3MGSC

Binding of cesium ions to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsC00
3MNNA 5JRGA 1KU5A 4E44A 3AFAC 3MGRD 5CP6D 4X23B 4DRAA 5DNNA 5CP6A 3A6NC 4H9SC 3C1BB 3AZIC 5AY8A 3KUYC 1KX5D 3B6GA 3REKB 5AV6C 4H9RB 5G49B 3X1SB 5B1MD 4JJNC 1KX4D 3W99B 4KUDB 4H9OB 5B31C 5B40B 3W98A 5AV8B 2HIOD 3C1CB 3AN2C 5B0YD 2HIOA 5JRGB 3MNNB 3UT9A 5CPKD 4ZUXA 4J8XA 4XUJC 3VH5W 4R8PD 5DNNB 5CP6B 1P3PD 4Z66A 3AZHB 3VH5A 5AY8B 5B1LC 3MGSD 3B6GB 1P3MA 4XZQD 3AZKD 4XZQA 4X23C 3AZKA 1P3AC 3W98B 3B0CT 3C1BC 3RELC 3UTBD 2CV5A 5AV5A 3UTBA 3UT9B 4ZUXB 4J8XB 1M1AD 3X1SC 5DNMA 4QLCD 1M1AA 4WZSB 3W99C 1P3ID 4KUDC 3REHA 4QLCA 5B40C 1JFIA 2RVQD 4HGAB 5AV8C 4Z66B 3LELA 1P3OD 3C1CC 3AZND 3MNNC 1P3FA 5JRGC 3AZNA 1P3MB 4UUZA 3AYWA 4XZQB 5DNNC 3AZKB 2IO5B 3AZHC 2CV5B 5AV5B 5AY8C 3LJAD 5B2ID 4CAYA 2NQBD 1U35A 5DNMB 1S32D 1M1AB 1HQ3D 5BT1C 3REHB 4QLCB 1HQ3A 1JFIB 3LELB 3W98C 3KWQD 3AZGD 5B24A 4CSRB 1P3FB 3VH6T 3AZMD 3AZNB 1P34D 4J8XC 1P3KD 1B6WA 5B32D 4UUZB 1P3KA 1M18A 4H9PA 3AYWB 3AFAD 3X1UA 4HGAC 4Z66C 3WAAC 3WTPE 3A6ND 5FUGA 4CAYB 3A6NA 4H9SA 3AZID 1F66A 3KUYD 3AZIA 1U35B 2F8NH 5AV6D 5AVBD 5AV6A 4YM6C 1KX3C 1HQ3B 4JJND 2IO5C 2CV5C 5AV5C 5B31D 2LY8A 5B24B 5F99A 3AN2D 5DNMC 1P3KB 3AN2A 1M18B 4H9PB 4XUJD 3X1UB 3LELC 5BNVA 3R45A 3KXBA 5FUGB 1P3FC 5CPIB 3A6NB 4WNNA 1F66B 5B1LD 5B1LA 3AYWC 5AV6B 4X23D 5AV9C 1P3AD 3B0CW 1P3AA 2CWEA 3C1BD 5F99B 3RELA 4Z2MG 2F8ND 2FJ7A 4J8WA 1U35C 3REKD 2F8NA 3LZ1A 5G49A 3X1SD 5BNVB 3W99D 3X1SA 4KUDD 5B40D 3KXBB 3W99A 5AV8D 4H9OA 5GT0B 3C1CD 4WNNB 5B0ZB 3MNND 3MVDC 5JRGD 1M18C 5B1LB 1EQZC 3X1UC 3MGQA 1P3BC 5DNND 3O62A 1P3AB 5CPIC 3AZHD 5AY8D 1F66C 3RELB 3AZHA 2FJ7B 5JA4B 3B6GD 4J8WB 4KHAA 4WU8C 1Q9CA 2F8NB 3LZ1B 5B33C 3B6FA 3WTPC 5BT1D 3W98D 4AWLC 4LD9C 5F99C 3VH6W 3AV2C 1WWSA 1TZYB 3UT9D 4ZUXD 4J8XD 2F8NK 1BFMA 1ID3B 3VH6A 3MGQB 3KXBC 3O62B 4Z66D 3WAAD 5GT0C 3WAAA 5B0ZC 4ZBJC 3AZEA 5B2JC 4KHAB 3REJC 1P3MD 3B6FB 4YM6D 1KX3D 4YM6A 3TU4A 1KX3A 4H9NB 5AV5D 2CV5D 2FJ7C 4J8WC 3X1TB 4J8VA 3LZ1C 3WKJA 5DNMD 3X1VC 5KDMB 3REHD 3LELD 3WAAB 1P3FD 1TZYC 5GT3A 3AZEB 4YS3B 4CSRA 2YFWA 3AYWD 5AVCB 1ID3C 3MGQC 4J8UB 3O62C 2BYMA 4YM6B 3TU4B 5AV9D 2HUEB 1KX3B 5AV9A 4J8VB 3WKJB 4NE3A 1U35D 3B6FC 2PYOA 1BH8A 5B24D 3X1TC 5GT3B 1AOIB 3AZLC 3W97A 2YFWB 2NZDA 1M18D 5BNXA 3MVDA 3X1UD 1EQZA 2BYMB 1P3BA 5AV9B 3NQUA 4YS3C 3AZEC 5CPID 4DRBA 1F66D 5CPIA 5AVCC 4WU8A 4J8UC 2L5AA 3WTPD 4G91B 5B33A 5B32G 3TU4C 2PYOB 2HUEC 3WTPA 1BH8B 5E5AC 3AZJC 3UTAA 4EO5B 4J8VC 4Z5TA 5F99D 4LD9D 3AV2D 3W97B 3WKJC 4LD9A 2NZDB 1BH9A 5BNXB 3AV2A 3MVDB 3MGPB 1EQZB 3AV1A 3KXBD 5BS7C 1P3BB 5GT3C 5GT0D 3NQUB 1AOIC 1ZLAB 5GT0A 5B0ZD 5B0ZA 3REJD 5B31G 5B2JA 4WU8B 3NQJA 3REJA 5B33B 3WTPB 3UTAB 4E45A 4Z5TB 5BO0A 3REIA 4AWLB 3RELD 2FJ7D 4KGCB 4LD9B 4J8WD 1BH9B 5JA4A 3AV2B 3LZ1D 5GSUB 4G91C 2PYOC 3B0BA 3X1VD 3AV1B 1R4VA 3X1VA 4EO5C 1P3OC 1P3GB 3AZFC 3W97C 1TZYD 2NZDC 1TZYA 4ZBJB 3WA9C 5B2JB 3MGPC 3NQJB 3REJB 1ID3D 3MGQD 1ID3A 1P3LC 3O62D 1A7WA 1ZLAC 5BO0B 3REIB 4M6BA 2AROA 3B6FD 3LZ0A 3W96A 3X1VB 3UTAC 4Z5TC 3AZGC 4H9QA 4KGCC 4H9NA 3X1TD 1ULYA 3X1TA 3AZLD 5GXQA 5GSUC 5B32C 3AZLA 5CPJB 3AV1C 5KDMA 3B0DB 3MGRA 1P3GC 3AZED 4YS3D 4YS3A 2AROB 4WU9C 5AVCD 1KX5A 3LZ0B 5AVCA 5AVBC 4J8UD 3W96B 1M19C 4J8UA 3TU4D 1KX4A 4H9QB 5B1MA 5E5AD 3REIC 3AZJD 5E5AA 4J8VD 3AZJA 4WV4B 5GXQB 3WKJD 3AZLB 5B0YA 5CPKA 3MGRB 4R8PA 5GT3D 5BS7A 5C3IC 1P3PA 1AOID 1AOIA 5CPJC 2YFVA 1KX5B 3MGSA 3B0DC 1KX4B 5B1MB 5E5AB 3AZJB 2AROC 2HIOB 3REKC 3LZ0C 5B0YB 3W96C 5CPKB 2PYOD 3KSYA 4R8PB 1P3IA 1P3PB 3AZFD 3V9RA 5GXQC 1P3OA 3W97D 4NE5A 2YFVB 3AZFA 2NZDD 3MVDD 3WA9D 3MGSB 3MGPD 3WA9A 3MGPA 1EQZD 3MGRC 1P3LD 5CP6C 2JSSA 1P3BD 1P3LA 1ZLAD 1ZLAA 3UTBB 3B6GC 3LJAA 1KX5C 5B2IA 1TAFA 4WU8D 2NQBA 5B33D 1KX4C 5B1MC 1S32A 3UTAD 1P3IB 4Z5TD 1WWIA 3V9RB 1P3OB 4KGCD 3KWQA 3AZGA 3AZFB 2HIOC 4Z2MH 2BYKA 3UT9C 4KGCA 5B0YC 4ZUXC 5GSUD 3AZMA 5CPKC 3WA9B 1P34A 5GSUA 5B32A 3AV1D 4R8PC 3VH5T 1P3LB 1P3PC 3AFAA 1P3GD 1P3GA 3LJAB 5B2JD 5B2IB 1TAFB 3MGSC 1P3MC 4WU9D 3KUYA 2NQBB 4XZQC 4WU9A 4G92B 3AZKC 1S32B 1M19D 5AVBA 1N1JA 1M19A 3REID 4JJNA 3KWQB 3UTBC 3AZGB 5B31A 2BYKB 1B67A 1H3OA 3AZMB 1HTAA 1P34B 5B32B 1M1AC 3REHC 4QLCC 1P3IC 4XUJA 3AFAB 2RVQC 4NFTA 3AZNC 5CPJD 3AZIB 3KUYB 5CPJA 4WU9B 2F8NG 4NE6A 5AVBB 1N1JB 1M19B 4JJNB 4X23A 3LJAC 5B31B 5CHLB 5B2IC 1H3OB 2AROD 3C1BA 2NQBC 3AN2B 3LZ0D 4G92C 3REKA 1S32C 3W96D 4H9RA 1HQ3C 4XUJB 3R45B 3KWQC 5B24C 4KUDA 5B40A 5AV8A 5GXQD 5C3IB 3AZMC 3C1CA 1P34C 1P3KC 1F1EA
