A 5B0YC 4WV4B 3MGSD 1P3GA 4XUJC 3R45B 5AV6C 4UUZB 3H0LC 5GT0B 3X1SB 3X1UD 3X1VC 4WU8B 1ULYA 3AN2C 4WU9A 3AFAC 3WA9B 3LELC 4QLCC 3W96B 1KX5B 1EQZB 5JA4B 5E5AB 3MGRB 5CPJB 5JRGC 5DNMD 3VH6W 1P3FC 4ZUXD 3MVDA 3X1TC 1WWSA 4H9RA 5B24A 3AYWB 3REKD 4EO5C 3VH5W 3LZ0A 3AZJA 4H9OA 1P3PB 3P5JB 4XZQC 3C1BA 2FJ7B 5F99D 3AZHB 2HIOD 1P3BA 4J8XC 4J8UA 2YFVA 4YS3C 3C1CA 5CPIB 3B6FC 1P3KA 3AZLB 3AZMC 2F8NG 2NQBC 3REIB 5AY8C 5B1LB 5B0YA 5B32G 4YM6D 4XUJA 5AV6A 3UTBB 3X1VA 3UTAD 2PYOC 3B0BA 1P3LB 3AZID 1N1JB 5G49A 1P3OC 3AFAA 3B6GD 4CAYB 2IO5B 5AV9D 1KX3A 4J8WD 5GSUB 3WKJB 3LJAB 1ZLAC 3AN2D 4Z66A 1HQ3C 3X1SD 5BNXA 5AV5C 3KXBC 4M6BA 1P3FA 5B31A 4G91B 3X1TA 3WA9D 3LZ1B 4QLCD 3V9RA 1M1AB 5GT3B 1M18B 3AZGB 5B2JB 3UT9A 5B40C 4Z2MH 5JRGD 4Z2MG 3AV1B 3MGRD 2ZY5A 4XZQA 1TZYA 1BH8B 5B0ZC 3KWQB 3AV2B 1U35D 4J8VB 4NE6A 5CP6D 3AYWD 3A6ND 1P34B 3AZNC 3W99B 4KUDB 3B6FA 5CHLB 5AVBB 3AZMA 3REHB 3MGSC 2NQBA 5GXQD 3WAAD 2FJ7D 3EPKA 5AY8A 3AZHD 4YS3D 3AZFB 4LD9D 2PYOA 1ID3A 2AROB 2Y2QA 2BYKB 2LY8A 3REID 5B1LD 4R8PB 4HGAB 5DNMC 5AV8D 3UTBD 4ZUXC 1ZLAA 1HQ3A 1P3OD 3VH6T 2CV5B 3O62D 2Y2IA 3KXBA 3REKC 4X23B 3MNNA 3VH5T 3KUYB 4H9QB 5BT1D 1TAFB 3EPLA 3EPJA 1P3AB 4H9NA 1P3MA 2Y2KA 5AV5D 5B40A 3WTPC 1P3IC 1F66A 1P3GB 5B0ZA 2HIOC 3LZ1D 3RELC 3AZED 3KSYA 5BS7A 5GT3D 1M18D 2XD5A 3AZNA 5B2JD 5B2IB 3IP4C 3AV2D 3MGSA 4YM6C 4AWLC 3X1UA 3UTAC 1AOIC 4H9RB 3AZIC 3B6GC 3W99D 5KDMB 5B24B 4KUDD 5AV9C 3A1KA 3LZ0B 3W98B 5CPKB 5AVBD 4J8WC 3AZJB 3REHD 3AL0C 3C1BB 3MGQB 5GT0C 3X1SC 5DNMA 3AZFD 4ZUXA 1P3BB 3WA9C 4J8UB 5B33B 2YFVB 3B0DB 3NQJB 3REKA 2W8SA 1KX5C 2AROD 1PZRA 4H9PA 1P3KB 3VH6A 1S32D 3MGRC 5CPJC 1U35C 2DF4C 3VH5A 5B0YB 5CP6C 5F99A 3AYWC 2HIOA 3A6NC 2Y2GA 3B0CW 3MGPB 4X23D 2F8NB 5G49B 2Y2LA 5B1MA 2DQNC 3AFAB 3KUYD 1P3PC 1P3ID 3WTPD 1P3AD 5B32B 3WAAC 2JE5A 1KX3B 5GXQC 2NZDD 2FJ7C 2BYMB 3AZHC 4Z66B 5BNVA 3RELD 5BNXB 3H0RC 3W97A 4YM6A 4LD9C 5B31B 3UTAA 4ZBJC 1M19D 2F8NH 3AZIA 3V9RB 3B6GA 2XD1A 5AV9A 5DNND 5B2ID 3UT9B 3REIC 4J8WA 5FUGA 5B1LC 5AV8C 3UTBC 3R45A 1AOID 1TZYB 3AN2A 3X1SA 3F6TA 1P3LC 3O62C 2G5IC 3WA9A 3LELA 5B31G 4QLCA 3W98D 5CPKD 5GSUC 5BT1C 3B6FB 3WKJC 3AZKB 4CSRB 1W2EA 5GT0D 5JA4A 5JRGA 4WU8D 3MGQD 3AZMB 2NQBB 3MGRA 1U35A 5AY8B 3LZ1C 5B33D 5CP6A 3AZEC 3AYWA 3W96D 1KX5D 5GT3C 3A6NA 1M18C 1EQZD 4JJNB 5B2JC 5E5AD 1ID3B 2HUEC 2YFWA 5AVCB 5CPJD 3REJB 3KWQC 3FDDA 4WNNA 3TU4B 3AV2C 3WAAA 4Z5TB 5GXQA 2FJ7A 4J8XA 3AZHA 1Q9CA 1P34C 4YS3A 4DRBA 3W99C 3MGPD 1P3PD 2F8ND 3A1IA 4KGCB 4KUDC 4LD9A 4G92C 5AVBC 3MNNB 5B32D 2Y2JA 2Y2OA 3REHC 1KX4B 1P3MB 3REIA 1BFMA 3EG5B 5B1LA 1F66B 5CPID 2ZY2A 5AV8A 3UTBA 3AZFC 4H9SC 3AZLD 1P3OA 2L5AA 3O62A 2AROC 3AZNB 3UT9D 1S32C 5AV5A 5BO0A 1P3LD 3MGSB 2CV5C 1T3UA 2Y2NA 3X1UB 4X23C 5GSUD 1H3OA 3AZEA 3B0CT 3WKJD 3LJAD 3KUYC 5GT3A 3H0MC 1M18A 1P3AC 3AZKD 5B2JA 3KFUG 2G5HC 2NZDC 4WU9B 3AV2A 1M1AD 2J8PA 5DNMB 3AZGD 1M19C 4JJND 3W99A 3AV1D 4UPKA 4KUDA 3REKB 5AVCD 3KWQD 5DNNC 5B2IC 4H9PB 3REJD 5AVBA 4J8VD 2FFFB 3TU4D 3REHA 4Z5TD 3MVDB 1P34D 4KGCD 3AZFA 5B24C 5F99B 2HIOB 4H9SA 2F2AC 3LZ0C 4H9OB 3W98C 5CPKC 3AZJC 3MNND 4E45A 5B1MB 2AROA 1Z2CB 5C3IB 1KX4D 4WU8C 3MGQC 1S32A 4KHAA 5BNVB 