3MGSC

Binding of cesium ions to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsC00
3AYWD 1TZYD 4H9QA 4LD9D 1M1AD 5AV6B 3W96D 3MGQD 3O62D 3AZIB 1WWIA 5AV8D 3VH6A 5B0ZD 3LZ1B 5AY8B 2F8NB 3AZJB 3KSYA 3KWQB 2NQBB 4X23B 5B31G 3AFAB 5KDMA 4J8UD 5F99C 1KX3B 3REHA 3AZFB 3W98C 3W97B 3A6ND 3X1SC 5B0YD 5B33C 4WNNA 1F1EA 1P3BA 1P3BC 3REIA 3UTAB 3LZ0B 1P34A 1M19D 3MGSB 1N1JA 1P3IA 4CAYB 2PYOD 5B2JB 3WA9B 2YFVB 3C1CA 2HIOA 3C1CC 5GT0A 5GT0C 3AZHB 1HQ3D 1A7WA 1M18D 5GSUA 5B24C 3MNND 3VH5T 3AYWB 1S32C 3UTBD 1JFIA 3AV1D 4LD9B 4KUDA 3AV2C 5B2ID 3AZMD 5BNXB 3W99C 3O62B 5B1LA 3B6FD 5AV8B 4ZBJC 3TU4B 5B0ZB 3RELD 3AZED 4YM6B 3MGPB 3R45B 1P3AC 3X1VA 1P3AA 4XZQC 5CPJA 4DRBA 5AV9C 1F66A 5E5AD 4J8UB 4ZUXD 3AZLD 3C1BD 1HTAA 3AZKD 5B1MD 4WU9D 1EQZB 5DNNA 5DNNC 3MVDD 3A6NB 5B0YB 4XUJA 4XUJC 4R8PD 5GT3B 5BNVA 1B6WA 1M19B 1TZYC 5CPIA 1M1AC 3W96C 3MGQC 4H9PB 3KXBD 1BH8A 2LY8A 4E45A 1ZLAD 2PYOB 1AOIA 2BYKB 1AOIC 5B32A 1P3FA 1P3FC 4Z66D 1HQ3B 3V9RA 4WU8D 1KU5A 5CHLB 1P3PA 1P3PC 3MNNB 4AWLB 2CV5A 4JJND 3NQUB 3UTBB 4G92B 3AV1B 2CV5C 3AZGD 3AZMB 4DRAA 3LELB 2F8NH 3UT9D 5AV5A 5AV5C 4YS3C 4YS3A 4H9OA 3RELB 3REJB 3AZID 5GXQB 2FJ7A 2FJ7C 4KGCA 5B32G 3KWQD 5E5AB 2NQBD 3AZLB 4ZUXB 3AN2D 3C1BB 4X23D 3AZKB 2JSSA 1M18C 5G49B 3X1UA 3W97D 3REID 4M6BA 1P34D 3WAAA 3KUYD 5B2IC 3KXBB 3B6FC 1P3ID 5JRGA 5JRGC 4UUZB 4CSRB 1ZLAB 3B0DC 5B31B 3MGSD 4J8WD 3AZEC 3WKJD 5CP6B 4HGAC 1BH9B 5DNMD 1P3GD 2IO5C 4NE6A 4WV4B 4JJNB 4H9QB 4QLCA 5AVCA 3AZGB 4WU9C 1U35A 1U35C 3MVDC 3UT9B 3NQJB 2RVQC 3TU4D 2AROD 4YM6D 3MGPD 1F66D 1P3KA 1P3KC 5KDMB 1KX5C 5BT1D 4J8VC 5AVBD 4J8VA 3AN2B 1P3OD 3REHB 1P3MA 1P3MC 1TAFB 1ID3A 5F99A 1ID3C 4WU8C 5CPKD 1EQZD 3W98A 4J8XD 3REIB 3X1SA 1P34B 5B33A 2BYMA 3KUYB 5GT3D 1N1JB 3X1TD 1P3IB 5AV6A 5AV6C 4J8WB 3WKJB 2HIOB 3AZIC 3LZ1A 3LZ1C 5DNMB 1P3GB 5AY8A 5AY8C 2F8NA 3AZJA 5GSUB 3AZJC 2YFWA 3KWQC 2NQBC 3VH5W 4KUDB 2NZDD 4X23C 5B24A 1S32A 3AFAA 5B1LB 3AFAC 3WTPD 1B67A 3AV2A 1KX3C 3W99A 5FUGA 3AZFA 3AZFC 2BYMB 3LELD 3X1VB 1KX4D 3W97C 5CPJB 2AROB 3REJD 4H9RA 5GXQD 4XZQA 4KHAB 1F66B 3UTAA 3UTAC 3LZ0A 3LZ0C 1P3LD 4NE3A 5AV9A 1P3OB 5AVBB 3MGSC 3AZND 3B6GD 4CAYA 2F8NG 5B2JA 5B2JC 3LJAD 5BO0A 3WA9C 5B40D 4XUJB 1H3OB 3X1UD 3AZHC 1Q9CA 5CPKB 4J8XB 4Z2MH 5CPIB 4Z5TD 3AYWA 3AYWC 3X1TB 3MGRD 1TZYA 4LD9C 4LD9A 1M1AA 3W96A 5B32B 3MGQA 5BNXA 3O62A 3O62C 3REKD 5AV8C 3TU4C 5B0ZA 5B0ZC 3V9RB 5B31D 4YM6C 3R45A 3MGPC 5CP6D 4QLCD 5BT1C 2NZDB 3VH6T 3WTPB 4J8UA 4J8UC 4H9OB 5C3IB 1KX4B 2HUEB 3A6NA 3A6NC 5B0YA 5B0YC 2FJ7B 4KGCB 5GT3C 1M19A 1M19C 1P3LB 3B0CT 5JA4B 3AZNB 3B6GB 2PYOA 2PYOC 1WWSA 3LJAB 5B40B 3REHD 3X1UB 1HQ3C 1M18A 3WAAB 1P3BD 4Z5TB 3MNNC 4AWLC 3UTBA 3MGRB 3UTBC 3AV1C 4G92C 3AV1A 5B2IA 4EO5B 3AZMC 3REKB 2L5AA 3B6FA 3LELC 3VH5A 4G91B 3RELC 3AZEA 4H9NB 3C1CD 2HIOD 5GT0D 4QLCB 5AVCB 5GSUD 5E5AA 5E5AC 3AZLA 4ZUXA 4ZUXC 3AZLC 4KUDD 3C1BA 3C1BC 3AZKA 3AZKC 5B1MA 5B1MC 5B1LD 4WU9A 3MVDA 2CWEA 4R8PA 4R8PC 1P3AD 3X1VD 4XZQD 5CPJD 4H9SA 4H9SC 1R4VA 3KXBC 3KXBA 1ZLAC 4UUZA 1KX5A 5F99B 5B31C 4Z66A 4Z66C 3W98B 5CP6C 5DNND 3X1SB 4WU8A 5B33B 4WNNB 4XUJD 1P3BB 4JJNA 4JJNC 5CPID 3AZGA 3AZGC 3UT9A 3UT9C 1AOID 3NQJA 5B32D 1P3FD 3C1CB 3AZIA 5GT0B 1BFMA 2YFWB 3WTPE 4Z2MG 1P3PD 5B24B 1S32B 1JFIB 2CV5D 3KWQA 2NQBA 3AN2A 3AN2C 3AV2B 4X23A 3W99B 5FUGB 3REHC 4ZBJB 1TAFA 5AV5D 4YS3D 1KX3A 4H9RB 1P3AB 4XZQB 3W97A 3REIC 1P34C 4NE5A 5AV9B 2FJ7D 3KUYA 3KUYC 4KGCD 1P3IC 3MGSA 5BO0B 4J8WA 4J8WC 3WKJA 3WKJC 2HIOC 5DNNB 5DNMA 5DNMC 2YFVA 1P3GC 1P3GA 3WA9A 3AZHA 5BNVB 5GSUC 1ULYA 1TZYB 4WZSB 1M1AB 3WAAD 3W96B 4KUDC 3MGQB 1BH8B 5B1LC 5JRGD 1AOIB 1P3FB 5AV8A 3X1VC 3TU4A 5CPJC 2AROA 2AROC 4YM6A 3MGPA 1P3PB 4KHAA 1F66C 2CV5B 4E44A 3VH6W 5AVBA 5AVBC 5AVCD 1P3OC 1P3OA 1U35D 5AV5B 4YS3B 1H3OA 5CPKA 5CPKC 1EQZA 1EQZC 2RVQD 4J8XA 4J8XC 5CPIC 5GT3A 3X1TA 3X1TC 1P3KD 3B0CW 1KX5D 4J8VD 5B32C 4H9PA 1P3MD 1M18B 2BYKA 3B0BA 1ID3D 5F99D 3W98D 1HQ3A 3X1SD 5B33D 2NZDA 2NZDC 5B2IB 3MNNA 3B6FB 4NFTA 3NQUA 3WTPA 5JRGB 3WTPC 3B0DB 5AV6D 3AZEB 3AZMA 5C3IC 1KX4A 1KX4C 3LELA 2HUEC 4HGAB 3LZ1D 3RELA 3REJA 2IO5B 5AY8D 3REJC 2F8ND 5GXQA 5GXQC 4KGCC 3AZJD 1P3LA 1P3LC 5JA4A 5B24D 5B1MB 3AFAD 3AZNA 3AZNC 1S32D 4WU9B 3B6GA 3B6GC 1U35B 3MVDB 2F8NK 3LJAA 3LJAC 3AV2D 5B40A 5B40C 1KX3D 3W99D 3AZFD 4R8PB 3X1UC 5G49A 3WAAC 4Z5TA 4Z5TC 3MGRA 3MGRC 3UTAD 3LZ0D 1P3KB 1KX5B 5AV9D 4J8VB 4EO5C 3REKA 4Z66B 3REKC 1P3MB 1ZLAA 5BS7A 4CSRA 5BS7C 5B2JD 4G91C 1ID3B 5B31A 3WA9D 4WU8B 4H9NA 3AZHD 5CP6A 1BH9A 4QLCC 5AVCC