chains in the Genus database with same CATH superfamily
3MNNA 5JRGA 1KU5A 4E44A 3AFAC 3MGRD 5CP6D 4X23B 4DRAA 5DNNA 5CP6A 3A6NC 4H9SC 3C1BB 3AZIC 5AY8A 3KUYC 1KX5D 3B6GA 3REKB 5AV6C 4H9RB 5G49B 3X1SB 5B1MD 4JJNC 1KX4D 1W2EA 3H0RC 3W99B 4KUDB 4H9OB 5B31C 5B40B 3W98A 5AV8B 2HIOD 3C1CB 3AN2C 5B0YD 2HIOA 5JRGB 3MNNB 2XD5A 3UT9A 5CPKD 4ZUXA 4J8XA 3H0LC 2Y2HA 2Y2KA 4XUJC 3VH5W 4R8PD 2VQRA 5DNNB 5CP6B 1P3PD 4Z66A 3AZHB 3VH5A 3AL0C 5AY8B 5B1LC 3MGSD 3B6GB 1P3MA 2Y2MA 4XZQD 3AZKD 4XZQA 4X23C 3AZKA 1P3AC 3W98B 3B0CT 3C1BC 3RELC 3UTBD 2CV5A 5AV5A 3UTBA 3UT9B 4ZUXB 4J8XB 1M1AD 3X1SC 5DNMA 4QLCD 1M1AA 3W99C 4WZSB 1P3ID 4KUDC 3REHA 4QLCA 5B40C 1JFIA 2RVQD 4HGAB 5AV8C 4Z66B 3LELA 1P3OD 3C1CC 3AZND 3MNNC 1P3FA 5JRGC 3AZNA 1P3MB 2JE5A 4UUZA 3AYWA 4XZQB 5DNNC 3AZKB 4UPKA 2Y2GA 2IO5B 3AZHC 2CV5B 2FFFB 5AY8C 5AV5B 3LJAD 5B2ID 4CAYA 2ZY3A 2NQBD 1U35A 5DNMB 1S32D 1M1AB 1HQ3D 5BT1C 3REHB 4QLCB 1HQ3A 1JFIB 3LELB 3W98C 3KWQD 3AZGD 5B24A 4CSRB 1P3FB 3VH6T 3AZMD 3AZNB 1P34D 2Y2LA 4J8XC 1P3KD 1B6WA 5B32D 4UUZB 1P3KA 1M18A 4H9PA 3AYWB 3AFAD 3X1UA 4HGAC 4Z66C 3WAAC 3WTPE 2Y2QA 5FUGA 3A6ND 3A1IA 4CAYB 3A6NA 4H9SA 3AZID 2Y2OA 1F66A 3KUYD 3AZIA 1U35B 2F8NH 5AV6D 2W8SA 5AVBD 5AV6A 4YM6C 1KX3C 1HQ3B 4JJND 2IO5C 2CV5C 5AV5C 5B31D 2LY8A 5B24B 5F99A 3AN2D 5DNMC 2J8PA 3AN2A 1P3KB 4H9PB 1M18B 4XUJD 3X1UB 3LELC 5BNVA 3R45A 3KXBA 5FUGB 1P3FC 5CPIB 3A6NB 4WNNA 1F66B 5B1LD 3EG5B 5B1LA 3AYWC 5AV6B 4X23D 5AV9C 1P3AD 3B0CW 1P3AA 2CWEA 3C1BD 5F99B 3RELA 4Z2MG 2F8ND 2FJ7A 4J8WA 1U35C 3REKD 2F8NA 2G5IC 3LZ1A 5G49A 3X1SD 5BNVB 3W99D 3X1SA 4KUDD 5B40D 3KXBB 3W99A 5AV8D 4H9OA 5GT0B 3C1CD 4WNNB 5B0ZB 3MNND 3MVDC 5JRGD 3EPLA 1M18C 5B1LB 1EQZC 3X1UC 3MGQA 1P3BC 5DNND 3O62A 1P3AB 5CPIC 3AZHD 5AY8D 1F66C 3RELB 3AZHA 2FJ7B 5JA4B 3B6GD 4J8WB 4KHAA 4WU8C 1Q9CA 2F8NB 3LZ1B 5B33C 3B6FA 2XD1A 3WTPC 5BT1D 3W98D 4AWLC 4LD9C 5F99C 3VH6W 3AV2C 1WWSA 1TZYB 3UT9D 4ZUXD 4J8XD 2F8NK 1BFMA 2RIQA 1ID3B 3VH6A 3MGQB 3KXBC 3O62B 4Z66D 3WAAD 5GT0C 3WAAA 5B0ZC 4ZBJC 3AZEA 5B2JC 4KHAB 3REJC 1P3MD 3B6FB 2BG1A 4YM6D 1KX3D 4YM6A 3TU4A 1KX3A 4H9NB 5AV5D 2CV5D 2FJ7C 4J8WC 3X1TB 4J8VA 3EPKA 3LZ1C 3WKJA 5DNMD 3X1VC 2Y2NA 5KDMB 3REHD 3LELD 2ZY5A 3WAAB 2DQNC 1P3FD 1TZYC 5GT3A 3AZEB 4YS3B 4CSRA 2YFWA 3AYWD 5AVCB 1ID3C 3MGQC 3KFUG 4J8UB 3O62C 2BYMA 4YM6B 3TU4B 5AV9D 2HUEB 1KX3B 5AV9A 2JCHA 2F2AC 4J8VB 3WKJB 4NE3A 1U35D 3B6FC 2Y2IA 2PYOA 1BH8A 5B24D 3X1TC 5GT3B 1AOIB 3AZLC 3W97A 2YFWB 2NZDA 1M18D 5BNXA 3MVDA 3X1UD 1EQZA 2BYMB 1P3BA 5AV9B 3NQUA 4YS3C 3AZEC 5CPID 3F6TA 4DRBA 1F66D 5CPIA 5AVCC 4WU8A 4J8UC 2L5AA 3WTPD 2Y2PA 4G91B 5B32G 5B33A 3TU4C 2HUEC 2PYOB 3WTPA 1PZRA 1BH8B 5E5AC 3AZJC 3UTAA 4EO5B 4J8VC 4Z5TA 5F99D 4LD9D 3AV2D 3W97B 3WKJC 4LD9A 2NZDB 1BH9A 5BNXB 3AV2A 3MVDB 3MGPB 1EQZB 3AV1A 3KXBD 5BS7C 1P3BB 5GT3C 5GT0D 3NQUB 1AOIC 1ZLAB 5GT0A 5B0ZD 5B0ZA 1Z2CB 3REJD 5B31G 5B2JA 4WU8B 2ZY4A 3NQJA 3REJA 5B33B 3WTPB 3UTAB 4E45A 4Z5TB 5BO0A 3REIA 4AWLB 3RELD 2FJ7D 4KGCB 4LD9B 4J8WD 1BH9B 3A1KA 5JA4A 3AV2B 3LZ1D 5GSUB 3P5JB 4G91C 2G5HC 2PYOC 3B0BA 3X1VD 3AV1B 1R4VA 3X1VA 4EO5C 1P3OC 1P3GB 3AZFC 3W97C 1TZYD 2NZDC 3EPJA 1TZYA 4ZBJB 3WA9C 5B2JB 3MGPC 3NQJB 3REJB 1ID3D 3MGQD 1ID3A 1P3LC 3O62D 1A7WA 1ZLAC 5BO0B 3REIB 4M6BA 2AROA 3B6FD 3LZ0A 3W96A 3X1VB 3UTAC 4Z5TC 3AZGC 4H9QA 2DF4C 4KGCC 4H9NA 3X1TD 1ULYA 3X1TA 3AZLD 5GXQA 5GSUC 5B32C 3AZLA 5CPJB 3AV1C 5KDMA 3B0DB 3MGRA 1P3GC 3AZED 4YS3D 4YS3A 2AROB 4WU9C 5AVCD 1KX5A 3LZ0B 5AVCA 5AVBC 4J8UD 3W96B 1M19C 4J8UA 3TU4D 1KX4A 4H9QB 5B1MA 5E5AD 3REIC 3AZJD 5E5AA 4J8VD 3AZJA 2ZY2A 4WV4B 5GXQB 3WKJD 3AZLB 5B0YA 5CPKA 3MGRB 4R8PA 5GT3D 5BS7A 5C3IC 1P3PA 1AOID 1AOIA 5CPJC 2YFVA 1KX5B 3MGSA 4WJ3C 3B0DC 1KX4B 5B1MB 2ZM5A 5E5AB 3AZJB 2AROC 2HIOB 3REKC 3LZ0C 5B0YB 3W96C 5CPKB 2PYOD 3KSYA 4R8PB 1P3IA 1P3PB 3AZFD 3V9RA 5GXQC 1P3OA 3W97D 4NE5A 2YFVB 3AZFA 2NZDD 3MVDD 3WA9D 3MGSB 3MGPD 3WA9A 3MGPA 1EQZD 3MGRC 1P3LD 5CP6C 2JSSA 1P3BD 1P3LA 1ZLAD 3H0MC 1ZLAA 3UTBB 3B6GC 3LJAA 1KX5C 5B2IA 1TAFA 4WU8D 2NQBA 5B33D 1KX4C 5B1MC 1S32A 3UTAD 1P3IB 4Z5TD 1WWIA 3V9RB 1P3OB 4KGCD 3KWQA 3AZGA 3AZFB 2HIOC 4Z2MH 2BYKA 3UT9C 3IP4C 4KGCA 5B0YC 4ZUXC 5GSUD 3AZMA 5CPKC 3WA9B 1P34A 5GSUA 5B32A 2Y2JA 3AV1D 4R8PC 3VH5T 1P3LB 1P3PC 3AFAA 1P3GD 1P3GA 3LJAB 5B2JD 5B2IB 1TAFB 3MGSC 1P3MC 4WU9D 3KUYA 2NQBB 4XZQC 4WU9A 4G92B 3AZKC 1S32B 1M19D 5AVBA 1N1JA 1M19A 3REID 4JJNA 3KWQB 3UTBC 3AZGB 5B31A 2BYKB 1B67A 1H3OA 3AZMB 1HTAA 1P34B 5B32B 1M1AC 3REHC 4QLCC 3FDDA 1P3IC 3EPHA 4XUJA 3AFAB 2RVQC 4NFTA 3AZNC 5CPJD 3AZIB 4DQYB 3KUYB 5CPJA 4WU9B 2F8NG 4NE6A 5AVBB 1N1JB 1M19B 4JJNB 4X23A 3LJAC 5B31B 5CHLB 5B2IC 1H3OB 2AROD 3C1BA 1T3UA 2NQBC 3AN2B 3LZ0D 4G92C 3REKA 1S32C 3W96D 4H9RA 1HQ3C 2UWXA 4XUJB 3R45B 3KWQC 5B24C 4KUDA 5B40A 5AV8A 5GXQD 5C3IB 3AZMC 3C1CA 1P34C 1P3KC 1F1EA