4J8UC 5B33C 3C1CB 2Y2MA 4DQYB 3W96C 1EQZC 3B0DC 3W97B 1P3KC 4X23A 5E5AC 3AZIB 3B6GB 4R8PD 3KUYA 1P3IA 3WTPA 1P3AA 2CV5D 2NZDA 4XUJB 5AV6B 3X1VB 1B67A 1B6WA 3AN2B 4WJ3C 3RELA 3MGPC 3LELB 4QLCB 1M19A 2JCHA 5B32C 1P3GD 1KX3C 2RVQD 4NE5A 5DNNA 5B2IA 1BH9A 4WU9D 5JRGB 4Z66C 5CPIC 1P3FB 1HTAA 3X1TB 1AOIA 1U35B 1JFIA 3AZLC 2F8NK 5B31C 5CP6B 4EO5B 5KDMA 3A6NB 3NQUA 3UT9C 5CPKA 3W98A 2YFWB 4XZQB 1A7WA 4UUZA 2ZM5A 5GT0A 4NFTA 1TZYC 3MVDD 4WU8A 4WNNB 3MGQA 3WAAB 5GXQB 5B24D 4J8XB 2IO5C 3LZ0D 5B33A 3AZJD 4YS3B 3LJAC 3W96A 1KX5A 1EQZA 3EPHA 3NQJA 4LD9B 5B1MD 4ZBJB 3C1BD 3AZKC 5E5AA 5CPJA 4G91C 1P3BD 2ZY3A 4J8UD 1M1AC 3C1CD 5AV8B 3W97D 3AZGC 1P3KD 2PYOB 1P3OB 3MGPA 4JJNC 2F8NA 3AV1C 1P3PA 1ID3C 3O62B 5AVCC 3REJC 4J8VC 5B32A 5B0YD 3TU4C 4Z5TC 4XUJD 5AV6D 1ZLAB 2BYMA 1HQ3B 3X1VD 5AV5B 5BO0B 3WTPE 3KXBB 5CPIA 4KGCC 3AFAD 3AZLA 3LELD 2Y2HA 1KX3D 3AZEB 1H3OB 2JSSA 3MNNC 2UWXA 4H9NB 1KX4C 5B40B 4Z66D 1P3MC 1WWIA 2HUEB 1F66C 5B0ZB 1P3FD 5B31D 3X1TD 1P3LA 1N1JA 4CAYA 4DRAA 5BS7C 5GSUA 3WKJA 3LJAA 4R8PC 2Y2PA 4HGAC 4XZQD 1TZYD 4G92B 3AZKA 4CSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ1 A;  4J8X D;  3X1U C;  1M1A A;  3B6F D;  3AZG A;  4JJN A;  3AV1 A;  3AZM D;  1P3G C;  2NQB D;  5AVC A;  2RVQ C;  3KWQ A;  1BH8 A;  5AY8 D;  4J8V A;  3REJ A;  3TU4 A;  4WU9 C;  4Z5T A;  1S32 B;  4ZUX B;  4KHA B;  1P34 A;  2PYO D;  1ID3 D;  4KGC A;  3MVD C;  1P3I B;  3WTP B;  1KX4 A;  1ZLA D;  1HQ3 D;  2NZD B;  3KXB D;  5F99 C;  4NE3 A;  3REL B;  1R4V A;  2BYK A;  5B1M C;  1KU5 A;  3C1B C;  1P3M D;  1M19 B;  5C3I C;  5B40 D;  1F66 D;  4E44 A;  4R8P A;  5B0Z D;  1P3B C;  5DNN B;  1BH9 B;  1F1E A;  4WZS B;  4YM6 B;  4AWL B;  2CV5 A;  3C1C C;  3W97 C;  3UTA B;  1AOI B;  1JFI B;  3AZN D;  4H9Q A;  5AV9 B;  1TAF A;  2CWE A;  4J8W B;  5FUG B;  3NQU B;  5B0Y C;  4WV4 B;  3MGS D;  1P3G A;  4XUJ C;  3R45 B;  5AV6 C;  4UUZ B;  3X1V C;  5GT0 B;  3X1S B;  3X1U D;  4WU8 B;  1ULY A;  3AN2 C;  4WU9 A;  3AFA C;  3WA9 B;  3LEL C;  4QLC C;  3W96 B;  1KX5 B;  1EQZ B;  5JA4 B;  5E5A B;  3MGR B;  5CPJ B;  5JRG C;  5DNM D;  3VH6 W;  1P3F C;  4ZUX D;  3MVD A;  3X1T C;  1WWS A;  4H9R A;  5B24 A;  3AYW B;  3REK D;  4EO5 C;  3VH5 W;  3LZ0 A;  3AZJ A;  4H9O A;  1P3P B;  4XZQ C;  3C1B A;  2FJ7 B;  5F99 D;  3AZH B;  2HIO D;  1P3B A;  4J8X C;  4J8U A;  2YFV A;  4YS3 C;  3C1C A;  5CPI B;  3B6F C;  1P3K A;  3AZL B;  3AZM C;  2F8N G;  2NQB C;  3REI B;  5AY8 C;  5B1L B;  5B0Y A;  5B32 G;  4YM6 D;  4XUJ A;  5AV6 A;  3UTB B;  3X1V A;  3UTA D;  2PYO C;  3B0B A;  1P3L B;  3AZI D;  1N1J B;  5G49 A;  1P3O C;  3AFA A;  3B6G D;  4CAY B;  2IO5 B;  5AV9 D;  1KX3 A;  4J8W D;  5GSU B;  3WKJ B;  3LJA B;  1ZLA C;  3AN2 D;  4Z66 A;  1HQ3 C;  3X1S D;  5BNX A;  5AV5 C;  3KXB C;  4M6B A;  1P3F A;  5B31 A;  4G91 B;  3X1T A;  3WA9 D;  3LZ1 B;  4QLC D;  3V9R A;  1M1A B;  5GT3 B;  1M18 B;  3AZG B;  5B2J B;  3UT9 A;  5B40 C;  4Z2M H;  5JRG D;  4Z2M G;  3AV1 B;  3MGR D;  4XZQ A;  1TZY A;  1BH8 B;  5B0Z C;  3KWQ B;  3AV2 B;  1U35 D;  4J8V B;  4NE6 A;  5CP6 D;  3AYW D;  3A6N D;  1P34 B;  3AZN C;  3W99 B;  4KUD B;  3B6F A;  5CHL B;  5AVB