chains in the Genus database with same CATH superfamily
2Y2PA 3AYWD 1TZYD 4H9QA 2Y2JA 4LD9D 1M1AD 5AV6B 3W96D 3MGQD 3O62D 3AZIB 1WWIA 5AV8D 3VH6A 5B0ZD 3LZ1B 5AY8B 2ZY3A 2F8NB 3AZJB 3H0MC 3KSYA 3KWQB 2NQBB 4X23B 5B31G 3AFAB 5KDMA 4J8UD 5F99C 1KX3B 3REHA 3AZFB 3W98C 3W97B 3A6ND 3X1SC 5B0YD 5B33C 4WNNA 1F1EA 1P3BA 1P3BC 3REIA 3UTAB 3LZ0B 1P34A 1M19D 3MGSB 1N1JA 1P3IA 4CAYB 2PYOD 5B2JB 3WA9B 2YFVB 3C1CA 2HIOA 3C1CC 5GT0A 5GT0C 3AZHB 1HQ3D 1A7WA 1M18D 5GSUA 5B24C 3MNND 3VH5T 3AYWB 1S32C 3UTBD 1JFIA 3AV1D 4LD9B 4KUDA 3AV2C 5B2ID 3AZMD 5BNXB 3W99C 3O62B 5B1LA 3B6FD 5AV8B 4ZBJC 3TU4B 5B0ZB 3RELD 3AZED 4YM6B 3MGPB 3R45B 2J8PA 3X1VA 1P3AC 4XZQC 1P3AA 5CPJA 4DRBA 5AV9C 1F66A 5E5AD 4J8UB 4ZUXD 3AZLD 2Y2OA 3C1BD 1HTAA 2ZM5A 3AZKD 5B1MD 4WU9D 1EQZB 5DNNA 5DNNC 3MVDD 4DQYB 3A6NB 5B0YB 4XUJA 4XUJC 4R8PD 2Y2NA 5GT3B 5BNVA 1B6WA 1M19B 1TZYC 5CPIA 1M1AC 3W96C 3MGQC 4H9PB 3KXBD 1BH8A 2LY8A 4E45A 1ZLAD 2PYOB 1AOIA 2BYKB 1AOIC 5B32A 1P3FA 1P3FC 4Z66D 1HQ3B 3V9RA 4WU8D 1KU5A 5CHLB 3EPLA 1P3PA 1P3PC 3MNNB 4AWLB 2CV5A 4JJND 3NQUB 3UTBB 4G92B 3AV1B 2CV5C 3AZGD 3AZMB 4DRAA 3LELB 2F8NH 3UT9D 5AV5A 5AV5C 4YS3C 4YS3A 4H9OA 3RELB 3REJB 3AZID 5GXQB 3A1KA 4UPKA 2Y2QA 2FJ7A 2FJ7C 4KGCA 5B32G 3KWQD 5E5AB 2NQBD 3AZLB 4ZUXB 3AN2D 3C1BB 4X23D 3AZKB 2JSSA 1M18C 5G49B 3X1UA 3W97D 3AL0C 2XD1A 4M6BA 3REID 1P34D 3WAAA 3KUYD 5B2IC 3KXBB 3B6FC 1P3ID 5JRGA 5JRGC 4UUZB 4CSRB 1ZLAB 3B0DC 5B31B 3MGSD 4J8WD 3AZEC 3WKJD 5CP6B 4HGAC 1BH9B 5DNMD 1P3GD 2IO5C 4NE6A 2JE5A 4WV4B 4JJNB 1T3UA 4H9QB 4QLCA 5AVCA 3AZGB 2JCHA 4WU9C 1U35A 1U35C 2G5IC 3IP4C 3MVDC 3NQJB 3UT9B 2RVQC 3TU4D 2AROD 4YM6D 3MGPD 1F66D 1P3KA 1P3KC 5KDMB 1KX5C 5BT1D 4J8VC 5AVBD 4J8VA 3AN2B 1P3OD 3REHB 1P3MA 1P3MC 1TAFB 1ID3A 5F99A 1ID3C 4WU8C 5CPKD 1EQZD 3W98A 4J8XD 3REIB 2Y2KA 3X1SA 1P34B 5B33A 2BYMA 3H0RC 3KUYB 5GT3D 1N1JB 3X1TD 1P3IB 5AV6A 5AV6C 4J8WB 3WKJB 2HIOB 3AZIC 3LZ1A 3LZ1C 5DNMB 1P3GB 5AY8A 5AY8C 2F8NA 3AZJA 5GSUB 3AZJC 2YFWA 3KWQC 2NQBC 3VH5W 4KUDB 2NZDD 4X23C 5B24A 1S32A 3AFAA 5B1LB 3AFAC 3WTPD 1B67A 3AV2A 1KX3C 3W99A 5FUGA 3AZFA 3AZFC 1KX4D 3LELD 3X1VB 3W97C 5CPJB 2AROB 3REJD 4H9RA 5GXQD 4XZQA 4KHAB 1F66B 3UTAA 3UTAC 3LZ0A 3LZ0C 1P3LD 4NE3A 5AV9A 1P3OB 5AVBB 3MGSC 3AZND 3B6GD 4CAYA 2F8NG 5B2JA 5B2JC 3LJAD 5BO0A 3WA9C 5B40D 4XUJB 1H3OB 3X1UD 3AZHC 1Q9CA 5CPKB 4J8XB 4Z2MH 5CPIB 4Z5TD 2BG1A 3AYWA 3AYWC 3X1TB 3MGRD 1TZYA 4LD9C 4LD9A 1M1AA 3W96A 5B32B 3MGQA 5BNXA 3O62A 3O62C 3REKD 5AV8C 3TU4C 5B0ZA 5B0ZC 3V9RB 5B31D 4YM6C 3R45A 3MGPC 2XD5A 5CP6D 4QLCD 5BT1C 2NZDB 3VH6T 2RIQA 3WTPB 4J8UA 4J8UC 4H9OB 5C3IB 1KX4B 2HUEB 3A6NA 3A6NC 5B0YA 5B0YC 2FJ7B 4KGCB 5GT3C 1M19A 1M19C 1P3LB 3B0CT 5JA4B 3AZNB 3B6GB 2PYOA 2PYOC 2Y2LA 3P5JB 1WWSA 3LJAB 5B40B 3A1IA 2Y2GA 3REHD 3X1UB 1HQ3C 1M18A 3EPJA 3WAAB 1P3BD 4Z5TB 3MNNC 4AWLC 3UTBA 3MGRB 3UTBC 5AVCC 4G92C 3AV1C 3AV1A 5B2IA 4EO5B 3AZMC 3REKB 2L5AA 3B6FA 3LELC 3VH5A 4G91B 3RELC 3AZEA 4H9NB 3C1CD 2HIOD 5GT0D 1Z2CB 2DQNC 2ZY5A 4QLCB 5AVCB 5GSUD 5E5AA 5E5AC 3AZLA 4ZUXA 4ZUXC 3AZLC 4KUDD 3C1BA 3C1BC 3AZKA 3AZKC 5B1MA 5B1MC 5B1LD 4WU9A 3MVDA 2CWEA 4R8PA 4R8PC 1P3AD 3X1VD 4XZQD 5CPJD 4H9SA 4H9SC 1R4VA 3KXBC 3KXBA 2UWXA 1ZLAC 4UUZA 1KX5A 5F99B 5B31C 3F6TA 4Z66A 4Z66C 3W98B 5CP6C 5DNND 3X1SB 4WU8A 5B33B 4WNNB 4XUJD 1P3BB 4JJNA 4JJNC 5CPID 3AZGA 3AZGC 2Y2MA 2FFFB 3UT9A 3UT9C 1AOID 3NQJA 5B32D 1P3FD 3C1CB 3AZIA 5GT0B 1BFMA 2YFWB 3WTPE 4Z2MG 1P3PD 2F2AC 5B24B 1S32B 1JFIB 2CV5D 3KWQA 2NQBA 3AN2A 3AN2C 3AV2B 4X23A 3W99B 5FUGB 3REHC 4ZBJB 1TAFA 5AV5D 4YS3D 1KX3A 4H9RB 3KFUG 1P3AB 4XZQB 2DF4C 3W97A 3REIC 1P34C 4NE5A 5AV9B 2FJ7D 3KUYA 3KUYC 4KGCD 1P3IC 3MGSA 5BO0B 4J8WA 4J8WC 3WKJA 3WKJC 2HIOC 5DNNB 2Y2HA 5DNMA 5DNMC 2YFVA 1P3GC 1P3GA 3WA9A 3AZHA 5BNVB 5GSUC 1ULYA 1TZYB 4WZSB 1M1AB 3WAAD 3W96B 4KUDC 3MGQB 1BH8B 5B1LC 5JRGD 1AOIB 1P3FB 5AV8A 3X1VC 3TU4A 5CPJC 2AROA 2AROC 4YM6A 3MGPA 1P3PB 4KHAA 1F66C 2CV5B 4E44A 2Y2IA 3VH6W 5AVBA 5AVBC 5AVCD 1P3OC 1P3OA 4WJ3C 1U35D 5AV5B 4YS3B 2VQRA 1H3OA 5CPKA 5CPKC 1EQZA 1EQZC 2RVQD 4J8XA 4J8XC 5CPIC 5GT3A 3X1TA 3X1TC 1P3KD 1PZRA 3B0CW 1KX5D 4J8VD 5B32C 3H0LC 4H9PA 1P3MD 1M18B 2BYKA 3B0BA 1ID3D 5F99D 3W98D 1HQ3A 3X1SD 5B33D 2NZDA 2NZDC 5B2IB 3MNNA 3B6FB 4NFTA 3NQUA 3WTPA 5JRGB 3WTPC 3B0DB 5AV6D 3AZEB 3AZMA 5C3IC 1KX4A 3FDDA 3LELA 1KX4C 2HUEC 4HGAB 3LZ1D 3RELA 3REJA 2IO5B 5AY8D 3REJC 2F8ND 5GXQA 5GXQC 4KGCC 3AZJD 1P3LA 1P3LC 5JA4A 5B24D 5B1MB 3AFAD 3AZNA 3AZNC 1S32D 4WU9B 3B6GA 3B6GC 1U35B 3MVDB 2F8NK 3EPHA 3LJAA 3LJAC 3AV2D 5B40A 5B40C 1KX3D 3W99D 3AZFD 4R8PB 3X1UC 5G49A 3WAAC 4Z5TA 4Z5TC 3MGRA 3MGRC 3UTAD 3LZ0D 1P3KB 1KX5B 5AV9D 4J8VB 2ZY4A 4EO5C 1W2EA 3EG5B 4Z66B 3EPKA 3REKA 3REKC 2W8SA 1P3MB 1ZLAA 5BS7A 4CSRA 5BS7C 5B2JD 4G91C 1ID3B 5B31A 3WA9D 2G5HC 4WU8B 4H9NA 3AZHD 5CP6A 2ZY2A 1BH9A 4QLCC 2BYMB