chains in the Genus database with same CATH topology
3MNNA 5JRGA 1KU5A 4E44A 3AFAC 3MGRD 5CP6D 4X23B 4DRAA 5DNNA 5CP6A 3A6NC 4H9SC 3C1BB 3AZIC 5AY8A 3KUYC 1KX5D 3B6GA 3REKB 5AV6C 4H9RB 5G49B 3X1SB 5B1MD 4JJNC 1KX4D 1W2EA 3H0RC 3W99B 4KUDB 4H9OB 5B31C 5B40B 3W98A 5AV8B 2HIOD 3C1CB 3AN2C 5B0YD 2HIOA 5JRGB 3MNNB 2XD5A 3UT9A 5CPKD 4ZUXA 4J8XA 3H0LC 2Y2HA 2Y2KA 4XUJC 3VH5W 4R8PD 2VQRA 5DNNB 5CP6B 1P3PD 4Z66A 3AZHB 3VH5A 3AL0C 5AY8B 5B1LC 3MGSD 3B6GB 1P3MA 2Y2MA 4XZQD 3AZKD 4XZQA 4X23C 3AZKA 1P3AC 3W98B 3B0CT 3C1BC 3RELC 3UTBD 2CV5A 5AV5A 3UTBA 3UT9B 4ZUXB 4J8XB 1M1AD 3X1SC 5DNMA 4QLCD 1M1AA 3W99C 4WZSB 1P3ID 4KUDC 3REHA 4QLCA 5B40C 1JFIA 2RVQD 4HGAB 5AV8C 4Z66B 3LELA 1P3OD 3C1CC 3AZND 3MNNC 1P3FA 5JRGC 3AZNA 1P3MB 2JE5A 4UUZA 3AYWA 4XZQB 5DNNC 3AZKB 4UPKA 2Y2GA 2IO5B 3AZHC 2CV5B 2FFFB 5AY8C 5AV5B 3LJAD 5B2ID 4CAYA 2ZY3A 2NQBD 1U35A 5DNMB 1S32D 1M1AB 1HQ3D 5BT1C 3REHB 4QLCB 1HQ3A 1JFIB 3LELB 3W98C 3KWQD 3AZGD 5B24A 4CSRB 1P3FB 3VH6T 3AZMD 3AZNB 1P34D 2Y2LA 4J8XC 1P3KD 1B6WA 5B32D 4UUZB 1P3KA 1M18A 4H9PA 3AYWB 3AFAD 3X1UA 4HGAC 4Z66C 3WAAC 3WTPE 2Y2QA 5FUGA 3A6ND 3A1IA 4CAYB 3A6NA 4H9SA 3AZID 2Y2OA 1F66A 3KUYD 3AZIA 1U35B 2F8NH 5AV6D 2W8SA 5AVBD 5AV6A 4YM6C 1KX3C 1HQ3B 4JJND 2IO5C 2CV5C 5AV5C 5B31D 2LY8A 5B24B 5F99A 3AN2D 5DNMC 2J8PA 3AN2A 1P3KB 4H9PB 1M18B 4XUJD 3X1UB 3LELC 5BNVA 3R45A 3KXBA 5FUGB 1P3FC 5CPIB 3A6NB 4WNNA 1F66B 5B1LD 3EG5B 5B1LA 3AYWC 5AV6B 4X23D 5AV9C 1P3AD 3B0CW 1P3AA 2CWEA 3C1BD 5F99B 3RELA 4Z2MG 2F8ND 2FJ7A 4J8WA 1U35C 3REKD 2F8NA 2G5IC 3LZ1A 5G49A 3X1SD 5BNVB 3W99D 3X1SA 4KUDD 5B40D 3KXBB 3W99A 5AV8D 4H9OA 5GT0B 3C1CD 4WNNB 5B0ZB 3MNND 3MVDC 5JRGD 3EPLA 1M18C 5B1LB 1EQZC 3X1UC 3MGQA 1P3BC 5DNND 3O62A 1P3AB 5CPIC 3AZHD 5AY8D 1F66C 3RELB 3AZHA 2FJ7B 5JA4B 3B6GD 4J8WB 4KHAA 4WU8C 1Q9CA 2F8NB 3LZ1B 5B33C 3B6FA 2XD1A 3WTPC 5BT1D 3W98D 4AWLC 4LD9C 5F99C 3VH6W 3AV2C 1WWSA 1TZYB 3UT9D 4ZUXD 4J8XD 2F8NK 1BFMA 2RIQA 1ID3B 3VH6A 3MGQB 3KXBC 3O62B 4Z66D 3WAAD 5GT0C 3WAAA 5B0ZC 4ZBJC 3AZEA 5B2JC 4KHAB 3REJC 1P3MD 3B6FB 2BG1A 4YM6D 1KX3D 4YM6A 3TU4A 1KX3A 4H9NB 5AV5D 2CV5D 2FJ7C 4J8WC 3X1TB 4J8VA 3EPKA 3LZ1C 3WKJA 5DNMD 3X1VC 2Y2NA 5KDMB 3REHD 3LELD 2ZY5A 3WAAB 2DQNC 1P3FD 1TZYC 5GT3A 3AZEB 4YS3B 4CSRA 2YFWA 3AYWD 5AVCB 1ID3C 3MGQC 3KFUG 4J8UB 3O62C 2BYMA 4YM6B 3TU4B 5AV9D 2HUEB 1KX3B 5AV9A 2JCHA 2F2AC 4J8VB 3WKJB 4NE3A 1U35D 3B6FC 2Y2IA 2PYOA 1BH8A 5B24D 3X1TC 5GT3B 1AOIB 3AZLC 3W97A 2YFWB 2NZDA 1M18D 5BNXA 3MVDA 3X1UD 1EQZA 2BYMB 1P3BA 5AV9B 3NQUA 4YS3C 3AZEC 5CPID 3F6TA 4DRBA 1F66D 5CPIA 5AVCC 4WU8A 4J8UC 2L5AA 3WTPD 2Y2PA 4G91B 5B32G 5B33A 3TU4C 2HUEC 2PYOB 3WTPA 1PZRA 1BH8B 5E5AC 3AZJC 3UTAA 4EO5B 4J8VC 4Z5TA 5F99D 4LD9D 3AV2D 3W97B 3WKJC 4LD9A 2NZDB 1BH9A 5BNXB 3AV2A 3MVDB 3MGPB 1EQZB 3AV1A 3KXBD 5BS7C 1P3BB 5GT3C 5GT0D 3NQUB 1AOIC 1ZLAB 5GT0A 5B0ZD 5B0ZA 1Z2CB 3REJD 5B31G 5B2JA 4WU8B 2ZY4A 3NQJA 3REJA 5B33B 3WTPB 3UTAB 4E45A 4Z5TB 5BO0A 3REIA 4AWLB 3RELD 2FJ7D 4KGCB 4LD9B 4J8WD 1BH9B 3A1KA 5JA4A 3AV2B 3LZ1D 5GSUB 3P5JB 4G91C 2G5HC 2PYOC 3B0BA 3X1VD 3AV1B 1R4VA 3X1VA 4EO5C 1P3OC 1P3GB 3AZFC 3W97C 1TZYD 2NZDC 3EPJA 1TZYA 4ZBJB 3WA9C 5B2JB 3MGPC 3NQJB 3REJB 1ID3D 3MGQD 1ID3A 1P3LC 3O62D 1A7WA 1ZLAC 5BO0B 3REIB 4M6BA 2AROA 3B6FD 3LZ0A 3W96A 3X1VB 3UTAC 4Z5TC 3AZGC 4H9QA 2DF4C 4KGCC 4H9NA 3X1TD 1ULYA 3X1TA 3AZLD 5GXQA 5GSUC 5B32C 3AZLA 5CPJB 3AV1C 5KDMA 3B0DB 3MGRA 1P3GC 3AZED 4YS3D 4YS3A 2AROB 4WU9C 5AVCD 1KX5A 3LZ0B 5AVCA 5AVBC 4J8UD 3W96B 1M19C 4J8UA 3TU4D 1KX4A 4H9QB 5B1MA 5E5AD 3REIC 3AZJD 5E5AA 4J8VD 3AZJA 2ZY2A 4WV4B 5GXQB 3WKJD 3AZLB 5B0YA 5CPKA 3MGRB 4R8PA 5GT3D 5BS7A 5C3IC 1P3PA 1AOID 1AOIA 5CPJC 2YFVA 1KX5B 3MGSA 4WJ3C 3B0DC 1KX4B 5B1MB 2ZM5A 5E5AB 3AZJB 2AROC 2HIOB 3REKC 3LZ0C 5B0YB 3W96C 5CPKB 2PYOD 3KSYA 4R8PB 1P3IA 1P3PB 3AZFD 3V9RA 5GXQC 1P3OA 3W97D 4NE5A 2YFVB 3AZFA 2NZDD 3MVDD 3WA9D 3MGSB 3MGPD 