B;  3AZM A;  3REH B;  3MGS C;  2NQB A;  5GXQ D;  3WAA D;  2FJ7 D;  5AY8 A;  3AZH D;  4YS3 D;  3AZF B;  4LD9 D;  2PYO A;  1ID3 A;  2ARO B;  2BYK B;  2LY8 A;  3REI D;  5B1L D;  4R8P B;  4HGA B;  5DNM C;  5AV8 D;  3UTB D;  4ZUX C;  1ZLA A;  1HQ3 A;  1P3O D;  3VH6 T;  2CV5 B;  3O62 D;  3KXB A;  3REK C;  4X23 B;  3MNN A;  3VH5 T;  3KUY B;  4H9Q B;  5BT1 D;  1TAF B;  1P3A B;  4H9N A;  1P3M A;  5AV5 D;  5B40 A;  3WTP C;  1P3I C;  1F66 A;  1P3G B;  5B0Z A;  2HIO C;  3LZ1 D;  3REL C;  3AZE D;  3KSY A;  5BS7 A;  5GT3 D;  1M18 D;  3AZN A;  5B2J D;  5B2I B;  3AV2 D;  3MGS A;  4YM6 C;  4AWL C;  3X1U A;  3UTA C;  1AOI C;  4H9R B;  3AZI C;  3B6G C;  3W99 D;  5KDM B;  5B24 B;  4KUD D;  5AV9 C;  3LZ0 B;  3W98 B;  5CPK B;  5AVB D;  4J8W C;  3AZJ B;  3REH D;  3C1B B;  3MGQ B;  5GT0 C;  3X1S C;  5DNM A;  3AZF D;  4ZUX A;  1P3B B;  3WA9 C;  4J8U B;  5B33 B;  2YFV B;  3B0D B;  3NQJ B;  3REK A;  1KX5 C;  2ARO D;  1P3K B;  4H9P A;  3VH6 A;  1S32 D;  3MGR C;  5CPJ C;  1U35 C;  3VH5 A;  5B0Y B;  5CP6 C;  5F99 A;  3AYW C;  2HIO A;  3A6N C;  3B0C W;  3MGP B;  4X23 D;  2F8N B;  5G49 B;  3AFA B;  5B1M A;  3KUY D;  1P3P C;  1P3I D;  3WTP D;  1P3A D;  5B32 B;  3WAA C;  1KX3 B;  5GXQ C;  2NZD D;  2FJ7 C;  2BYM B;  3AZH C;  4Z66 B;  5BNV A;  3REL D;  5BNX B;  4YM6 A;  3W97 A;  4LD9 C;  5B31 B;  3UTA A;  4ZBJ C;  1M19 D;  2F8N H;  3AZI A;  3V9R B;  3B6G A;  5AV9 A;  5DNN D;  5B2I D;  3UT9 B;  3REI C;  4J8W A;  5FUG A;  5B1L C;  5AV8 C;  3UTB C;  3R45 A;  1AOI D;  1TZY B;  3AN2 A;  3X1S A;  1P3L C;  3O62 C;  3WA9 A;  3LEL A;  5B31 G;  4QLC A;  3W98 D;  5CPK D;  5GSU C;  5BT1 C;  3B6F B;  3WKJ C;  3AZK B;  4CSR B;  5GT0 D;  5JA4 A;  5JRG A;  4WU8 D;  3MGQ D;  3AZM B;  2NQB B;  3MGR A;  1U35 A;  5AY8 B;  3LZ1 C;  5B33 D;  5CP6 A;  3AZE C;  3AYW A;  3W96 D;  1KX5 D;  5GT3 C;  3A6N A;  1M18 C;  1EQZ D;  4JJN B;  5B2J C;  5E5A D;  1ID3 B;  2HUE C;  2YFW A;  5AVC B;  5CPJ D;  3REJ B;  3KWQ C;  3TU4 B;  4WNN A;  3AV2 C;  3WAA A;  4Z5T B;  5GXQ A;  2FJ7 A;  4J8X A;  3AZH A;  1Q9C A;  1P34 C;  4YS3 A;  4DRB A;  3W99 C;  3MGP D;  1P3P D;  2F8N D;  4KGC B;  4KUD C;  4LD9 A;  4G92 C;  5AVB C;  3MNN B;  5B32 D;  3REH C;  1KX4 B;  1P3M B;  3REI A;  1BFM A;  5B1L A;  1F66 B;  5CPI D;  5AV8 A;  3UTB A;  3AZF C;  4H9S C;  3AZL D;  1P3O A;  2L5A A;  3O62 A;  2ARO C;  3AZN B;  3UT9 D;  1S32 C;  5AV5 A;  5BO0 A;  1P3L D;  3MGS B;  2CV5 C;  3X1U B;  4X23 C;  5GSU D;  1H3O A;  3AZE A;  3B0C T;  3WKJ D;  3LJA D;  3KUY C;  5GT3 A;  1M18 A;  1P3A C;  3AZK D;  5B2J A;  2NZD C;  4WU9 B;  3AV2 A;  1M1A D;  5DNM B;  3AZG D;  1M19 C;  4JJN D;  3W99 A;  3AV1 D;  4KUD A;  3REK B;  5AVC D;  3KWQ D;  5DNN C;  5B2I C;  4H9P B;  3REJ D;  5AVB A;  4J8V D;  3TU4 D;  3REH A;  4Z5T D;  3MVD B;  1P34 D;  4KGC D;  3AZF A;  5B24 C;  5F99 B;  2HIO B;  4H9S A;  3LZ0 C;  4H9O B;  3W98 C;  5CPK C;  3AZJ C;  3MNN D;  4E45 A;  5B1M B;  2ARO A;  5C3I B;  1KX4 D;  4WU8 C;  3MGQ C;  1S32 A;  4KHA A;  5BNV B;  4J8U C;  5B33 C;  3C1C B;  3W97 B;  3W96 C;  1EQZ C;  3B0D C;  1P3K C;  4X23 A;  5E5A C;  3AZI B;  3B6G B;  4R8P D;  3KUY A;  