chains in the Genus database with same CATH topology
2Y2PA 3AYWD 1TZYD 4H9QA 2Y2JA 4LD9D 1M1AD 5AV6B 3W96D 3MGQD 3O62D 3AZIB 1WWIA 5AV8D 3VH6A 5B0ZD 3LZ1B 5AY8B 2ZY3A 2F8NB 3AZJB 3H0MC 3KSYA 3KWQB 2NQBB 4X23B 5B31G 3AFAB 5KDMA 4J8UD 5F99C 1KX3B 3REHA 3AZFB 3W98C 3W97B 3A6ND 3X1SC 5B0YD 5B33C 4WNNA 1F1EA 1P3BA 1P3BC 3REIA 3UTAB 3LZ0B 1P34A 1M19D 3MGSB 1N1JA 1P3IA 4CAYB 2PYOD 5B2JB 3WA9B 2YFVB 3C1CA 2HIOA 3C1CC 5GT0A 5GT0C 3AZHB 1HQ3D 1A7WA 1M18D 5GSUA 5B24C 3MNND 3VH5T 3AYWB 1S32C 3UTBD 1JFIA 3AV1D 4LD9B 4KUDA 3AV2C 5B2ID 3AZMD 5BNXB 3W99C 3O62B 5B1LA 3B6FD 5AV8B 4ZBJC 3TU4B 5B0ZB 3RELD 3AZED 4YM6B 3MGPB 3R45B 2J8PA 3X1VA 1P3AC 4XZQC 1P3AA 5CPJA 4DRBA 5AV9C 1F66A 5E5AD 4J8UB 4ZUXD 3AZLD 2Y2OA 3C1BD 1HTAA 2ZM5A 3AZKD 5B1MD 4WU9D 1EQZB 5DNNA 5DNNC 3MVDD 4DQYB 3A6NB 5B0YB 4XUJA 4XUJC 4R8PD 2Y2NA 5GT3B 5BNVA 1B6WA 1M19B 1TZYC 5CPIA 1M1AC 3W96C 3MGQC 4H9PB 3KXBD 1BH8A 2LY8A 4E45A 1ZLAD 2PYOB 1AOIA 2BYKB 1AOIC 5B32A 1P3FA 1P3FC 4Z66D 1HQ3B 3V9RA 4WU8D 1KU5A 5CHLB 3EPLA 1P3PA 1P3PC 3MNNB 4AWLB 2CV5A 4JJND 3NQUB 3UTBB 4G92B 3AV1B 2CV5C 3AZGD 3AZMB 4DRAA 3LELB 2F8NH 3UT9D 5AV5A 5AV5C 4YS3C 4YS3A 4H9OA 3RELB 3REJB 3AZID 5GXQB 3A1KA 4UPKA 2Y2QA 2FJ7A 2FJ7C 4KGCA 5B32G 3KWQD 5E5AB 2NQBD 3AZLB 4ZUXB 3AN2D 3C1BB 4X23D 3AZKB 2JSSA 1M18C 5G49B 3X1UA 3W97D 3AL0C 2XD1A 4M6BA 3REID 1P34D 3WAAA 3KUYD 5B2IC 3KXBB 3B6FC 1P3ID 5JRGA 5JRGC 4UUZB 4CSRB 1ZLAB 3B0DC 5B31B 3MGSD 4J8WD 3AZEC 3WKJD 5CP6B 4HGAC 1BH9B 5DNMD 1P3GD 2IO5C 4NE6A 2JE5A 4WV4B 4JJNB 1T3UA 4H9QB 4QLCA 5AVCA 3AZGB 2JCHA 4WU9C 1U35A 1U35C 2G5IC 3IP4C 3MVDC 3NQJB 3UT9B 2RVQC 3TU4D 2AROD 4YM6D 3MGPD 1F66D 1P3KA 1P3KC 5KDMB 1KX5C 5BT1D 4J8VC 5AVBD 4J8VA 3AN2B 1P3OD 3REHB 1P3MA 1P3MC 1TAFB 1ID3A 5F99A 1ID3C 4WU8C 5CPKD 1EQZD 3W98A 4J8XD 3REIB 2Y2KA 3X1SA 1P34B 5B33A 2BYMA 3H0RC 3KUYB 5GT3D 1N1JB 3X1TD 1P3IB 5AV6A 5AV6C 4J8WB 3WKJB 2HIOB 3AZIC 3LZ1A 3LZ1C 5DNMB 1P3GB 5AY8A 5AY8C 2F8NA 3AZJA 5GSUB 3AZJC 2YFWA 3KWQC 2NQBC 3VH5W 4KUDB 2NZDD 4X23C 5B24A 1S32A 3AFAA 5B1LB 3AFAC 3WTPD 1B67A 3AV2A 1KX3C 3W99A 5FUGA 3AZFA 3AZFC 1KX4D 3LELD 3X1VB 3W97C 5CPJB 2AROB 3REJD 4H9RA 5GXQD 4XZQA 4KHAB 1F66B 3UTAA 3UTAC 3LZ0A 3LZ0C 1P3LD 4NE3A 5AV9A 1P3OB 5AVBB 3MGSC 3AZND 3B6GD 4CAYA 2F8NG 5B2JA 5B2JC 3LJAD 5BO0A 3WA9C 5B40D 4XUJB 1H3OB 3X1UD 3AZHC 1Q9CA 5CPKB 4J8XB 4Z2MH 5CPIB 4Z5TD 2BG1A 3AYWA 3AYWC 3X1TB 3MGRD 1TZYA 4LD9C 4LD9A 1M1AA 3W96A 5B32B 3MGQA 5BNXA 3O62A 3O62C 3REKD 5AV8C 3TU4C 5B0ZA 5B0ZC 3V9RB 5B31D 4YM6C 3R45A 3MGPC 2XD5A 5CP6D 4QLCD 5BT1C 2NZDB 3VH6T 2RIQA 3WTPB 4J8UA 4J8UC 4H9OB 5C3IB 1KX4B 2HUEB 3A6NA 3A6NC 5B0YA 5B0YC 2FJ7B 4KGCB 5GT3C 1M19A 1M19C 1P3LB 3B0CT 5JA4B 3AZNB 3B6GB 2PYOA 2PYOC 2Y2LA 3P5JB 1WWSA 3LJAB 5B40B 3A1IA 2Y2GA 3REHD 3X1UB 1HQ3C 1M18A 3EPJA 3WAAB 1P3BD 4Z5TB 3MNNC 4AWLC 3UTBA 3MGRB 3UTBC 5AVCC 4G92C 3AV1C 3AV1A 5B2IA 4EO5B 3AZMC 3REKB 2L5AA 3B6FA 3LELC 3VH5A 4G91B 3RELC 3AZEA 4H9NB 3C1CD 2HIOD 5GT0D 1Z2CB 2DQNC 2ZY5A 4QLCB 5AVCB 5GSUD 5E5AA 5E5AC 3AZLA 4ZUXA 4ZUXC 3AZLC 4KUDD 3C1BA 3C1BC 3AZKA 3AZKC 5B1MA 5B1MC 5B1LD 4WU9A 3MVDA 2CWEA 4R8PA 4R8PC 1P3AD 3X1VD 4XZQD 5CPJD 4H9SA 4H9SC 1R4VA 3KXBC 3KXBA 2UWXA 1ZLAC 4UUZA 1KX5A 5F99B 5B31C 3F6TA 4Z66A 4Z66C 3W98B 5CP6C 5DNND 3X1SB 4WU8A 5B33B 4WNNB 4XUJD 1P3BB 4JJNA 4JJNC 5CPID 3AZGA 3AZGC 2Y2MA 2FFFB 3UT9A 3UT9C 1AOID 3NQJA 5B32D 1P3FD 3C1CB 3AZIA 5GT0B 1BFMA 2YFWB 3WTPE 4Z2MG 1P3PD 2F2AC 5B24B 1S32B 1JFIB 2CV5D 3KWQA 2NQBA 3AN2A 3AN2C 3AV2B 4X23A 3W99B 5FUGB 3REHC 4ZBJB 1TAFA 5AV5D 4YS3D 1KX3A 4H9RB 3KFUG 1P3AB 4XZQB 2DF4C 3W97A 3REIC 1P34C 4NE5A 5AV9B 2FJ7D 3KUYA 3KUYC 4KGCD 1P3IC 3MGSA 5BO0B 4J8WA 4J8WC 3WKJA 3WKJC 2HIOC 5DNNB 2Y2HA 5DNMA 5DNMC 2YFVA 1P3GC 1P3GA 3WA9A 3AZHA 5BNVB 5GSUC 1ULYA 1TZYB 4WZSB 1M1AB 3WAAD 3W96B 4KUDC 3MGQB 1BH8B 5B1LC 5JRGD 1AOIB 1P3FB 5AV8A 3X1VC 3TU4A 5CPJC 2AROA 2AROC 4YM6A 3MGPA 