3WA9A 3MGPA 1EQZD 3MGRC 1P3LD 5CP6C 2JSSA 1P3BD 1P3LA 1ZLAD 3H0MC 1ZLAA 3UTBB 3B6GC 3LJAA 1KX5C 5B2IA 1TAFA 4WU8D 2NQBA 5B33D 1KX4C 5B1MC 1S32A 3UTAD 1P3IB 4Z5TD 1WWIA 3V9RB 1P3OB 4KGCD 3KWQA 3AZGA 3AZFB 2HIOC 4Z2MH 2BYKA 3UT9C 3IP4C 4KGCA 5B0YC 4ZUXC 5GSUD 3AZMA 5CPKC 3WA9B 1P34A 5GSUA 5B32A 2Y2JA 3AV1D 4R8PC 3VH5T 1P3LB 1P3PC 3AFAA 1P3GD 1P3GA 3LJAB 5B2JD 5B2IB 1TAFB 3MGSC 1P3MC 4WU9D 3KUYA 2NQBB 4XZQC 4WU9A 4G92B 3AZKC 1S32B 1M19D 5AVBA 1N1JA 1M19A 3REID 4JJNA 3KWQB 3UTBC 3AZGB 5B31A 2BYKB 1B67A 1H3OA 3AZMB 1HTAA 1P34B 5B32B 1M1AC 3REHC 4QLCC 3FDDA 1P3IC 3EPHA 4XUJA 3AFAB 2RVQC 4NFTA 3AZNC 5CPJD 3AZIB 4DQYB 3KUYB 5CPJA 4WU9B 2F8NG 4NE6A 5AVBB 1N1JB 1M19B 4JJNB 4X23A 3LJAC 5B31B 5CHLB 5B2IC 1H3OB 2AROD 3C1BA 1T3UA 2NQBC 3AN2B 3LZ0D 4G92C 3REKA 1S32C 3W96D 4H9RA 1HQ3C 2UWXA 4XUJB 3R45B 3KWQC 5B24C 4KUDA 5B40A 5AV8A 5GXQD 5C3IB 3AZMC 3C1CA 1P34C 1P3KC 1F1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN A;  5JRG A;  1KU5 A;  4E44 A;  3AFA C;  3MGR D;  5CP6 D;  4X23 B;  4DRA A;  5DNN A;  5CP6 A;  3A6N C;  4H9S C;  3C1B B;  3AZI C;  5AY8 A;  3KUY C;  1KX5 D;  3B6G A;  3REK B;  5AV6 C;  4H9R B;  5G49 B;  3X1S B;  5B1M D;  4JJN C;  1KX4 D;  3W99 B;  4KUD B;  4H9O B;  5B31 C;  5B40 B;  3W98 A;  5AV8 B;  2HIO D;  3C1C B;  3AN2 C;  5B0Y D;  2HIO A;  5JRG B;  3MNN B;  3UT9 A;  5CPK D;  4ZUX A;  4J8X A;  4XUJ C;  3VH5 W;  4R8P D;  5DNN B;  5CP6 B;  1P3P D;  4Z66 A;  3AZH B;  3VH5 A;  5AY8 B;  5B1L C;  3MGS D;  3B6G B;  1P3M A;  4XZQ D;  3AZK D;  4XZQ A;  4X23 C;  3AZK A;  1P3A C;  3W98 B;  3B0C T;  3C1B C;  3REL C;  3UTB D;  2CV5 A;  5AV5 A;  3UTB A;  3UT9 B;  4ZUX B;  4J8X B;  1M1A D;  3X1S C;  5DNM A;  4QLC D;  1M1A A;  4WZS B;  3W99 C;  1P3I D;  4KUD C;  3REH A;  4QLC A;  5B40 C;  1JFI A;  2RVQ D;  4HGA B;  5AV8 C;  4Z66 B;  3LEL A;  1P3O D;  3C1C C;  3AZN D;  3MNN C;  1P3F A;  5JRG C;  3AZN A;  1P3M B;  4UUZ A;  3AYW A;  4XZQ B;  5DNN C;  3AZK B;  2IO5 B;  3AZH C;  2CV5 B;  5AV5 B;  5AY8 C;  3LJA D;  5B2I D;  4CAY A;  2NQB D;  1U35 A;  5DNM B;  1S32 D;  1M1A B;  1HQ3 D;  5BT1 C;  3REH B;  4QLC B;  1HQ3 A;  1JFI B;  3LEL B;  3W98 C;  3KWQ D;  3AZG D;  5B24 A;  4CSR B;  1P3F B;  3VH6 T;  3AZM D;  3AZN B;  1P34 D;  4J8X C;  1P3K D;  1B6W A;  5B32 D;  4UUZ B;  1P3K A;  1M18 A;  4H9P A;  3AYW B;  3AFA D;  3X1U A;  4HGA C;  4Z66 C;  3WAA C;  3WTP E;  3A6N D;  5FUG A;  4CAY B;  3A6N A;  4H9S A;  3AZI D;  1F66 A;  3KUY D;  3AZI A;  1U35 B;  2F8N H;  5AV6 D;  5AVB D;  5AV6 A;  4YM6 C;  1KX3 C;  1HQ3 B;  4JJN D;  2IO5 C;  2CV5 C;  5AV5 C;  5B31 D;  2LY8 A;  5B24 B;  5F99 A;  3AN2 D;  5DNM C;  1P3K B;  3AN2 A;  1M18 B;  4H9P B;  4XUJ D;  3X1U B;  3LEL C;  5BNV A;  3R45 A;  3KXB A;  5FUG B;  1P3F C;  5CPI B;  3A6N B;  4WNN A;  1F66 B;  5B1L D;  5B1L A;  3AYW C;  5AV6 B;  4X23 D;  5AV9 C;  1P3A D;  3B0C W;  1P3A A;  2CWE A;  3C1B D;  5F99 B;  3REL A;  4Z2M G;  2F8N D;  2FJ7 A;  4J8W A;  1U35 C;  3REK D;  2F8N A;  3LZ1 A;  5G49 A;  3X1S D;  5BNV B;  3W99 D;  3X1S A;  4KUD D;  5B40 D;  3KXB B;  3W99 A;  5AV8 D;  4H9O A;  5GT0 B;  3C1C D;  4WNN B;  5B0Z B;  3MNN D;  3MVD C;  5JRG D;  1M18 C;  5B1L B;  1EQZ C;  3X1U C;  3MGQ A;  1P3B C;  5DNN D;  3O62 A;  1P3A B;  5CPI C;  3AZH D;  5AY8 D;  1F66 C;  3REL B;  3AZH A;  2FJ7 B;  5JA4 B;  3B6G D;  4J8W B;  4KHA A;  4WU8 C;  1Q9C A;  2F8N B;  3LZ1 B;  5B33 C;  3B6F A;  3WTP C;  5BT1 D;  3W98 D;  4AWL C;  4LD9 C;  5F99 C;  3VH6 W;  3AV2 C;  1WWS A;  1TZY B;  3UT9 D;  4ZUX D;  4J8X D;  2F8N K;  1BFM A;  1ID3 B;  3VH6 A;  3MGQ B;  3KXB C;  3O62 B;  4Z66 D;  3WAA D;  5GT0 C;  3WAA A;  5B0Z C;  4ZBJ C;  3AZE A;  5B2J C;  4KHA B;  3REJ C;  1P3M D;  3B6F B;  4YM6 D;  1KX3 D;  4YM6 A;  3TU4 A;  1KX3 A;  4H9N B;  5AV5 D;  2CV5 D;  2FJ7 C;  4J8W C;  3X1T B;  4J8V A;  3LZ1 C;  3WKJ A;  5DNM D;  3X1V C;  5KDM B;  3REH D;  3LEL D;  3WAA B;  1P3F D;  1TZY C;  5GT3 A;  3AZE B;  4YS3 B;  4CSR A;  2YFW A;  3AYW D;  5AVC B;  1ID3 C;  3MGQ C;  4J8U B;  3O62 C;  2BYM A;  4YM6 B;  3TU4 B;  5AV9 D;  2HUE B;  1KX3 B;  5AV9 A;  4J8V B;  3WKJ B;  4NE3 A;  1U35 D;  3B6F C;  2PYO A;  1BH8 A;  5B24 D;  3X1T C;  5GT3 B;  1AOI B;  3AZL C;  3W97 A;  2YFW B;  2NZD A;  1M18 D;  5BNX A;  3MVD A;  3X1U D;  1EQZ A;  2BYM B;  1P3B A;  5AV9 B;  3NQU A;  4YS3 C;  3AZE C;  5CPI D;  4DRB A;  1F66 D;  