1P3I A;  3WTP A;  1P3A A;  2CV5 D;  2NZD A;  4XUJ B;  5AV6 B;  3X1V B;  1B67 A;  1B6W A;  3AN2 B;  3REL A;  3MGP C;  3LEL B;  4QLC B;  1M19 A;  5B32 C;  1P3G D;  1KX3 C;  2RVQ D;  4NE5 A;  5DNN A;  5B2I A;  1BH9 A;  4WU9 D;  5JRG B;  4Z66 C;  5CPI C;  1P3F B;  1HTA A;  3X1T B;  1AOI A;  1U35 B;  1JFI A;  3AZL C;  2F8N K;  5B31 C;  5CP6 B;  4EO5 B;  5KDM A;  3A6N B;  3NQU A;  3UT9 C;  5CPK A;  3W98 A;  2YFW B;  4XZQ B;  1A7W A;  4UUZ A;  4NFT A;  5GT0 A;  1TZY C;  3MVD D;  4WU8 A;  4WNN B;  3MGQ A;  3WAA B;  5GXQ B;  5B24 D;  4J8X B;  2IO5 C;  3LZ0 D;  5B33 A;  3AZJ D;  4YS3 B;  3LJA C;  3W96 A;  1KX5 A;  1EQZ A;  3NQJ A;  4LD9 B;  5B1M D;  4ZBJ B;  3C1B D;  3AZK C;  5E5A A;  5CPJ A;  4G91 C;  1P3B D;  4J8U D;  1M1A C;  3C1C D;  5AV8 B;  3W97 D;  3AZG C;  1P3K D;  2PYO B;  1P3O B;  3MGP A;  4JJN C;  2F8N A;  3AV1 C;  1P3P A;  1ID3 C;  3O62 B;  5AVC C;  3REJ C;  4J8V C;  5B32 A;  5B0Y D;  3TU4 C;  4Z5T C;  4XUJ D;  5AV6 D;  1ZLA B;  2BYM A;  1HQ3 B;  3X1V D;  5AV5 B;  5BO0 B;  3WTP E;  3KXB B;  5CPI A;  4KGC C;  3AFA D;  3AZL A;  3LEL D;  1KX3 D;  3AZE B;  1H3O B;  2JSS A;  3MNN C;  4H9N B;  1KX4 C;  5B40 B;  4Z66 D;  1P3M C;  1WWI A;  2HUE B;  1F66 C;  5B0Z B;  1P3F D;  5B31 D;  3X1T D;  1P3L A;  1N1J A;  4CAY A;  4DRA A;  5BS7 C;  5GSU A;  3WKJ A;  3LJA A;  4R8P C;  4HGA C;  4XZQ D;  1TZY D;  4G92 B;  3AZK A;  4CSR A; 
#chains in the Genus database with same CATH topology
 2ZY4 A;  3LZ1 A;  4J8X D;  3X1U C;  1M1A A;  3B6F D;  3AZG A;  4JJN A;  3AV1 A;  3AZM D;  1P3G C;  2NQB D;  5AVC A;  2RVQ C;  3KWQ A;  1BH8 A;  5AY8 D;  4J8V A;  3REJ A;  3TU4 A;  4WU9 C;  4Z5T A;  1S32 B;  4ZUX B;  4KHA B;  1P34 A;  2PYO D;  1ID3 D;  2RIQ A;  4KGC A;  3MVD C;  1P3I B;  3WTP B;  1KX4 A;  1ZLA D;  1HQ3 D;  2NZD B;  3KXB D;  5F99 C;  2VQR A;  4NE3 A;  3REL B;  1R4V A;  2BYK A;  5B1M C;  1KU5 A;  3C1B C;  1P3M D;  1M19 B;  5C3I C;  5B40 D;  1F66 D;  4E44 A;  4R8P A;  5B0Z D;  1P3B C;  5DNN B;  1BH9 B;  1F1E A;  4WZS B;  4YM6 B;  4AWL B;  2CV5 A;  3C1C C;  3W97 C;  3UTA B;  1AOI B;  1JFI B;  3AZN D;  4H9Q A;  5AV9 B;  1TAF A;  2CWE A;  4J8W B;  5FUG B;  3NQU B;  2BG1 A;  5B0Y C;  4WV4 B;  3MGS D;  1P3G A;  4XUJ C;  3R45 B;  5AV6 C;  4UUZ B;  3H0L C;  5GT0 B;  3X1S B;  3X1U D;  3X1V C;  4WU8 B;  1ULY A;  3AN2 C;  4WU9 A;  3AFA C;  3WA9 B;  3LEL C;  4QLC C;  3W96 B;  1KX5 B;  1EQZ B;  5JA4 B;  5E5A B;  3MGR B;  5CPJ B;  5JRG C;  5DNM D;  3VH6 W;  1P3F C;  4ZUX D;  3MVD A;  3X1T C;  1WWS A;  4H9R A;  5B24 A;  3AYW B;  3REK D;  4EO5 C;  3VH5 W;  3LZ0 A;  3AZJ A;  4H9O A;  1P3P B;  3P5J B;  4XZQ C;  3C1B A;  2FJ7 B;  5F99 D;  3AZH B;  2HIO D;  1P3B A;  4J8X C;  4J8U A;  2YFV A;  4YS3 C;  3C1C A;  5CPI B;  3B6F C;  1P3K A;  3AZL B;  3AZM C;  2F8N G;  2NQB C;  3REI B;  5AY8 C;  5B1L B;  5B0Y A;  5B32 G;  4YM6 D;  4XUJ A;  5AV6 A;  3UTB B;  3X1V A;  3UTA D;  2PYO C;  3B0B A;  1P3L B;  3AZI D;  1N1J B;  5G49 A;  1P3O C;  3AFA A;  3B6G D;  4CAY B;  2IO5 B;  5AV9 D;  1KX3 A;  4J8W D;  5GSU B;  3WKJ B;  3LJA B;  1ZLA C;  3AN2 D;  4Z66 A;  1HQ3 C;  3X1S D;  5BNX A;  5AV5 C;  