1P3PB 4KHAA 1F66C 2CV5B 4E44A 2Y2IA 3VH6W 5AVBA 5AVBC 5AVCD 1P3OC 1P3OA 4WJ3C 1U35D 5AV5B 4YS3B 2VQRA 1H3OA 5CPKA 5CPKC 1EQZA 1EQZC 2RVQD 4J8XA 4J8XC 5CPIC 5GT3A 3X1TA 3X1TC 1P3KD 1PZRA 3B0CW 1KX5D 4J8VD 5B32C 3H0LC 4H9PA 1P3MD 1M18B 2BYKA 3B0BA 1ID3D 5F99D 3W98D 1HQ3A 3X1SD 5B33D 2NZDA 2NZDC 5B2IB 3MNNA 3B6FB 4NFTA 3NQUA 3WTPA 5JRGB 3WTPC 3B0DB 5AV6D 3AZEB 3AZMA 5C3IC 1KX4A 3FDDA 3LELA 1KX4C 2HUEC 4HGAB 3LZ1D 3RELA 3REJA 2IO5B 5AY8D 3REJC 2F8ND 5GXQA 5GXQC 4KGCC 3AZJD 1P3LA 1P3LC 5JA4A 5B24D 5B1MB 3AFAD 3AZNA 3AZNC 1S32D 4WU9B 3B6GA 3B6GC 1U35B 3MVDB 2F8NK 3EPHA 3LJAA 3LJAC 3AV2D 5B40A 5B40C 1KX3D 3W99D 3AZFD 4R8PB 3X1UC 5G49A 3WAAC 4Z5TA 4Z5TC 3MGRA 3MGRC 3UTAD 3LZ0D 1P3KB 1KX5B 5AV9D 4J8VB 2ZY4A 4EO5C 1W2EA 3EG5B 4Z66B 3EPKA 3REKA 3REKC 2W8SA 1P3MB 1ZLAA 5BS7A 4CSRA 5BS7C 5B2JD 4G91C 1ID3B 5B31A 3WA9D 2G5HC 4WU8B 4H9NA 3AZHD 5CP6A 2ZY2A 1BH9A 4QLCC 2BYMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW D;  1TZY D;  4H9Q A;  4LD9 D;  1M1A D;  5AV6 B;  3W96 D;  3MGQ D;  3O62 D;  3AZI B;  1WWI A;  5AV8 D;  3VH6 A;  5B0Z D;  3LZ1 B;  5AY8 B;  2F8N B;  3AZJ B;  3KSY A;  3KWQ B;  2NQB B;  4X23 B;  5B31 G;  3AFA B;  5KDM A;  4J8U D;  5F99 C;  1KX3 B;  3REH A;  3AZF B;  3W98 C;  3W97 B;  3A6N D;  3X1S C;  5B0Y D;  5B33 C;  4WNN A;  1F1E A;  1P3B A;  1P3B C;  3REI A;  3UTA B;  3LZ0 B;  1P34 A;  1M19 D;  3MGS B;  1N1J A;  1P3I A;  4CAY B;  2PYO D;  5B2J B;  3WA9 B;  2YFV B;  3C1C A;  2HIO A;  3C1C C;  5GT0 A;  5GT0 C;  3AZH B;  1HQ3 D;  1A7W A;  1M18 D;  5GSU A;  5B24 C;  3MNN D;  3VH5 T;  3AYW B;  1S32 C;  3UTB D;  1JFI A;  3AV1 D;  4LD9 B;  4KUD A;  3AV2 C;  5B2I D;  3AZM D;  5BNX B;  3W99 C;  3O62 B;  5B1L A;  3B6F D;  5AV8 B;  4ZBJ C;  3TU4 B;  5B0Z B;  3REL D;  3AZE D;  4YM6 B;  3MGP B;  3R45 B;  1P3A C;  3X1V A;  1P3A A;  4XZQ C;  5CPJ A;  4DRB A;  5AV9 C;  1F66 A;  5E5A D;  4J8U B;  4ZUX D;  3AZL D;  3C1B D;  1HTA A;  3AZK D;  5B1M D;  4WU9 D;  1EQZ B;  5DNN A;  5DNN C;  3MVD D;  3A6N B;  5B0Y B;  4XUJ A;  4XUJ C;  4R8P D;  5GT3 B;  5BNV A;  1B6W A;  1M19 B;  1TZY C;  5CPI A;  1M1A C;  3W96 C;  3MGQ C;  4H9P B;  3KXB D;  1BH8 A;  2LY8 A;  4E45 A;  1ZLA D;  2PYO B;  1AOI A;  2BYK B;  1AOI C;  5B32 A;  1P3F A;  1P3F C;  4Z66 D;  1HQ3 B;  3V9R A;  4WU8 D;  1KU5 A;  5CHL B;  1P3P A;  1P3P C;  3MNN B;  4AWL B;  2CV5 A;  4JJN D;  3NQU B;  3UTB B;  4G92 B;  3AV1 B;  2CV5 C;  3AZG D;  3AZM B;  4DRA A;  3LEL B;  2F8N H;  3UT9 D;  5AV5 A;  5AV5 C;  4YS3 C;  4YS3 A;  4H9O A;  3REL B;  3REJ B;  3AZI D;  5GXQ B;  2FJ7 A;  2FJ7 C;  4KGC A;  5B32 G;  3KWQ D;  5E5A B;  2NQB D;  3AZL B;  4ZUX B;  3AN2 D;  3C1B B;  4X23 D;  3AZK B;  2JSS A;  1M18 C;  5G49 B;  3X1U A;  3W97 D;  3REI D;  4M6B A;  1P34 D;  3WAA A;  3KUY D;  5B2I C;  3KXB B;  3B6F C;  1P3I D;  5JRG A;  5JRG C;  4UUZ B;  4CSR B;  1ZLA B;  3B0D C;  5B31 B;  3MGS D;  4J8W D;  3AZE C;  3WKJ D;  5CP6 B;  4HGA C;  1BH9 B;  5DNM D;  1P3G D;  2IO5 C;  4NE6 A;  4WV4 B;  4JJN B;  4H9Q B;  4QLC A;  5AVC A;  3AZG B;  4WU9 C;  1U35 A;  1U35 C;  3MVD C;  3UT9 B;  3NQJ B;  2RVQ C;  3TU4 D;  2ARO D;  4YM6 D;  3MGP D;  1F66 D;  1P3K A;  1P3K C;  5KDM B;  1KX5 C;  5BT1 D;  4J8V C;  5AVB D;  4J8V A;  3AN2 B;  1P3O D;  3REH B;  1P3M A;  1P3M C;  1TAF B;  1ID3 A;  5F99 A;  1ID3 C;  4WU8 C;  5CPK D;  1EQZ D;  3W98 A;  4J8X D;  3REI B;  3X1S A;  1P34 B;  5B33 A;  2BYM A;  3KUY B;  5GT3 D;  1N1J B;  3X1T D;  1P3I B;  5AV6 A;  5AV6 C;  4J8W B;  3WKJ B;  2HIO B;  3AZI C;  3LZ1 A;  3LZ1 C;  5DNM B;  1P3G B;  5AY8 A;  5AY8 C;  2F8N A;  3AZJ A;  5GSU B;  3AZJ C;  2YFW A;  3KWQ C;  2NQB C;  3VH5 W;  4KUD B;  2NZD D;  4X23 C;  5B24 A;  1S32 A;  3AFA A;  5B1L B;  3AFA C;  3WTP D;  1B67 A;  3AV2 A;  1KX3 C;  3W99 A;  5FUG A;  3AZF A;  3AZF C;  2BYM B;  3LEL D;  3X1V B;  1KX4 D;  3W97 C;  5CPJ B;  2ARO B;  3REJ D;  4H9R A;  5GXQ D;  4XZQ A;  4KHA B;  1F66 B;  3UTA A;  3UTA C;  3LZ0 A;  3LZ0 C;  1P3L D;  4NE3 A;  5AV9 A;  1P3O B;  5AVB B;  3MGS C;  3AZN D;  3B6G D;  4CAY A;  2F8N G;  5B2J A;  5B2J C;  3LJA D;  5BO0 A;  3WA9 C;  5B40 D;  4XUJ B;  1H3O B;  3X1U D;  3AZH C;  1Q9C A;  5CPK B;  4J8X B;  4Z2M H;  5CPI B;  4Z5T D;  3AYW A;  3AYW C;  3X1T B;  3MGR D;  1TZY A;  4LD9 C;  4LD9 A;  1M1A A;  3W96 A;  5B32 B;  3MGQ A;  5BNX A;  3O62 A;  3O62 C;  3REK D;  5AV8 C;  3TU4 C;  