5CPI A;  5AVC C;  4WU8 A;  4J8U C;  2L5A A;  3WTP D;  4G91 B;  5B33 A;  5B32 G;  3TU4 C;  2PYO B;  2HUE C;  3WTP A;  1BH8 B;  5E5A C;  3AZJ C;  3UTA A;  4EO5 B;  4J8V C;  4Z5T A;  5F99 D;  4LD9 D;  3AV2 D;  3W97 B;  3WKJ C;  4LD9 A;  2NZD B;  1BH9 A;  5BNX B;  3AV2 A;  3MVD B;  3MGP B;  1EQZ B;  3AV1 A;  3KXB D;  5BS7 C;  1P3B B;  5GT3 C;  5GT0 D;  3NQU B;  1AOI C;  1ZLA B;  5GT0 A;  5B0Z D;  5B0Z A;  3REJ D;  5B31 G;  5B2J A;  4WU8 B;  3NQJ A;  3REJ A;  5B33 B;  3WTP B;  3UTA B;  4E45 A;  4Z5T B;  5BO0 A;  3REI A;  4AWL B;  3REL D;  2FJ7 D;  4KGC B;  4LD9 B;  4J8W D;  1BH9 B;  5JA4 A;  3AV2 B;  3LZ1 D;  5GSU B;  4G91 C;  2PYO C;  3B0B A;  3X1V D;  3AV1 B;  1R4V A;  3X1V A;  4EO5 C;  1P3O C;  1P3G B;  3AZF C;  3W97 C;  1TZY D;  2NZD C;  1TZY A;  4ZBJ B;  3WA9 C;  5B2J B;  3MGP C;  3NQJ B;  3REJ B;  1ID3 D;  3MGQ D;  1ID3 A;  1P3L C;  3O62 D;  1A7W A;  1ZLA C;  5BO0 B;  3REI B;  4M6B A;  2ARO A;  3B6F D;  3LZ0 A;  3W96 A;  3X1V B;  3UTA C;  4Z5T C;  3AZG C;  4H9Q A;  4KGC C;  4H9N A;  3X1T D;  1ULY A;  3X1T A;  3AZL D;  5GXQ A;  5GSU C;  5B32 C;  3AZL A;  5CPJ B;  3AV1 C;  5KDM A;  3B0D B;  3MGR A;  1P3G C;  3AZE D;  4YS3 D;  4YS3 A;  2ARO B;  4WU9 C;  5AVC D;  1KX5 A;  3LZ0 B;  5AVC A;  5AVB C;  4J8U D;  3W96 B;  1M19 C;  4J8U A;  3TU4 D;  1KX4 A;  4H9Q B;  5B1M A;  5E5A D;  3REI C;  3AZJ D;  5E5A A;  4J8V D;  3AZJ A;  4WV4 B;  5GXQ B;  3WKJ D;  3AZL B;  5B0Y A;  5CPK A;  3MGR B;  4R8P A;  5GT3 D;  5BS7 A;  5C3I C;  1P3P A;  1AOI D;  1AOI A;  5CPJ C;  2YFV A;  1KX5 B;  3MGS A;  3B0D C;  1KX4 B;  5B1M B;  5E5A B;  3AZJ B;  2ARO C;  2HIO B;  3REK C;  3LZ0 C;  5B0Y B;  3W96 C;  5CPK B;  2PYO D;  3KSY A;  4R8P B;  1P3I A;  1P3P B;  3AZF D;  3V9R A;  5GXQ C;  1P3O A;  3W97 D;  4NE5 A;  2YFV B;  3AZF A;  2NZD D;  3MVD D;  3WA9 D;  3MGS B;  3MGP D;  3WA9 A;  3MGP A;  1EQZ D;  3MGR C;  1P3L D;  5CP6 C;  2JSS A;  1P3B D;  1P3L A;  1ZLA D;  1ZLA A;  3UTB B;  3B6G C;  3LJA A;  1KX5 C;  5B2I A;  1TAF A;  4WU8 D;  2NQB A;  5B33 D;  1KX4 C;  5B1M C;  1S32 A;  3UTA D;  1P3I B;  4Z5T D;  1WWI A;  3V9R B;  1P3O B;  4KGC D;  3KWQ A;  3AZG A;  3AZF B;  2HIO C;  4Z2M H;  2BYK A;  3UT9 C;  4KGC A;  5B0Y C;  4ZUX C;  5GSU D;  3AZM A;  5CPK C;  3WA9 B;  1P34 A;  5GSU A;  5B32 A;  3AV1 D;  4R8P C;  3VH5 T;  1P3L B;  1P3P C;  3AFA A;  1P3G D;  1P3G A;  3LJA B;  5B2J D;  5B2I B;  1TAF B;  3MGS C;  1P3M C;  4WU9 D;  3KUY A;  2NQB B;  4XZQ C;  4WU9 A;  4G92 B;  3AZK C;  1S32 B;  1M19 D;  5AVB A;  1N1J A;  1M19 A;  3REI D;  4JJN A;  3KWQ B;  3UTB C;  3AZG B;  5B31 A;  2BYK B;  1B67 A;  1H3O A;  3AZM B;  1HTA A;  1P34 B;  5B32 B;  1M1A C;  3REH C;  4QLC C;  1P3I C;  4XUJ A;  3AFA B;  2RVQ C;  4NFT A;  3AZN C;  5CPJ D;  3AZI B;  3KUY B;  5CPJ A;  4WU9 B;  2F8N G;  4NE6 A;  5AVB B;  1N1J B;  1M19 B;  4JJN B;  4X23 A;  3LJA C;  5B31 B;  5CHL B;  5B2I C;  1H3O B;  2ARO D;  3C1B A;  2NQB C;  3AN2 B;  3LZ0 D;  4G92 C;  3REK A;  1S32 C;  3W96 D;  4H9R A;  1HQ3 C;  4XUJ B;  3R45 B;  3KWQ C;  5B24 C;  4KUD A;  5B40 A;  5AV8 A;  5GXQ D;  5C3I B;  3AZM C;  3C1C A;  1P34 C;  1P3K C;  1F1E A; 
#chains in the Genus database with same CATH topology
 3MNN A;  5JRG A;  1KU5 A;  4E44 A;  3AFA C;  3MGR D;  5CP6 D;  4X23 B;  4DRA A;  5DNN A;  5CP6 A;  3A6N C;  4H9S C;  3C1B B;  3AZI C;  5AY8 A;  3KUY C;  1KX5 D;  3B6G A;  3REK B;  5AV6 C;  4H9R B;  5G49 B;  3X1S B;  5B1M D;  4JJN C;  1KX4 D;  1W2E A;  3H0R C;  3W99 B;  4KUD B;  4H9O B;  5B31 C;  5B40 B;  3W98 A;  5AV8 B;  2HIO D;  3C1C B;  3AN2 C;  5B0Y D;  2HIO A;  5JRG B;  3MNN B;  2XD5 A;  3UT9 A;  5CPK D;  4ZUX A;  4J8X A;  3H0L C;  2Y2H A;  2Y2K A;  4XUJ C;  3VH5 W;  4R8P D;  2VQR A;  5DNN B;  5CP6 B;  1P3P D;  4Z66 A;  3AZH B;  3VH5 A;  3AL0 C;  5AY8 B;  5B1L C;  3MGS D;  3B6G B;  1P3M A;  2Y2M A;  4XZQ D;  3AZK D;  4XZQ A;  4X23 C;  3AZK A;  1P3A C;  3W98 B;  3B0C T;  3C1B C;  3REL C;  3UTB D;  2CV5 A;  5AV5 A;  3UTB A;  3UT9 B;  4ZUX B;  4J8X B;  1M1A D;  3X1S C;  5DNM A;  4QLC D;  1M1A A;  3W99 C;  4WZS B;  1P3I D;  4KUD C;  3REH A;  4QLC A;  5B40 C;  1JFI A;  2RVQ D;  4HGA B;  5AV8 C;  4Z66 B;  3LEL A;  1P3O D;  3C1C C;  3AZN D;  3MNN C;  1P3F A;  5JRG C;  3AZN A;  1P3M B;  2JE5 A;  4UUZ A;  3AYW A;  4XZQ B;  5DNN C;  3AZK B;  4UPK A;  2Y2G A;  2IO5 B;  3AZH C;  2CV5 B;  2FFF B;  