3KXB C;  4M6B A;  1P3F A;  5B31 A;  4G91 B;  3X1T A;  3WA9 D;  3LZ1 B;  4QLC D;  3V9R A;  1M1A B;  5GT3 B;  1M18 B;  3AZG B;  5B2J B;  3UT9 A;  5B40 C;  4Z2M H;  5JRG D;  4Z2M G;  3AV1 B;  3MGR D;  2ZY5 A;  4XZQ A;  1TZY A;  1BH8 B;  5B0Z C;  3KWQ B;  3AV2 B;  1U35 D;  4J8V B;  4NE6 A;  5CP6 D;  3AYW D;  3A6N D;  1P34 B;  3AZN C;  3W99 B;  4KUD B;  3B6F A;  5CHL B;  5AVB B;  3AZM A;  3REH B;  3MGS C;  2NQB A;  5GXQ D;  3WAA D;  2FJ7 D;  3EPK A;  5AY8 A;  3AZH D;  4YS3 D;  3AZF B;  4LD9 D;  2PYO A;  1ID3 A;  2ARO B;  2Y2Q A;  2BYK B;  2LY8 A;  3REI D;  5B1L D;  4R8P B;  4HGA B;  5DNM C;  5AV8 D;  3UTB D;  4ZUX C;  1ZLA A;  1HQ3 A;  1P3O D;  3VH6 T;  2CV5 B;  3O62 D;  2Y2I A;  3KXB A;  3REK C;  4X23 B;  3MNN A;  3VH5 T;  3KUY B;  4H9Q B;  5BT1 D;  1TAF B;  3EPL A;  3EPJ A;  1P3A B;  4H9N A;  1P3M A;  2Y2K A;  5AV5 D;  5B40 A;  3WTP C;  1P3I C;  1F66 A;  1P3G B;  5B0Z A;  2HIO C;  3LZ1 D;  3REL C;  3AZE D;  3KSY A;  5BS7 A;  5GT3 D;  1M18 D;  2XD5 A;  3AZN A;  5B2J D;  5B2I B;  3IP4 C;  3AV2 D;  3MGS A;  4YM6 C;  4AWL C;  3X1U A;  3UTA C;  1AOI C;  4H9R B;  3AZI C;  3B6G C;  3W99 D;  5KDM B;  5B24 B;  4KUD D;  5AV9 C;  3A1K A;  3LZ0 B;  3W98 B;  5CPK B;  5AVB D;  4J8W C;  3AZJ B;  3REH D;  3AL0 C;  3C1B B;  3MGQ B;  5GT0 C;  3X1S C;  5DNM A;  3AZF D;  4ZUX A;  1P3B B;  3WA9 C;  4J8U B;  5B33 B;  2YFV B;  3B0D B;  3NQJ B;  3REK A;  2W8S A;  1KX5 C;  2ARO D;  1PZR A;  4H9P A;  1P3K B;  3VH6 A;  1S32 D;  3MGR C;  5CPJ C;  1U35 C;  2DF4 C;  3VH5 A;  5B0Y B;  5CP6 C;  5F99 A;  3AYW C;  2HIO A;  3A6N C;  2Y2G A;  3B0C W;  3MGP B;  4X23 D;  2F8N B;  5G49 B;  2Y2L A;  5B1M A;  2DQN C;  3AFA B;  3KUY D;  1P3P C;  1P3I D;  3WTP D;  1P3A D;  5B32 B;  3WAA C;  2JE5 A;  1KX3 B;  5GXQ C;  2NZD D;  2FJ7 C;  2BYM B;  3AZH C;  4Z66 B;  5BNV A;  3REL D;  5BNX B;  3H0R C;  3W97 A;  4YM6 A;  4LD9 C;  5B31 B;  3UTA A;  4ZBJ C;  1M19 D;  2F8N H;  3AZI A;  3V9R B;  3B6G A;  2XD1 A;  5AV9 A;  5DNN D;  5B2I D;  3UT9 B;  3REI C;  4J8W A;  5FUG A;  5B1L C;  5AV8 C;  3UTB C;  3R45 A;  1AOI D;  1TZY B;  3AN2 A;  3X1S A;  3F6T A;  1P3L C;  3O62 C;  2G5I C;  3WA9 A;  3LEL A;  5B31 G;  4QLC A;  3W98 D;  5CPK D;  5GSU C;  5BT1 C;  3B6F B;  3WKJ C;  3AZK B;  4CSR B;  1W2E A;  5GT0 D;  5JA4 A;  5JRG A;  4WU8 D;  3MGQ D;  3AZM B;  2NQB B;  3MGR A;  1U35 A;  5AY8 B;  3LZ1 C;  5B33 D;  5CP6 A;  3AZE C;  3AYW A;  3W96 D;  1KX5 D;  5GT3 C;  3A6N A;  1M18 C;  1EQZ D;  4JJN B;  5B2J C;  5E5A D;  1ID3 B;  2HUE C;  2YFW A;  5AVC B;  5CPJ D;  3REJ B;  3KWQ C;  3FDD A;  4WNN A;  3TU4 B;  3AV2 C;  3WAA A;  4Z5T B;  5GXQ A;  2FJ7 A;  4J8X A;  3AZH A;  1Q9C A;  1P34 C;  4YS3 A;  4DRB A;  3W99 C;  3MGP D;  1P3P D;  2F8N D;  3A1I A;  4KGC B;  4KUD C;  4LD9 A;  4G92 C;  5AVB C;  3MNN B;  5B32 D;  2Y2J A;  2Y2O A;  3REH C;  1KX4 B;  1P3M B;  3REI A;  1BFM A;  3EG5 B;  5B1L A;  1F66 B;  5CPI D;  2ZY2 A;  5AV8 A;  3UTB A;  3AZF C;  4H9S C;  3AZL D;  1P3O A;  2L5A A;  3O62 A;  2ARO C;  3AZN B;  3UT9 D;  1S32 C;  5AV5 A;  5BO0 A;  1P3L D;  3MGS B;  2CV5 C;  1T3U A;  2Y2N A;  3X1U B;  4X23 C;  5GSU D;  1H3O