5B0Z A;  5B0Z C;  3V9R B;  5B31 D;  4YM6 C;  3R45 A;  3MGP C;  5CP6 D;  4QLC D;  5BT1 C;  2NZD B;  3VH6 T;  3WTP B;  4J8U A;  4J8U C;  4H9O B;  5C3I B;  1KX4 B;  2HUE B;  3A6N A;  3A6N C;  5B0Y A;  5B0Y C;  2FJ7 B;  4KGC B;  5GT3 C;  1M19 A;  1M19 C;  1P3L B;  3B0C T;  5JA4 B;  3AZN B;  3B6G B;  2PYO A;  2PYO C;  1WWS A;  3LJA B;  5B40 B;  3REH D;  3X1U B;  1HQ3 C;  1M18 A;  3WAA B;  1P3B D;  4Z5T B;  3MNN C;  4AWL C;  3UTB A;  3MGR B;  3UTB C;  3AV1 C;  4G92 C;  3AV1 A;  5B2I A;  4EO5 B;  3AZM C;  3REK B;  2L5A A;  3B6F A;  3LEL C;  3VH5 A;  4G91 B;  3REL C;  3AZE A;  4H9N B;  3C1C D;  2HIO D;  5GT0 D;  4QLC B;  5AVC B;  5GSU D;  5E5A A;  5E5A C;  3AZL A;  4ZUX A;  4ZUX C;  3AZL C;  4KUD D;  3C1B A;  3C1B C;  3AZK A;  3AZK C;  5B1M A;  5B1M C;  5B1L D;  4WU9 A;  3MVD A;  2CWE A;  4R8P A;  4R8P C;  1P3A D;  3X1V D;  4XZQ D;  5CPJ D;  4H9S A;  4H9S C;  1R4V A;  3KXB C;  3KXB A;  1ZLA C;  4UUZ A;  1KX5 A;  5F99 B;  5B31 C;  4Z66 A;  4Z66 C;  3W98 B;  5CP6 C;  5DNN D;  3X1S B;  4WU8 A;  5B33 B;  4WNN B;  4XUJ D;  1P3B B;  4JJN A;  4JJN C;  5CPI D;  3AZG A;  3AZG C;  3UT9 A;  3UT9 C;  1AOI D;  3NQJ A;  5B32 D;  1P3F D;  3C1C B;  3AZI A;  5GT0 B;  1BFM A;  2YFW B;  3WTP E;  4Z2M G;  1P3P D;  5B24 B;  1S32 B;  1JFI B;  2CV5 D;  3KWQ A;  2NQB A;  3AN2 A;  3AN2 C;  3AV2 B;  4X23 A;  3W99 B;  5FUG B;  3REH C;  4ZBJ B;  1TAF A;  5AV5 D;  4YS3 D;  1KX3 A;  4H9R B;  1P3A B;  4XZQ B;  3W97 A;  3REI C;  1P34 C;  4NE5 A;  5AV9 B;  2FJ7 D;  3KUY A;  3KUY C;  4KGC D;  1P3I C;  3MGS A;  5BO0 B;  4J8W A;  4J8W C;  3WKJ A;  3WKJ C;  2HIO C;  5DNN B;  5DNM A;  5DNM C;  2YFV A;  1P3G C;  1P3G A;  3WA9 A;  3AZH A;  5BNV B;  5GSU C;  1ULY A;  1TZY B;  4WZS B;  1M1A B;  3WAA D;  3W96 B;  4KUD C;  3MGQ B;  1BH8 B;  5B1L C;  5JRG D;  1AOI B;  1P3F B;  5AV8 A;  3X1V C;  3TU4 A;  5CPJ C;  2ARO A;  2ARO C;  4YM6 A;  3MGP A;  1P3P B;  4KHA A;  1F66 C;  2CV5 B;  4E44 A;  3VH6 W;  5AVB A;  5AVB C;  5AVC D;  1P3O C;  1P3O A;  1U35 D;  5AV5 B;  4YS3 B;  1H3O A;  5CPK A;  5CPK C;  1EQZ A;  1EQZ C;  2RVQ D;  4J8X A;  4J8X C;  5CPI C;  5GT3 A;  3X1T A;  3X1T C;  1P3K D;  3B0C W;  1KX5 D;  4J8V D;  5B32 C;  4H9P A;  1P3M D;  1M18 B;  2BYK A;  3B0B A;  1ID3 D;  5F99 D;  3W98 D;  1HQ3 A;  3X1S D;  5B33 D;  2NZD A;  2NZD C;  5B2I B;  3MNN A;  3B6F B;  4NFT A;  3NQU A;  3WTP A;  5JRG B;  3WTP C;  3B0D B;  5AV6 D;  3AZE B;  3AZM A;  5C3I C;  1KX4 A;  1KX4 C;  3LEL A;  2HUE C;  4HGA B;  3LZ1 D;  3REL A;  3REJ A;  2IO5 B;  5AY8 D;  3REJ C;  2F8N D;  5GXQ A;  5GXQ C;  4KGC C;  3AZJ D;  1P3L A;  1P3L C;  5JA4 A;  5B24 D;  5B1M B;  3AFA D;  3AZN A;  3AZN C;  1S32 D;  4WU9 B;  3B6G A;  3B6G C;  1U35 B;  3MVD B;  2F8N K;  3LJA A;  3LJA C;  3AV2 D;  5B40 A;  5B40 C;  1KX3 D;  3W99 D;  3AZF D;  4R8P B;  3X1U C;  5G49 A;  3WAA C;  4Z5T A;  4Z5T C;  3MGR A;  3MGR C;  3UTA D;  3LZ0 D;  1P3K B;  1KX5 B;  5AV9 D;  4J8V B;  4EO5 C;  3REK A;  4Z66 B;  3REK C;  1P3M B;  1ZLA A;  5BS7 A;  4CSR A;  5BS7 C;  5B2J D;  4G91 C;  1ID3 B;  5B31 A;  3WA9 D;  4WU8 B;  4H9N A;  3AZH D;  5CP6 A;  1BH9 A;  4QLC C;  5AVC C; 
#chains in the Genus database with same CATH topology
 2Y2P A;  3AYW D;  1TZY D;  4H9Q A;  2Y2J A;  4LD9 D;  1M1A D;  5AV6 B;  3W96 D;  3MGQ D;  3O62 D;  3AZI B;  1WWI A;  5AV8 D;  3VH6 A;  5B0Z D;  3LZ1 B;  5AY8 B;  2ZY3 A;  2F8N B;  3AZJ B;  3H0M C;  3KSY A;  3KWQ B;  2NQB B;  4X23 B;  5B31 G;  3AFA B;  5KDM A;  4J8U D;  5F99 C;  1KX3 B;  3REH A;  3AZF B;  3W98 C;  3W97 B;  3A6N D;  3X1S C;  5B0Y D;  5B33 C;  4WNN A;  1F1E A;  1P3B A;  1P3B C;  3REI A;  3UTA B;  3LZ0 B;  1P34 A;  1M19 D;  3MGS B;  1N1J A;  1P3I A;  4CAY B;  2PYO D;  5B2J B;  3WA9 B;  2YFV B;  3C1C A;  2HIO A;  3C1C C;  5GT0 A;  5GT0 C;  3AZH B;  1HQ3 D;  1A7W A;  1M18 D;  5GSU A;  5B24 C;  3MNN D;  3VH5 T;  3AYW B;  1S32 C;  3UTB D;  1JFI A;  3AV1 D;  4LD9 B;  4KUD A;  3AV2 C;  5B2I D;  3AZM D;  5BNX B;  3W99 C;  3O62 B;  5B1L A;  3B6F D;  5AV8 B;  4ZBJ C;  3TU4 B;  5B0Z B;  3REL D;  3AZE D;  4YM6 B;  3MGP B;  3R45 B;  2J8P A;  3X1V A;  1P3A C;  4XZQ C;  1P3A A;  5CPJ A;  4DRB A;  5AV9 C;  1F66 A;  5E5A D;  4J8U B;  4ZUX D;  3AZL D;  2Y2O A;  3C1B D;  1HTA A;  2ZM5 A;  3AZK D;  5B1M D;  4WU9 D;  1EQZ B;  5DNN A;  5DNN C;  3MVD D;  4DQY B;  3A6N B;  5B0Y B;  4XUJ A;  4XUJ C;  