5AY8 C;  5AV5 B;  3LJA D;  5B2I D;  4CAY A;  2ZY3 A;  2NQB D;  1U35 A;  5DNM B;  1S32 D;  1M1A B;  1HQ3 D;  5BT1 C;  3REH B;  4QLC B;  1HQ3 A;  1JFI B;  3LEL B;  3W98 C;  3KWQ D;  3AZG D;  5B24 A;  4CSR B;  1P3F B;  3VH6 T;  3AZM D;  3AZN B;  1P34 D;  2Y2L A;  4J8X C;  1P3K D;  1B6W A;  5B32 D;  4UUZ B;  1P3K A;  1M18 A;  4H9P A;  3AYW B;  3AFA D;  3X1U A;  4HGA C;  4Z66 C;  3WAA C;  3WTP E;  2Y2Q A;  5FUG A;  3A6N D;  3A1I A;  4CAY B;  3A6N A;  4H9S A;  3AZI D;  2Y2O A;  1F66 A;  3KUY D;  3AZI A;  1U35 B;  2F8N H;  5AV6 D;  2W8S A;  5AVB D;  5AV6 A;  4YM6 C;  1KX3 C;  1HQ3 B;  4JJN D;  2IO5 C;  2CV5 C;  5AV5 C;  5B31 D;  2LY8 A;  5B24 B;  5F99 A;  3AN2 D;  5DNM C;  2J8P A;  3AN2 A;  1P3K B;  4H9P B;  1M18 B;  4XUJ D;  3X1U B;  3LEL C;  5BNV A;  3R45 A;  3KXB A;  5FUG B;  1P3F C;  5CPI B;  3A6N B;  4WNN A;  1F66 B;  5B1L D;  3EG5 B;  5B1L A;  3AYW C;  5AV6 B;  4X23 D;  5AV9 C;  1P3A D;  3B0C W;  1P3A A;  2CWE A;  3C1B D;  5F99 B;  3REL A;  4Z2M G;  2F8N D;  2FJ7 A;  4J8W A;  1U35 C;  3REK D;  2F8N A;  2G5I C;  3LZ1 A;  5G49 A;  3X1S D;  5BNV B;  3W99 D;  3X1S A;  4KUD D;  5B40 D;  3KXB B;  3W99 A;  5AV8 D;  4H9O A;  5GT0 B;  3C1C D;  4WNN B;  5B0Z B;  3MNN D;  3MVD C;  5JRG D;  3EPL A;  1M18 C;  5B1L B;  1EQZ C;  3X1U C;  3MGQ A;  1P3B C;  5DNN D;  3O62 A;  1P3A B;  5CPI C;  3AZH D;  5AY8 D;  1F66 C;  3REL B;  3AZH A;  2FJ7 B;  5JA4 B;  3B6G D;  4J8W B;  4KHA A;  4WU8 C;  1Q9C A;  2F8N B;  3LZ1 B;  5B33 C;  3B6F A;  2XD1 A;  3WTP C;  5BT1 D;  3W98 D;  4AWL C;  4LD9 C;  5F99 C;  3VH6 W;  3AV2 C;  1WWS A;  1TZY B;  3UT9 D;  4ZUX D;  4J8X D;  2F8N K;  1BFM A;  2RIQ A;  1ID3 B;  3VH6 A;  3MGQ B;  3KXB C;  3O62 B;  4Z66 D;  3WAA D;  5GT0 C;  3WAA A;  5B0Z C;  4ZBJ C;  3AZE A;  5B2J C;  4KHA B;  3REJ C;  1P3M D;  3B6F B;  2BG1 A;  4YM6 D;  1KX3 D;  4YM6 A;  3TU4 A;  1KX3 A;  4H9N B;  5AV5 D;  2CV5 D;  2FJ7 C;  4J8W C;  3X1T B;  4J8V A;  3EPK A;  3LZ1 C;  3WKJ A;  5DNM D;  3X1V C;  2Y2N A;  5KDM B;  3REH D;  3LEL D;  2ZY5 A;  3WAA B;  2DQN C;  1P3F D;  1TZY C;  5GT3 A;  3AZE B;  4YS3 B;  4CSR A;  2YFW A;  3AYW D;  5AVC B;  1ID3 C;  3MGQ C;  3KFU G;  4J8U B;  3O62 C;  2BYM A;  4YM6 B;  3TU4 B;  5AV9 D;  2HUE B;  1KX3 B;  5AV9 A;  2JCH A;  2F2A C;  4J8V B;  3WKJ B;  4NE3 A;  1U35 D;  3B6F C;  2Y2I A;  2PYO A;  1BH8 A;  5B24 D;  3X1T C;  5GT3 B;  1AOI B;  3AZL C;  3W97 A;  2YFW B;  2NZD A;  1M18 D;  5BNX A;  3MVD A;  3X1U D;  1EQZ A;  2BYM B;  1P3B A;  5AV9 B;  3NQU A;  4YS3 C;  3AZE C;  5CPI D;  3F6T A;  4DRB A;  1F66 D;  5CPI A;  5AVC C;  4WU8 A;  4J8U C;  2L5A A;  3WTP D;  2Y2P A;  4G91 B;  5B32 G;  5B33 A;  3TU4 C;  2HUE C;  2PYO B;  3WTP A;  1PZR A;  1BH8 B;  5E5A C;  3AZJ C;  3UTA A;  4EO5 B;  4J8V C;  4Z5T A;  5F99 D;  4LD9 D;  3AV2 D;  3W97 B;  3WKJ C;  4LD9 A;  2NZD B;  1BH9 A;  5BNX B;  3AV2 A;  3MVD B;  3MGP B;  1EQZ B;  3AV1 A;  3KXB D;  5BS7 C;  1P3B B;  5GT3 C;  5GT0 D;  3NQU B;  1AOI C;  1ZLA B;  5GT0 A;  5B0Z D;  5B0Z A;  1Z2C B;  3REJ D;  5B31 G;  5B2J A;  4WU8 B;  2ZY4 A;  3NQJ A;  3REJ A;  5B33 B;  3WTP B;  3UTA B;  4E45 A;  4Z5T B;  5BO0 A;  3REI A;  4AWL B;  3REL D;  2FJ7 D;  4KGC B;  4LD9 B;  4J8W D;  1BH9 B;  3A1K A;  5JA4 A;  3AV2 B;  3LZ1 D;  5GSU B;  3P5J B;  4G91 C;  2G5H C;  2PYO C;  3B0B A;  3X1V D;  3AV1 B;  1R4V A;  3X1V A;  4EO5 C;  1P3O C;  1P3G B;  3AZF C;  3W97 C;  1TZY D;  2NZD C;  3EPJ A;  1TZY A;  4ZBJ B;  3WA9 C;  5B2J B;  3MGP C;  3NQJ B;  3REJ B;  1ID3 D;  3MGQ D;  1ID3 A;  1P3L C;  3O62 D;  1A7W A;  1ZLA C;  5BO0 B;  3REI B;  4M6B A;  2ARO A;  3B6F D;  3LZ0 A;  3W96 A;  3X1V B;  3UTA C;  4Z5T C;  3AZG C;  4H9Q A;  2DF4 C;  4KGC C;  4H9N A;  3X1T D;  1ULY A;  3X1T A;  3AZL D;  5GXQ A;  5GSU C;  5B32 C;  3AZL A;  5CPJ B;  3AV1 C;  5KDM A;  3B0D B;  3MGR A;  1P3G C;  3AZE D;  4YS3 D;  4YS3 A;  2ARO B;  4WU9 C;  5AVC D;  1KX5 A;  3LZ0 B;  5AVC A;  5AVB C;  4J8U D;  3W96 B;  1M19 C;  4J8U A;  3TU4 D;  1KX4 A;  4H9Q B;  5B1M A;  5E5A D;  3REI C;  3AZJ D;  5E5A A;  4J8V D;  3AZJ A;  2ZY2 A;  4WV4 B;  5GXQ B;  3WKJ D;  3AZL B;  5B0Y A;  5CPK A;  3MGR B;  4R8P A;  5GT3 D;  5BS7 A;  5C3I C;  1P3P A;  1AOI D;  1AOI A;  5CPJ C;  2YFV A;  1KX5 B;  3MGS A;  4WJ3 C;  3B0D C;  1KX4 B;  5B1M B;  2ZM5 A;  5E5A B;  3AZJ B;  2ARO C;  2HIO B;  3REK C;  3LZ0 C;  5B0Y B;  3W96 C;  