A;  3AZE A;  3B0C T;  3WKJ D;  3LJA D;  3KUY C;  5GT3 A;  3H0M C;  1M18 A;  1P3A C;  3AZK D;  5B2J A;  3KFU G;  2G5H C;  2NZD C;  4WU9 B;  3AV2 A;  1M1A D;  2J8P A;  5DNM B;  3AZG D;  1M19 C;  4JJN D;  3W99 A;  3AV1 D;  4UPK A;  4KUD A;  3REK B;  5AVC D;  3KWQ D;  5DNN C;  5B2I C;  4H9P B;  3REJ D;  5AVB A;  4J8V D;  2FFF B;  3TU4 D;  3REH A;  4Z5T D;  3MVD B;  1P34 D;  4KGC D;  3AZF A;  5B24 C;  5F99 B;  2HIO B;  4H9S A;  2F2A C;  3LZ0 C;  4H9O B;  3W98 C;  5CPK C;  3AZJ C;  3MNN D;  4E45 A;  5B1M B;  2ARO A;  1Z2C B;  5C3I B;  1KX4 D;  4WU8 C;  3MGQ C;  1S32 A;  4KHA A;  5BNV B;  4J8U C;  5B33 C;  3C1C B;  2Y2M A;  4DQY B;  3W96 C;  1EQZ C;  3B0D C;  3W97 B;  1P3K C;  4X23 A;  5E5A C;  3AZI B;  3B6G B;  4R8P D;  3KUY A;  1P3I A;  3WTP A;  1P3A A;  2CV5 D;  2NZD A;  4XUJ B;  5AV6 B;  3X1V B;  1B67 A;  1B6W A;  3AN2 B;  4WJ3 C;  3REL A;  3MGP C;  3LEL B;  4QLC B;  1M19 A;  2JCH A;  5B32 C;  1P3G D;  1KX3 C;  2RVQ D;  4NE5 A;  5DNN A;  5B2I A;  1BH9 A;  4WU9 D;  5JRG B;  4Z66 C;  5CPI C;  1P3F B;  1HTA A;  3X1T B;  1AOI A;  1U35 B;  1JFI A;  3AZL C;  2F8N K;  5B31 C;  5CP6 B;  4EO5 B;  5KDM A;  3A6N B;  3NQU A;  3UT9 C;  5CPK A;  3W98 A;  2YFW B;  4XZQ B;  1A7W A;  4UUZ A;  2ZM5 A;  5GT0 A;  4NFT A;  1TZY C;  3MVD D;  4WU8 A;  4WNN B;  3MGQ A;  3WAA B;  5GXQ B;  5B24 D;  4J8X B;  2IO5 C;  3LZ0 D;  5B33 A;  3AZJ D;  4YS3 B;  3LJA C;  3W96 A;  1KX5 A;  1EQZ A;  3EPH A;  3NQJ A;  4LD9 B;  5B1M D;  4ZBJ B;  3C1B D;  3AZK C;  5E5A A;  5CPJ A;  4G91 C;  1P3B D;  2ZY3 A;  4J8U D;  1M1A C;  3C1C D;  5AV8 B;  3W97 D;  3AZG C;  1P3K D;  2PYO B;  1P3O B;  3MGP A;  4JJN C;  2F8N A;  3AV1 C;  1P3P A;  1ID3 C;  3O62 B;  5AVC C;  3REJ C;  4J8V C;  5B32 A;  5B0Y D;  3TU4 C;  4Z5T C;  4XUJ D;  5AV6 D;  1ZLA B;  2BYM A;  1HQ3 B;  3X1V D;  5AV5 B;  5BO0 B;  3WTP E;  3KXB B;  5CPI A;  4KGC C;  3AFA D;  3AZL A;  3LEL D;  2Y2H A;  1KX3 D;  3AZE B;  1H3O B;  2JSS A;  3MNN C;  2UWX A;  4H9N B;  1KX4 C;  5B40 B;  4Z66 D;  1P3M C;  1WWI A;  2HUE B;  1F66 C;  5B0Z B;  1P3F D;  5B31 D;  3X1T D;  1P3L A;  1N1J A;  4CAY A;  4DRA A;  5BS7 C;  5GSU A;  3WKJ A;  3LJA A;  4R8P C;  2Y2P A;  4HGA C;  4XZQ D;  1TZY D;  4G92 B;  3AZK A;  4CSR A; 
#chains in the Genus database with same CATH homology
 2ZY4 A;  3LZ1 A;  4J8X D;  3X1U C;  1M1A A;  3B6F D;  3AZG A;  4JJN A;  3AV1 A;  3AZM D;  1P3G C;  2NQB D;  5AVC A;  2RVQ C;  3KWQ A;  1BH8 A;  5AY8 D;  4J8V A;  3REJ A;  3TU4 A;  4WU9 C;  4Z5T A;  1S32 B;  4ZUX B;  4KHA B;  1P34 A;  2PYO D;  1ID3 D;  2RIQ A;  4KGC A;  3MVD C;  1P3I B;  3WTP B;  1KX4 A;  1ZLA D;  1HQ3 D;  2NZD B;  3KXB D;  5F99 C;  2VQR A;  4NE3 A;  3REL B;  1R4V A;  2BYK A;  5B1M C;  1KU5 A;  3C1B C;  1P3M D;  1M19 B;  5C3I C;  5B40 D;  1F66 D;  4E44 A;  4R8P A;  5B0Z D;  1P3B C;  5DNN B;  1BH9 B;  1F1E A;  4WZS B;  4YM6 B;  4AWL B;  2CV5 A;  3C1C C;  3W97 C;  3UTA B;  1AOI B;  1JFI B;  3AZN D;  4H9Q A;  5AV9 B;  1TAF A;  2CWE A;  4J8W B;  5FUG B;  3NQU B;  2BG1 A;  5B0Y C;  4WV4 B;  3MGS D;  1P3G A;  4XUJ C;  3R45 B;  5AV6 C;  4UUZ B;  3H0L C;  5GT0 B;  3X1S B;  3X1U D;  