4R8P D;  2Y2N A;  5GT3 B;  5BNV A;  1B6W A;  1M19 B;  1TZY C;  5CPI A;  1M1A C;  3W96 C;  3MGQ C;  4H9P B;  3KXB D;  1BH8 A;  2LY8 A;  4E45 A;  1ZLA D;  2PYO B;  1AOI A;  2BYK B;  1AOI C;  5B32 A;  1P3F A;  1P3F C;  4Z66 D;  1HQ3 B;  3V9R A;  4WU8 D;  1KU5 A;  5CHL B;  3EPL A;  1P3P A;  1P3P C;  3MNN B;  4AWL B;  2CV5 A;  4JJN D;  3NQU B;  3UTB B;  4G92 B;  3AV1 B;  2CV5 C;  3AZG D;  3AZM B;  4DRA A;  3LEL B;  2F8N H;  3UT9 D;  5AV5 A;  5AV5 C;  4YS3 C;  4YS3 A;  4H9O A;  3REL B;  3REJ B;  3AZI D;  5GXQ B;  3A1K A;  4UPK A;  2Y2Q A;  2FJ7 A;  2FJ7 C;  4KGC A;  5B32 G;  3KWQ D;  5E5A B;  2NQB D;  3AZL B;  4ZUX B;  3AN2 D;  3C1B B;  4X23 D;  3AZK B;  2JSS A;  1M18 C;  5G49 B;  3X1U A;  3W97 D;  3AL0 C;  2XD1 A;  4M6B A;  3REI D;  1P34 D;  3WAA A;  3KUY D;  5B2I C;  3KXB B;  3B6F C;  1P3I D;  5JRG A;  5JRG C;  4UUZ B;  4CSR B;  1ZLA B;  3B0D C;  5B31 B;  3MGS D;  4J8W D;  3AZE C;  3WKJ D;  5CP6 B;  4HGA C;  1BH9 B;  5DNM D;  1P3G D;  2IO5 C;  4NE6 A;  2JE5 A;  4WV4 B;  4JJN B;  1T3U A;  4H9Q B;  4QLC A;  5AVC A;  3AZG B;  2JCH A;  4WU9 C;  1U35 A;  1U35 C;  2G5I C;  3IP4 C;  3MVD C;  3NQJ B;  3UT9 B;  2RVQ C;  3TU4 D;  2ARO D;  4YM6 D;  3MGP D;  1F66 D;  1P3K A;  1P3K C;  5KDM B;  1KX5 C;  5BT1 D;  4J8V C;  5AVB D;  4J8V A;  3AN2 B;  1P3O D;  3REH B;  1P3M A;  1P3M C;  1TAF B;  1ID3 A;  5F99 A;  1ID3 C;  4WU8 C;  5CPK D;  1EQZ D;  3W98 A;  4J8X D;  3REI B;  2Y2K A;  3X1S A;  1P34 B;  5B33 A;  2BYM A;  3H0R C;  3KUY B;  5GT3 D;  1N1J B;  3X1T D;  1P3I B;  5AV6 A;  5AV6 C;  4J8W B;  3WKJ B;  2HIO B;  3AZI C;  3LZ1 A;  3LZ1 C;  5DNM B;  1P3G B;  5AY8 A;  5AY8 C;  2F8N A;  3AZJ A;  5GSU B;  3AZJ C;  2YFW A;  3KWQ C;  2NQB C;  3VH5 W;  4KUD B;  2NZD D;  4X23 C;  5B24 A;  1S32 A;  3AFA A;  5B1L B;  3AFA C;  3WTP D;  1B67 A;  3AV2 A;  1KX3 C;  3W99 A;  5FUG A;  3AZF A;  3AZF C;  1KX4 D;  3LEL D;  3X1V B;  3W97 C;  5CPJ B;  2ARO B;  3REJ D;  4H9R A;  5GXQ D;  4XZQ A;  4KHA B;  1F66 B;  3UTA A;  3UTA C;  3LZ0 A;  3LZ0 C;  1P3L D;  4NE3 A;  5AV9 A;  1P3O B;  5AVB B;  3MGS C;  3AZN D;  3B6G D;  4CAY A;  2F8N G;  5B2J A;  5B2J C;  3LJA D;  5BO0 A;  3WA9 C;  5B40 D;  4XUJ B;  1H3O B;  3X1U D;  3AZH C;  1Q9C A;  5CPK B;  4J8X B;  4Z2M H;  5CPI B;  4Z5T D;  2BG1 A;  3AYW A;  3AYW C;  3X1T B;  3MGR D;  1TZY A;  4LD9 C;  4LD9 A;  1M1A A;  3W96 A;  5B32 B;  3MGQ A;  5BNX A;  3O62 A;  3O62 C;  3REK D;  5AV8 C;  3TU4 C;  5B0Z A;  5B0Z C;  3V9R B;  5B31 D;  4YM6 C;  3R45 A;  3MGP C;  2XD5 A;  5CP6 D;  4QLC D;  5BT1 C;  2NZD B;  3VH6 T;  2RIQ A;  3WTP B;  4J8U A;  4J8U C;  4H9O B;  5C3I B;  1KX4 B;  2HUE B;  3A6N A;  3A6N C;  5B0Y A;  5B0Y C;  2FJ7 B;  4KGC B;  5GT3 C;  1M19 A;  1M19 C;  1P3L B;  3B0C T;  5JA4 B;  3AZN B;  3B6G B;  2PYO A;  2PYO C;  2Y2L A;  3P5J B;  1WWS A;  3LJA B;  5B40 B;  3A1I A;  2Y2G A;  3REH D;  3X1U B;  1HQ3 C;  1M18 A;  3EPJ A;  3WAA B;  1P3B D;  4Z5T B;  3MNN C;  4AWL C;  3UTB A;  3MGR B;  3UTB C;  5AVC C;  4G92 C;  3AV1 C;  3AV1 A;  5B2I A;  4EO5 B;  3AZM C;  3REK B;  2L5A A;  3B6F A;  3LEL C;  3VH5 A;  4G91 B;  3REL C;  3AZE A;  4H9N B;  3C1C D;  2HIO D;  5GT0 D;  1Z2C B;  2DQN C;  2ZY5 A;  4QLC B;  5AVC B;  5GSU D;  5E5A A;  5E5A C;  3AZL A;  4ZUX A;  4ZUX C;  3AZL C;  4KUD D;  3C1B A;  3C1B C;  3AZK A;  3AZK C;  5B1M A;  5B1M C;  5B1L D;  4WU9 A;  3MVD A;  2CWE A;  4R8P A;  4R8P C;  1P3A D;  3X1V D;  4XZQ D;  5CPJ D;  4H9S A;  4H9S C;  1R4V A;  3KXB C;  3KXB A;  2UWX A;  1ZLA C;  4UUZ A;  1KX5 A;  5F99 B;  5B31 C;  3F6T A;  4Z66 A;  4Z66 C;  3W98 B;  5CP6 C;  5DNN D;  3X1S B;  4WU8 A;  5B33 B;  4WNN B;  4XUJ D;  1P3B B;  4JJN A;  4JJN C;  5CPI D;  3AZG A;  3AZG C;  2Y2M A;  2FFF B;  3UT9 A;  3UT9 C;  1AOI D;  3NQJ A;  5B32 D;  1P3F D;  3C1C B;  3AZI A;  5GT0 B;  1BFM A;  2YFW B;  3WTP E;  4Z2M G;  1P3P D;  2F2A C;  5B24 B;  1S32 B;  1JFI B;  2CV5 D;  3KWQ A;  2NQB A;  3AN2 A;  3AN2 C;  3AV2 B;  4X23 A;  3W99 B;  5FUG B;  3REH C;  4ZBJ B;  1TAF A;  5AV5 D;  4YS3 D;  1KX3 A;  4H9R B;  3KFU G;  1P3A B;  4XZQ B;  2DF4 C;  3W97 A;  3REI C;  1P34 C;  4NE5 A;  5AV9 B;  2FJ7 D;  3KUY A;  3KUY C;  4KGC D;  1P3I C;  3MGS A;  5BO0 B;  4J8W A;  4J8W C;  3WKJ A;  3WKJ C;  2HIO C;  5DNN B;  2Y2H A;  5DNM A;  5DNM C;  2YFV A;  1P3G C;  1P3G A;  3WA9 A;  3AZH A;  5BNV B;  5GSU C;  1ULY A;  1TZY B;  