5CPK B;  2PYO D;  3KSY A;  4R8P B;  1P3I A;  1P3P B;  3AZF D;  3V9R A;  5GXQ C;  1P3O A;  3W97 D;  4NE5 A;  2YFV B;  3AZF A;  2NZD D;  3MVD D;  3WA9 D;  3MGS B;  3MGP D;  3WA9 A;  3MGP A;  1EQZ D;  3MGR C;  1P3L D;  5CP6 C;  2JSS A;  1P3B D;  1P3L A;  1ZLA D;  3H0M C;  1ZLA A;  3UTB B;  3B6G C;  3LJA A;  1KX5 C;  5B2I A;  1TAF A;  4WU8 D;  2NQB A;  5B33 D;  1KX4 C;  5B1M C;  1S32 A;  3UTA D;  1P3I B;  4Z5T D;  1WWI A;  3V9R B;  1P3O B;  4KGC D;  3KWQ A;  3AZG A;  3AZF B;  2HIO C;  4Z2M H;  2BYK A;  3UT9 C;  3IP4 C;  4KGC A;  5B0Y C;  4ZUX C;  5GSU D;  3AZM A;  5CPK C;  3WA9 B;  1P34 A;  5GSU A;  5B32 A;  2Y2J A;  3AV1 D;  4R8P C;  3VH5 T;  1P3L B;  1P3P C;  3AFA A;  1P3G D;  1P3G A;  3LJA B;  5B2J D;  5B2I B;  1TAF B;  3MGS C;  1P3M C;  4WU9 D;  3KUY A;  2NQB B;  4XZQ C;  4WU9 A;  4G92 B;  3AZK C;  1S32 B;  1M19 D;  5AVB A;  1N1J A;  1M19 A;  3REI D;  4JJN A;  3KWQ B;  3UTB C;  3AZG B;  5B31 A;  2BYK B;  1B67 A;  1H3O A;  3AZM B;  1HTA A;  1P34 B;  5B32 B;  1M1A C;  3REH C;  4QLC C;  3FDD A;  1P3I C;  3EPH A;  4XUJ A;  3AFA B;  2RVQ C;  4NFT A;  3AZN C;  5CPJ D;  3AZI B;  4DQY B;  3KUY B;  5CPJ A;  4WU9 B;  2F8N G;  4NE6 A;  5AVB B;  1N1J B;  1M19 B;  4JJN B;  4X23 A;  3LJA C;  5B31 B;  5CHL B;  5B2I C;  1H3O B;  2ARO D;  3C1B A;  1T3U A;  2NQB C;  3AN2 B;  3LZ0 D;  4G92 C;  3REK A;  1S32 C;  3W96 D;  4H9R A;  1HQ3 C;  2UWX A;  4XUJ B;  3R45 B;  3KWQ C;  5B24 C;  4KUD A;  5B40 A;  5AV8 A;  5GXQ D;  5C3I B;  3AZM C;  3C1C A;  1P34 C;  1P3K C;  1F1E A; 
#chains in the Genus database with same CATH homology
 3MNN A;  5JRG A;  1KU5 A;  4E44 A;  3AFA C;  3MGR D;  5CP6 D;  4X23 B;  4DRA A;  5DNN A;  5CP6 A;  3A6N C;  4H9S C;  3C1B B;  3AZI C;  5AY8 A;  3KUY C;  1KX5 D;  3B6G A;  3REK B;  5AV6 C;  4H9R B;  5G49 B;  3X1S B;  5B1M D;  4JJN C;  1KX4 D;  1W2E A;  3H0R C;  3W99 B;  4KUD B;  4H9O B;  5B31 C;  5B40 B;  3W98 A;  5AV8 B;  2HIO D;  3C1C B;  3AN2 C;  5B0Y D;  2HIO A;  5JRG B;  3MNN B;  2XD5 A;  3UT9 A;  5CPK D;  4ZUX A;  4J8X A;  3H0L C;  2Y2H A;  2Y2K A;  4XUJ C;  3VH5 W;  4R8P D;  2VQR A;  5DNN B;  5CP6 B;  1P3P D;  4Z66 A;  3AZH B;  3VH5 A;  3AL0 C;  5AY8 B;  5B1L C;  3MGS D;  3B6G B;  1P3M A;  2Y2M A;  4XZQ D;  3AZK D;  4XZQ A;  4X23 C;  3AZK A;  1P3A C;  3W98 B;  3B0C T;  3C1B C;  3REL C;  3UTB D;  2CV5 A;  5AV5 A;  3UTB A;  3UT9 B;  4ZUX B;  4J8X B;  1M1A D;  3X1S C;  5DNM A;  4QLC D;  1M1A A;  3W99 C;  4WZS B;  1P3I D;  4KUD C;  3REH A;  4QLC A;  5B40 C;  1JFI A;  2RVQ D;  4HGA B;  5AV8 C;  4Z66 B;  3LEL A;  1P3O D;  3C1C C;  3AZN D;  3MNN C;  1P3F A;  5JRG C;  3AZN A;  1P3M B;  2JE5 A;  4UUZ A;  3AYW A;  4XZQ B;  5DNN C;  3AZK B;  4UPK A;  2Y2G A;  2IO5 B;  3AZH C;  2CV5 B;  2FFF B;  5AY8 C;  5AV5 B;  3LJA D;  5B2I D;  4CAY A;  2ZY3 A;  2NQB D;  1U35 A;  5DNM B;  1S32 D;  1M1A B;  1HQ3 D;  5BT1 C;  3REH B;  4QLC B;  1HQ3 A;  1JFI B;  3LEL B;  3W98 C;  3KWQ D;  3AZG D;  5B24 A;  4CSR B;  1P3F B;  3VH6 T;  3AZM D;  3AZN B;  1P34 D;  2Y2L A;  4J8X C;  1P3K D;  1B6W A;  5B32 D;  4UUZ B;  1P3K A;  1M18 A;  4H9P A;  3AYW B;  3AFA D;  3X1U A;  4HGA C;  4Z66 C;  3WAA C;  3WTP E;  2Y2Q A;  5FUG A;  3A6N D;  3A1I A;  4CAY B;  3A6N A;  4H9S A;  3AZI D;  2Y2O A;  1F66 A;  3KUY D;  3AZI A;  1U35 B;  2F8N H;  5AV6 D;  2W8S A;  5AVB D;  5AV6 A;  4YM6 C;  1KX3 C;  1HQ3 B;  4JJN D;  2IO5 C;  2CV5 C;  5AV5 C;  5B31 D;  2LY8 A;  5B24 B;  5F99 A;  3AN2 D;  5DNM C;  2J8P A;  3AN2 A;  1P3K B;  4H9P B;  1M18 B;  4XUJ D;  3X1U B;  3LEL C;  5BNV A;  3R45 A;  3KXB A;  5FUG B;  1P3F C;  5CPI B;  3A6N B;  4WNN A;  1F66 B;  5B1L D;  3EG5 B;  5B1L A;  3AYW C;  5AV6 B;  4X23 D;  5AV9 C;  1P3A D;  3B0C W;  1P3A A;  2CWE A;  3C1B D;  5F99 B;  3REL A;  4Z2M G;  2F8N D;  2FJ7 A;  4J8W A;  1U35 C;  3REK D;  2F8N A;  2G5I C;  3LZ1 A;  5G49 A;  3X1S D;  5BNV B;  3W99 D;  3X1S A;  4KUD D;  5B40 D;  3KXB B;  3W99 A;  5AV8 D;  4H9O A;  5GT0 B;  3C1C D;  4WNN B;  5B0Z B;  3MNN D;  3MVD C;  5JRG D;  3EPL A;  1M18 C;  5B1L B;  1EQZ C;  3X1U C;  3MGQ A;  1P3B C;  5DNN D;  3O62 A;  1P3A B;  5CPI C;  3AZH D;  5AY8 D;  1F66 C;  3REL B;  3AZH A;  2FJ7 B;  5JA4 B;  3B6G D;  4J8W B;  4KHA A;  4WU8 C;  1Q9C A;  2F8N B;  3LZ1 B;  5B33 C;  3B6F A;  2XD1 A;  3WTP C;  5BT1 D;  3W98 D;  4AWL C;  4LD9 C;  5F99 C;  3VH6 W;  3AV2 C;  1WWS