3X1V C;  4WU8 B;  1ULY A;  3AN2 C;  4WU9 A;  3AFA C;  3WA9 B;  3LEL C;  4QLC C;  3W96 B;  1KX5 B;  1EQZ B;  5JA4 B;  5E5A B;  3MGR B;  5CPJ B;  5JRG C;  5DNM D;  3VH6 W;  1P3F C;  4ZUX D;  3MVD A;  3X1T C;  1WWS A;  4H9R A;  5B24 A;  3AYW B;  3REK D;  4EO5 C;  3VH5 W;  3LZ0 A;  3AZJ A;  4H9O A;  1P3P B;  3P5J B;  4XZQ C;  3C1B A;  2FJ7 B;  5F99 D;  3AZH B;  2HIO D;  1P3B A;  4J8X C;  4J8U A;  2YFV A;  4YS3 C;  3C1C A;  5CPI B;  3B6F C;  1P3K A;  3AZL B;  3AZM C;  2F8N G;  2NQB C;  3REI B;  5AY8 C;  5B1L B;  5B0Y A;  5B32 G;  4YM6 D;  4XUJ A;  5AV6 A;  3UTB B;  3X1V A;  3UTA D;  2PYO C;  3B0B A;  1P3L B;  3AZI D;  1N1J B;  5G49 A;  1P3O C;  3AFA A;  3B6G D;  4CAY B;  2IO5 B;  5AV9 D;  1KX3 A;  4J8W D;  5GSU B;  3WKJ B;  3LJA B;  1ZLA C;  3AN2 D;  4Z66 A;  1HQ3 C;  3X1S D;  5BNX A;  5AV5 C;  3KXB C;  4M6B A;  1P3F A;  5B31 A;  4G91 B;  3X1T A;  3WA9 D;  3LZ1 B;  4QLC D;  3V9R A;  1M1A B;  5GT3 B;  1M18 B;  3AZG B;  5B2J B;  3UT9 A;  5B40 C;  4Z2M H;  5JRG D;  4Z2M G;  3AV1 B;  3MGR D;  2ZY5 A;  4XZQ A;  1TZY A;  1BH8 B;  5B0Z C;  3KWQ B;  3AV2 B;  1U35 D;  4J8V B;  4NE6 A;  5CP6 D;  3AYW D;  3A6N D;  1P34 B;  3AZN C;  3W99 B;  4KUD B;  3B6F A;  5CHL B;  5AVB B;  3AZM A;  3REH B;  3MGS C;  2NQB A;  5GXQ D;  3WAA D;  2FJ7 D;  3EPK A;  5AY8 A;  3AZH D;  4YS3 D;  3AZF B;  4LD9 D;  2PYO A;  1ID3 A;  2ARO B;  2Y2Q A;  2BYK B;  2LY8 A;  3REI D;  5B1L D;  4R8P B;  4HGA B;  5DNM C;  5AV8 D;  3UTB D;  4ZUX C;  1ZLA A;  1HQ3 A;  1P3O D;  3VH6 T;  2CV5 B;  3O62 D;  2Y2I A;  3KXB A;  3REK C;  4X23 B;  3MNN A;  3VH5 T;  3KUY B;  4H9Q B;  5BT1 D;  1TAF B;  3EPL A;  3EPJ A;  1P3A B;  4H9N A;  1P3M A;  2Y2K A;  5AV5 D;  5B40 A;  3WTP C;  1P3I C;  1F66 A;  1P3G B;  5B0Z A;  2HIO C;  3LZ1 D;  3REL C;  3AZE D;  3KSY A;  5BS7 A;  5GT3 D;  1M18 D;  2XD5 A;  3AZN A;  5B2J D;  5B2I B;  3IP4 C;  3AV2 D;  3MGS A;  4YM6 C;  4AWL C;  3X1U A;  3UTA C;  1AOI C;  4H9R B;  3AZI C;  3B6G C;  3W99 D;  5KDM B;  5B24 B;  4KUD D;  5AV9 C;  3A1K A;  3LZ0 B;  3W98 B;  5CPK B;  5AVB D;  4J8W C;  3AZJ B;  3REH D;  3AL0 C;  3C1B B;  3MGQ B;  5GT0 C;  3X1S C;  5DNM A;  3AZF D;  4ZUX A;  1P3B B;  3WA9 C;  4J8U B;  5B33 B;  2YFV B;  3B0D B;  3NQJ B;  3REK A;  2W8S A;  1KX5 C;  2ARO D;  1PZR A;  4H9P A;  1P3K B;  3VH6 A;  1S32 D;  3MGR C;  5CPJ C;  1U35 C;  2DF4 C;  3VH5 A;  5B0Y B;  5CP6 C;  5F99 A;  3AYW C;  2HIO A;  3A6N C;  2Y2G A;  3B0C W;  3MGP B;  4X23 D;  2F8N B;  5G49 B;  2Y2L A;  5B1M A;  2DQN C;  3AFA B;  3KUY D;  1P3P C;  1P3I D;  3WTP D;  1P3A D;  5B32 B;  3WAA C;  2JE5 A;  1KX3 B;  5GXQ C;  2NZD D;  2FJ7 C;  2BYM B;  3AZH C;  4Z66 B;  5BNV A;  3REL D;  5BNX B;  3H0R C;  3W97 A;  4YM6 A;  4LD9 C;  5B31 B;  3UTA A;  4ZBJ C;  1M19 D;  2F8N H;  3AZI A;  3V9R B;  3B6G A;  2XD1 A;  5AV9 A;  5DNN D;  5B2I D;  3UT9 B;  3REI C;  4J8W A;  5FUG A;  5B1L C;  5AV8 C;  3UTB C;  3R45 A;  1AOI D;  1TZY B;  3AN2 A;  3X1S A;  3F6T A;  1P3L C;  3O62 C;  2G5I C;  3WA9 A;  3LEL A;  5B31 G;  4QLC A;  3W98 D;  5CPK D;  5GSU C;  5BT1 C;  3B6F B;  3WKJ C;  3AZK B;  4CSR B;  1W2E A;  5GT0 D;  5JA4 A;  