4WZS B;  1M1A B;  3WAA D;  3W96 B;  4KUD C;  3MGQ B;  1BH8 B;  5B1L C;  5JRG D;  1AOI B;  1P3F B;  5AV8 A;  3X1V C;  3TU4 A;  5CPJ C;  2ARO A;  2ARO C;  4YM6 A;  3MGP A;  1P3P B;  4KHA A;  1F66 C;  2CV5 B;  4E44 A;  2Y2I A;  3VH6 W;  5AVB A;  5AVB C;  5AVC D;  1P3O C;  1P3O A;  4WJ3 C;  1U35 D;  5AV5 B;  4YS3 B;  2VQR A;  1H3O A;  5CPK A;  5CPK C;  1EQZ A;  1EQZ C;  2RVQ D;  4J8X A;  4J8X C;  5CPI C;  5GT3 A;  3X1T A;  3X1T C;  1P3K D;  1PZR A;  3B0C W;  1KX5 D;  4J8V D;  5B32 C;  3H0L C;  4H9P A;  1P3M D;  1M18 B;  2BYK A;  3B0B A;  1ID3 D;  5F99 D;  3W98 D;  1HQ3 A;  3X1S D;  5B33 D;  2NZD A;  2NZD C;  5B2I B;  3MNN A;  3B6F B;  4NFT A;  3NQU A;  3WTP A;  5JRG B;  3WTP C;  3B0D B;  5AV6 D;  3AZE B;  3AZM A;  5C3I C;  1KX4 A;  3FDD A;  3LEL A;  1KX4 C;  2HUE C;  4HGA B;  3LZ1 D;  3REL A;  3REJ A;  2IO5 B;  5AY8 D;  3REJ C;  2F8N D;  5GXQ A;  5GXQ C;  4KGC C;  3AZJ D;  1P3L A;  1P3L C;  5JA4 A;  5B24 D;  5B1M B;  3AFA D;  3AZN A;  3AZN C;  1S32 D;  4WU9 B;  3B6G A;  3B6G C;  1U35 B;  3MVD B;  2F8N K;  3EPH A;  3LJA A;  3LJA C;  3AV2 D;  5B40 A;  5B40 C;  1KX3 D;  3W99 D;  3AZF D;  4R8P B;  3X1U C;  5G49 A;  3WAA C;  4Z5T A;  4Z5T C;  3MGR A;  3MGR C;  3UTA D;  3LZ0 D;  1P3K B;  1KX5 B;  5AV9 D;  4J8V B;  2ZY4 A;  4EO5 C;  1W2E A;  3EG5 B;  4Z66 B;  3EPK A;  3REK A;  3REK C;  2W8S A;  1P3M B;  1ZLA A;  5BS7 A;  4CSR A;  5BS7 C;  5B2J D;  4G91 C;  1ID3 B;  5B31 A;  3WA9 D;  2G5H C;  4WU8 B;  4H9N A;  3AZH D;  5CP6 A;  2ZY2 A;  1BH9 A;  4QLC C;  2BYM B; 
#chains in the Genus database with same CATH homology
 2Y2P A;  3AYW D;  1TZY D;  4H9Q A;  2Y2J A;  4LD9 D;  1M1A D;  5AV6 B;  3W96 D;  3MGQ D;  3O62 D;  3AZI B;  1WWI A;  5AV8 D;  3VH6 A;  5B0Z D;  3LZ1 B;  5AY8 B;  2ZY3 A;  2F8N B;  3AZJ B;  3H0M C;  3KSY A;  3KWQ B;  2NQB B;  4X23 B;  5B31 G;  3AFA B;  5KDM A;  4J8U D;  5F99 C;  1KX3 B;  3REH A;  3AZF B;  3W98 C;  3W97 B;  3A6N D;  3X1S C;  5B0Y D;  5B33 C;  4WNN A;  1F1E A;  1P3B A;  1P3B C;  3REI A;  3UTA B;  3LZ0 B;  1P34 A;  1M19 D;  3MGS B;  1N1J A;  1P3I A;  4CAY B;  2PYO D;  5B2J B;  3WA9 B;  2YFV B;  3C1C A;  2HIO A;  3C1C C;  5GT0 A;  5GT0 C;  3AZH B;  1HQ3 D;  1A7W A;  1M18 D;  5GSU A;  5B24 C;  3MNN D;  3VH5 T;  3AYW B;  1S32 C;  3UTB D;  1JFI A;  3AV1 D;  4LD9 B;  4KUD A;  3AV2 C;  5B2I D;  3AZM D;  5BNX B;  3W99 C;  3O62 B;  5B1L A;  3B6F D;  5AV8 B;  4ZBJ C;  3TU4 B;  5B0Z B;  3REL D;  3AZE D;  4YM6 B;  3MGP B;  3R45 B;  2J8P A;  3X1V A;  1P3A C;  4XZQ C;  1P3A A;  5CPJ A;  4DRB A;  5AV9 C;  1F66 A;  5E5A D;  4J8U B;  4ZUX D;  3AZL D;  2Y2O A;  3C1B D;  1HTA A;  2ZM5 A;  3AZK D;  5B1M D;  4WU9 D;  1EQZ B;  5DNN A;  5DNN C;  3MVD D;  4DQY B;  3A6N B;  5B0Y B;  4XUJ A;  4XUJ C;  4R8P D;  2Y2N A;  5GT3 B;  5BNV A;  1B6W A;  1M19 B;  1TZY C;  5CPI A;  1M1A C;  3W96 C;  3MGQ C;  4H9P B;  3KXB D;  1BH8 A;  2LY8 A;  4E45 A;  1ZLA D;  2PYO B;  1AOI A;  2BYK B;  1AOI C;  5B32 A;  1P3F A;  1P3F C;  4Z66 D;  1HQ3 B;  3V9R A;  4WU8 D;  1KU5 A;  5CHL B;  3EPL A;  1P3P A;  1P3P C;  3MNN B;  4AWL B;  2CV5 A;  4JJN D;  3NQU B;  3UTB B;  4G92 B;  3AV1 B;  2CV5 C;  3AZG D;  3AZM B;  4DRA A;  3LEL B;  2F8N H;  3UT9 D;  5AV5 A;  5AV5 C;  4YS3 C;  4YS3 A;  4H9O A;  3REL B;  3REJ B;  3AZI D;  5GXQ B;  3A1K A;  4UPK A;  2Y2Q A;  2FJ7 A;  2FJ7 C;  4KGC A;  5B32 G;  3KWQ D;  5E5A B;  2NQB D;  3AZL B;  4ZUX B;  3AN2 D;  3C1B B;  4X23 D;  3AZK B;  2JSS A;  1M18 C;  5G49 B;  3X1U A;  3W97 D;  3AL0 C;  2XD1 A;  4M6B A;  3REI D;  1P34 D;  3WAA A;  3KUY D;  5B2I C;  3KXB B;  3B6F C;  1P3I D;  5JRG A;  5JRG C;  4UUZ B;  4CSR B;  1ZLA B;  3B0D C;  5B31 B;  3MGS D;  4J8W D;  3AZE C;  3WKJ D;  5CP6 B;  4HGA C;  1BH9 B;  5DNM D;  1P3G D;  2IO5 C;  4NE6 A;  2JE5 A;  4WV4 B;  4JJN B;  1T3U A;  4H9Q B;  4QLC A;  5AVC A;  3AZG B;  2JCH A;  4WU9 C;  1U35 A;  1U35 C;  2G5I C;  3IP4 C;  3MVD C;  3NQJ B;  3UT9 B;  2RVQ C;  3TU4 D;  2ARO D;  4YM6 D;  3MGP D;  1F66 D;  1P3K A;  1P3K C;  5KDM B;  1KX5 C;  5BT1 D;  4J8V C;  5AVB D;  4J8V A;  3AN2 B;  1P3O D;  3REH B;  1P3M A;  1P3M C;  1TAF B;  1ID3 A;  5F99 A;  1ID3 C;  4WU8 C;  5CPK D;  1EQZ D;  3W98 A;  4J8X D;  3REI B;  2Y2K A;  3X1S A;  1P34 B;  5B33 A;  2BYM A;  3H0R C;  3KUY B;  5GT3 D;  1N1J B;  3X1T D;  1P3I B;  5AV6 A;  5AV6 C;  4J8W B;  3WKJ B;  2HIO B;  3AZI