A;  1TZY B;  3UT9 D;  4ZUX D;  4J8X D;  2F8N K;  1BFM A;  2RIQ A;  1ID3 B;  3VH6 A;  3MGQ B;  3KXB C;  3O62 B;  4Z66 D;  3WAA D;  5GT0 C;  3WAA A;  5B0Z C;  4ZBJ C;  3AZE A;  5B2J C;  4KHA B;  3REJ C;  1P3M D;  3B6F B;  2BG1 A;  4YM6 D;  1KX3 D;  4YM6 A;  3TU4 A;  1KX3 A;  4H9N B;  5AV5 D;  2CV5 D;  2FJ7 C;  4J8W C;  3X1T B;  4J8V A;  3EPK A;  3LZ1 C;  3WKJ A;  5DNM D;  3X1V C;  2Y2N A;  5KDM B;  3REH D;  3LEL D;  2ZY5 A;  3WAA B;  2DQN C;  1P3F D;  1TZY C;  5GT3 A;  3AZE B;  4YS3 B;  4CSR A;  2YFW A;  3AYW D;  5AVC B;  1ID3 C;  3MGQ C;  3KFU G;  4J8U B;  3O62 C;  2BYM A;  4YM6 B;  3TU4 B;  5AV9 D;  2HUE B;  1KX3 B;  5AV9 A;  2JCH A;  2F2A C;  4J8V B;  3WKJ B;  4NE3 A;  1U35 D;  3B6F C;  2Y2I A;  2PYO A;  1BH8 A;  5B24 D;  3X1T C;  5GT3 B;  1AOI B;  3AZL C;  3W97 A;  2YFW B;  2NZD A;  1M18 D;  5BNX A;  3MVD A;  3X1U D;  1EQZ A;  2BYM B;  1P3B A;  5AV9 B;  3NQU A;  4YS3 C;  3AZE C;  5CPI D;  3F6T A;  4DRB A;  1F66 D;  5CPI A;  5AVC C;  4WU8 A;  4J8U C;  2L5A A;  3WTP D;  2Y2P A;  4G91 B;  5B32 G;  5B33 A;  3TU4 C;  2HUE C;  2PYO B;  3WTP A;  1PZR A;  1BH8 B;  5E5A C;  3AZJ C;  3UTA A;  4EO5 B;  4J8V C;  4Z5T A;  5F99 D;  4LD9 D;  3AV2 D;  3W97 B;  3WKJ C;  4LD9 A;  2NZD B;  1BH9 A;  5BNX B;  3AV2 A;  3MVD B;  3MGP B;  1EQZ B;  3AV1 A;  3KXB D;  5BS7 C;  1P3B B;  5GT3 C;  5GT0 D;  3NQU B;  1AOI C;  1ZLA B;  5GT0 A;  5B0Z D;  5B0Z A;  1Z2C B;  3REJ D;  5B31 G;  5B2J A;  4WU8 B;  2ZY4 A;  3NQJ A;  3REJ A;  5B33 B;  3WTP B;  3UTA B;  4E45 A;  4Z5T B;  5BO0 A;  3REI A;  4AWL B;  3REL D;  2FJ7 D;  4KGC B;  4LD9 B;  4J8W D;  1BH9 B;  3A1K A;  5JA4 A;  3AV2 B;  3LZ1 D;  5GSU B;  3P5J B;  4G91 C;  2G5H C;  2PYO C;  3B0B A;  3X1V D;  3AV1 B;  1R4V A;  3X1V A;  4EO5 C;  1P3O C;  1P3G B;  3AZF C;  3W97 C;  1TZY D;  2NZD C;  3EPJ A;  1TZY A;  4ZBJ B;  3WA9 C;  5B2J B;  3MGP C;  3NQJ B;  3REJ B;  1ID3 D;  3MGQ D;  1ID3 A;  1P3L C;  3O62 D;  1A7W A;  1ZLA C;  5BO0 B;  3REI B;  4M6B A;  2ARO A;  3B6F D;  3LZ0 A;  3W96 A;  3X1V B;  3UTA C;  4Z5T C;  3AZG C;  4H9Q A;  2DF4 C;  4KGC C;  4H9N A;  3X1T D;  1ULY A;  3X1T A;  3AZL D;  5GXQ A;  5GSU C;  5B32 C;  3AZL A;  5CPJ B;  3AV1 C;  5KDM A;  3B0D B;  3MGR A;  1P3G C;  3AZE D;  4YS3 D;  4YS3 A;  2ARO B;  4WU9 C;  5AVC D;  1KX5 A;  3LZ0 B;  5AVC A;  5AVB C;  4J8U D;  3W96 B;  1M19 C;  4J8U A;  3TU4 D;  1KX4 A;  4H9Q B;  5B1M A;  5E5A D;  3REI C;  3AZJ D;  5E5A A;  4J8V D;  3AZJ A;  2ZY2 A;  4WV4 B;  5GXQ B;  3WKJ D;  3AZL B;  5B0Y A;  5CPK A;  3MGR B;  4R8P A;  5GT3 D;  5BS7 A;  5C3I C;  1P3P A;  1AOI D;  1AOI A;  5CPJ C;  2YFV A;  1KX5 B;  3MGS A;  4WJ3 C;  3B0D C;  1KX4 B;  5B1M B;  2ZM5 A;  5E5A B;  3AZJ B;  2ARO C;  2HIO B;  3REK C;  3LZ0 C;  5B0Y B;  3W96 C;  5CPK B;  2PYO D;  3KSY A;  4R8P B;  1P3I A;  1P3P B;  3AZF D;  3V9R A;  5GXQ C;  1P3O A;  3W97 D;  4NE5 A;  2YFV B;  3AZF A;  2NZD D;  3MVD D;  3WA9 D;  3MGS B;  3MGP D;  3WA9 A;  3MGP A;  1EQZ D;  3MGR C;  1P3L D;  5CP6 C;  2JSS A;  1P3B D;  1P3L A;  1ZLA D;  3H0M C;  1ZLA A;  3UTB B;  3B6G C;  3LJA A;  1KX5 C;  5B2I A;  1TAF A;  4WU8 D;  2NQB A;  5B33 D;  1KX4 C;  5B1M C;  1S32 A;  3UTA D;  1P3I B;  4Z5T D;  1WWI A;  3V9R B;  1P3O B;  4KGC D;  3KWQ A;  3AZG A;  3AZF B;  2HIO C;  4Z2M H;  2BYK A;  3UT9 C;  3IP4 C;  4KGC A;  5B0Y C;  4ZUX C;  5GSU D;  3AZM A;  5CPK C;  3WA9 B;  1P34 A;  5GSU A;  5B32 A;  2Y2J A;  3AV1 D;  4R8P C;  3VH5 T;  1P3L B;  1P3P C;  3AFA A;  1P3G D;  1P3G A;  3LJA B;  5B2J D;  5B2I B;  1TAF B;  3MGS C;  1P3M C;  4WU9 D;  3KUY A;  2NQB B;  4XZQ C;  4WU9 A;  4G92 B;  3AZK C;  1S32 B;  1M19 D;  5AVB A;  1N1J A;  1M19 A;  3REI D;  4JJN A;  3KWQ B;  3UTB C;  3AZG B;  5B31 A;  2BYK B;  1B67 A;  1H3O A;  3AZM B;  1HTA A;  1P34 B;  5B32 B;  1M1A C;  3REH C;  4QLC C;  3FDD A;  1P3I C;  3EPH A;  4XUJ A;  3AFA B;  2RVQ C;  4NFT A;  3AZN C;  5CPJ D;  3AZI B;  4DQY B;  3KUY B;  5CPJ A;  4WU9 B;  2F8N G;  4NE6 A;  5AVB B;  1N1J B;  1M19 B;  4JJN B;  4X23 A;  3LJA C;  5B31 B;  5CHL B;  5B2I C;  1H3O B;  2ARO D;  3C1B A;  1T3U A;  2NQB C;  3AN2 B;  3LZ0 D;  4G92 C;  3REK A;  1S32 C;  3W96 D;  4H9R A;  1HQ3 C;  2UWX A;  4XUJ B;  3R45 B;  3KWQ C;  5B24 C;  4KUD A;  5B40 A;  5AV8 A;  5GXQ D;  5C3I B;  3AZM C;  3C1C A;  1P34 C;  1P3K C;  1F1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...