5JRG A;  4WU8 D;  3MGQ D;  3AZM B;  2NQB B;  3MGR A;  1U35 A;  5AY8 B;  3LZ1 C;  5B33 D;  5CP6 A;  3AZE C;  3AYW A;  3W96 D;  1KX5 D;  5GT3 C;  3A6N A;  1M18 C;  1EQZ D;  4JJN B;  5B2J C;  5E5A D;  1ID3 B;  2HUE C;  2YFW A;  5AVC B;  5CPJ D;  3REJ B;  3KWQ C;  3FDD A;  4WNN A;  3TU4 B;  3AV2 C;  3WAA A;  4Z5T B;  5GXQ A;  2FJ7 A;  4J8X A;  3AZH A;  1Q9C A;  1P34 C;  4YS3 A;  4DRB A;  3W99 C;  3MGP D;  1P3P D;  2F8N D;  3A1I A;  4KGC B;  4KUD C;  4LD9 A;  4G92 C;  5AVB C;  3MNN B;  5B32 D;  2Y2J A;  2Y2O A;  3REH C;  1KX4 B;  1P3M B;  3REI A;  1BFM A;  3EG5 B;  5B1L A;  1F66 B;  5CPI D;  2ZY2 A;  5AV8 A;  3UTB A;  3AZF C;  4H9S C;  3AZL D;  1P3O A;  2L5A A;  3O62 A;  2ARO C;  3AZN B;  3UT9 D;  1S32 C;  5AV5 A;  5BO0 A;  1P3L D;  3MGS B;  2CV5 C;  1T3U A;  2Y2N A;  3X1U B;  4X23 C;  5GSU D;  1H3O A;  3AZE A;  3B0C T;  3WKJ D;  3LJA D;  3KUY C;  5GT3 A;  3H0M C;  1M18 A;  1P3A C;  3AZK D;  5B2J A;  3KFU G;  2G5H C;  2NZD C;  4WU9 B;  3AV2 A;  1M1A D;  2J8P A;  5DNM B;  3AZG D;  1M19 C;  4JJN D;  3W99 A;  3AV1 D;  4UPK A;  4KUD A;  3REK B;  5AVC D;  3KWQ D;  5DNN C;  5B2I C;  4H9P B;  3REJ D;  5AVB A;  4J8V D;  2FFF B;  3TU4 D;  3REH A;  4Z5T D;  3MVD B;  1P34 D;  4KGC D;  3AZF A;  5B24 C;  5F99 B;  2HIO B;  4H9S A;  2F2A C;  3LZ0 C;  4H9O B;  3W98 C;  5CPK C;  3AZJ C;  3MNN D;  4E45 A;  5B1M B;  2ARO A;  1Z2C B;  5C3I B;  1KX4 D;  4WU8 C;  3MGQ C;  1S32 A;  4KHA A;  5BNV B;  4J8U C;  5B33 C;  3C1C B;  2Y2M A;  4DQY B;  3W96 C;  1EQZ C;  3B0D C;  3W97 B;  1P3K C;  4X23 A;  5E5A C;  3AZI B;  3B6G B;  4R8P D;  3KUY A;  1P3I A;  3WTP A;  1P3A A;  2CV5 D;  2NZD A;  4XUJ B;  5AV6 B;  3X1V B;  1B67 A;  1B6W A;  3AN2 B;  4WJ3 C;  3REL A;  3MGP C;  3LEL B;  4QLC B;  1M19 A;  2JCH A;  5B32 C;  1P3G D;  1KX3 C;  2RVQ D;  4NE5 A;  5DNN A;  5B2I A;  1BH9 A;  4WU9 D;  5JRG B;  4Z66 C;  5CPI C;  1P3F B;  1HTA A;  3X1T B;  1AOI A;  1U35 B;  1JFI A;  3AZL C;  2F8N K;  5B31 C;  5CP6 B;  4EO5 B;  5KDM A;  3A6N B;  3NQU A;  3UT9 C;  5CPK A;  3W98 A;  2YFW B;  4XZQ B;  1A7W A;  4UUZ A;  2ZM5 A;  5GT0 A;  4NFT A;  1TZY C;  3MVD D;  4WU8 A;  4WNN B;  3MGQ A;  3WAA B;  5GXQ B;  5B24 D;  4J8X B;  2IO5 C;  3LZ0 D;  5B33 A;  3AZJ D;  4YS3 B;  3LJA C;  3W96 A;  1KX5 A;  1EQZ A;  3EPH A;  3NQJ A;  4LD9 B;  5B1M D;  4ZBJ B;  3C1B D;  3AZK C;  5E5A A;  5CPJ A;  4G91 C;  1P3B D;  2ZY3 A;  4J8U D;  1M1A C;  3C1C D;  5AV8 B;  3W97 D;  3AZG C;  1P3K D;  2PYO B;  1P3O B;  3MGP A;  4JJN C;  2F8N A;  3AV1 C;  1P3P A;  1ID3 C;  3O62 B;  5AVC C;  3REJ C;  4J8V C;  5B32 A;  5B0Y D;  3TU4 C;  4Z5T C;  4XUJ D;  5AV6 D;  1ZLA B;  2BYM A;  1HQ3 B;  3X1V D;  5AV5 B;  5BO0 B;  3WTP E;  3KXB B;  5CPI A;  4KGC C;  3AFA D;  3AZL A;  3LEL D;  2Y2H A;  1KX3 D;  3AZE B;  1H3O B;  2JSS A;  3MNN C;  2UWX A;  4H9N B;  1KX4 C;  5B40 B;  4Z66 D;  1P3M C;  1WWI A;  2HUE B;  1F66 C;  5B0Z B;  1P3F D;  5B31 D;  3X1T D;  1P3L A;  1N1J A;  4CAY A;  4DRA A;  5BS7 C;  5GSU A;  3WKJ A;  3LJA A;  4R8P C;  2Y2P A;  4HGA C;  4XZQ D;  1TZY D;  4G92 B;  3AZK A;  4CSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...