C;  3LZ1 A;  3LZ1 C;  5DNM B;  1P3G B;  5AY8 A;  5AY8 C;  2F8N A;  3AZJ A;  5GSU B;  3AZJ C;  2YFW A;  3KWQ C;  2NQB C;  3VH5 W;  4KUD B;  2NZD D;  4X23 C;  5B24 A;  1S32 A;  3AFA A;  5B1L B;  3AFA C;  3WTP D;  1B67 A;  3AV2 A;  1KX3 C;  3W99 A;  5FUG A;  3AZF A;  3AZF C;  1KX4 D;  3LEL D;  3X1V B;  3W97 C;  5CPJ B;  2ARO B;  3REJ D;  4H9R A;  5GXQ D;  4XZQ A;  4KHA B;  1F66 B;  3UTA A;  3UTA C;  3LZ0 A;  3LZ0 C;  1P3L D;  4NE3 A;  5AV9 A;  1P3O B;  5AVB B;  3MGS C;  3AZN D;  3B6G D;  4CAY A;  2F8N G;  5B2J A;  5B2J C;  3LJA D;  5BO0 A;  3WA9 C;  5B40 D;  4XUJ B;  1H3O B;  3X1U D;  3AZH C;  1Q9C A;  5CPK B;  4J8X B;  4Z2M H;  5CPI B;  4Z5T D;  2BG1 A;  3AYW A;  3AYW C;  3X1T B;  3MGR D;  1TZY A;  4LD9 C;  4LD9 A;  1M1A A;  3W96 A;  5B32 B;  3MGQ A;  5BNX A;  3O62 A;  3O62 C;  3REK D;  5AV8 C;  3TU4 C;  5B0Z A;  5B0Z C;  3V9R B;  5B31 D;  4YM6 C;  3R45 A;  3MGP C;  2XD5 A;  5CP6 D;  4QLC D;  5BT1 C;  2NZD B;  3VH6 T;  2RIQ A;  3WTP B;  4J8U A;  4J8U C;  4H9O B;  5C3I B;  1KX4 B;  2HUE B;  3A6N A;  3A6N C;  5B0Y A;  5B0Y C;  2FJ7 B;  4KGC B;  5GT3 C;  1M19 A;  1M19 C;  1P3L B;  3B0C T;  5JA4 B;  3AZN B;  3B6G B;  2PYO A;  2PYO C;  2Y2L A;  3P5J B;  1WWS A;  3LJA B;  5B40 B;  3A1I A;  2Y2G A;  3REH D;  3X1U B;  1HQ3 C;  1M18 A;  3EPJ A;  3WAA B;  1P3B D;  4Z5T B;  3MNN C;  4AWL C;  3UTB A;  3MGR B;  3UTB C;  5AVC C;  4G92 C;  3AV1 C;  3AV1 A;  5B2I A;  4EO5 B;  3AZM C;  3REK B;  2L5A A;  3B6F A;  3LEL C;  3VH5 A;  4G91 B;  3REL C;  3AZE A;  4H9N B;  3C1C D;  2HIO D;  5GT0 D;  1Z2C B;  2DQN C;  2ZY5 A;  4QLC B;  5AVC B;  5GSU D;  5E5A A;  5E5A C;  3AZL A;  4ZUX A;  4ZUX C;  3AZL C;  4KUD D;  3C1B A;  3C1B C;  3AZK A;  3AZK C;  5B1M A;  5B1M C;  5B1L D;  4WU9 A;  3MVD A;  2CWE A;  4R8P A;  4R8P C;  1P3A D;  3X1V D;  4XZQ D;  5CPJ D;  4H9S A;  4H9S C;  1R4V A;  3KXB C;  3KXB A;  2UWX A;  1ZLA C;  4UUZ A;  1KX5 A;  5F99 B;  5B31 C;  3F6T A;  4Z66 A;  4Z66 C;  3W98 B;  5CP6 C;  5DNN D;  3X1S B;  4WU8 A;  5B33 B;  4WNN B;  4XUJ D;  1P3B B;  4JJN A;  4JJN C;  5CPI D;  3AZG A;  3AZG C;  2Y2M A;  2FFF B;  3UT9 A;  3UT9 C;  1AOI D;  3NQJ A;  5B32 D;  1P3F D;  3C1C B;  3AZI A;  5GT0 B;  1BFM A;  2YFW B;  3WTP E;  4Z2M G;  1P3P D;  2F2A C;  5B24 B;  1S32 B;  1JFI B;  2CV5 D;  3KWQ A;  2NQB A;  3AN2 A;  3AN2 C;  3AV2 B;  4X23 A;  3W99 B;  5FUG B;  3REH C;  4ZBJ B;  1TAF A;  5AV5 D;  4YS3 D;  1KX3 A;  4H9R B;  3KFU G;  1P3A B;  4XZQ B;  2DF4 C;  3W97 A;  3REI C;  1P34 C;  4NE5 A;  5AV9 B;  2FJ7 D;  3KUY A;  3KUY C;  4KGC D;  1P3I C;  3MGS A;  5BO0 B;  4J8W A;  4J8W C;  3WKJ A;  3WKJ C;  2HIO C;  5DNN B;  2Y2H A;  5DNM A;  5DNM C;  2YFV A;  1P3G C;  1P3G A;  3WA9 A;  3AZH A;  5BNV B;  5GSU C;  1ULY A;  1TZY B;  4WZS B;  1M1A B;  3WAA D;  3W96 B;  4KUD C;  3MGQ B;  1BH8 B;  5B1L C;  5JRG D;  1AOI B;  1P3F B;  5AV8 A;  3X1V C;  3TU4 A;  5CPJ C;  2ARO A;  2ARO C;  4YM6 A;  3MGP A;  1P3P B;  4KHA A;  1F66 C;  2CV5 B;  4E44 A;  2Y2I A;  3VH6 W;  5AVB A;  5AVB C;  5AVC D;  1P3O C;  1P3O A;  4WJ3 C;  1U35 D;  5AV5 B;  4YS3 B;  2VQR A;  1H3O A;  5CPK A;  5CPK C;  1EQZ A;  1EQZ C;  2RVQ D;  4J8X A;  4J8X C;  5CPI C;  5GT3 A;  3X1T A;  3X1T C;  1P3K D;  1PZR A;  3B0C W;  1KX5 D;  4J8V D;  5B32 C;  3H0L C;  4H9P A;  1P3M D;  1M18 B;  2BYK A;  3B0B A;  1ID3 D;  5F99 D;  3W98 D;  1HQ3 A;  3X1S D;  5B33 D;  2NZD A;  2NZD C;  5B2I B;  3MNN A;  3B6F B;  4NFT A;  3NQU A;  3WTP A;  5JRG B;  3WTP C;  3B0D B;  5AV6 D;  3AZE B;  3AZM A;  5C3I C;  1KX4 A;  3FDD A;  3LEL A;  1KX4 C;  2HUE C;  4HGA B;  3LZ1 D;  3REL A;  3REJ A;  2IO5 B;  5AY8 D;  3REJ C;  2F8N D;  5GXQ A;  5GXQ C;  4KGC C;  3AZJ D;  1P3L A;  1P3L C;  5JA4 A;  5B24 D;  5B1M B;  3AFA D;  3AZN A;  3AZN C;  1S32 D;  4WU9 B;  3B6G A;  3B6G C;  1U35 B;  3MVD B;  2F8N K;  3EPH A;  3LJA A;  3LJA C;  3AV2 D;  5B40 A;  5B40 C;  1KX3 D;  3W99 D;  3AZF D;  4R8P B;  3X1U C;  5G49 A;  3WAA C;  4Z5T A;  4Z5T C;  3MGR A;  3MGR C;  3UTA D;  3LZ0 D;  1P3K B;  1KX5 B;  5AV9 D;  4J8V B;  2ZY4 A;  4EO5 C;  1W2E A;  3EG5 B;  4Z66 B;  3EPK A;  3REK A;  3REK C;  2W8S A;  1P3M B;  1ZLA A;  5BS7 A;  4CSR A;  5BS7 C;  5B2J D;  4G91 C;  1ID3 B;  5B31 A;  3WA9 D;  2G5H C;  4WU8 B;  4H9N A;  3AZH D;  5CP6 A;  2ZY2 A;  1BH9 A;  4QLC C;  2BYM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...