3MGSC

Binding of cesium ions to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
b'KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsC00
4XZQA 3MGQD 3LZ1A 5BT1C 1AOIB 3W99D 3O62D 4LD9B 5GT3D 1P3BD 3AZEA 1P3AC 3AZGA 3WAAB 5GT0C 1M1AA 4LD9D 5B31G 4JJNC 5B32G 2NZDA 1EQZA 4XUJA 4QLCD 4EO5B 3B6GC 3KUYC 4Z2MG 4ZBJC 4H9PB 4WU8B 1HQ3C 4Z5TB 1P3IB 4J8VC 5B31A 4J8XB 5JRGC 5B1LA 3AZLA 1U35B 5B32A 4KHAB 5CPIA 4Z5TD 4WU9A 5CPKD 1P3ID 1P3OA 1KX3A 3AYWA 3AZMB 3W97B 1U35D 3MGPC 3X1TC 3X1UA 4KUDB 3NQUA 2FJ7B 4X23C 2BYMB 1P3MA 3UTBB 1P34D 5B0YB 4XZQB 3VH5A 3W97D 3REKD 3MNNA 3LZ1B 5E5AD 2CV5C 5AV6A 2FJ7D 5AY8A 3LZ0A 3AZEB 3UTBD 4XZQD 1P3LD 3AZGB 1ID3D 3X1SC 3LZ1D 4KGCB 1M1AB 2PYOD 3KXBA 3REJA 5F99A 3MVDD 3AZED 5JA4A 3B0DC 3LJAA 3X1VA 3WTPC 1EQZB 4XUJB 1M1AD 1M19C 3WKJD 4R8PD 2L5AA 5AVBC 5BNVA 3AZIC 3C1CA 3AZJA 2NZDD 1EQZD 5B0ZD 3B6FC 4XUJD 5AV5A 5B31B 3REHC 4H9SA 1JFIA 5B1LB 3UTAC 3AZLB 5B32B 3W99A 5CPIB 1P3BA 4WU9B 5GSUA 5AV9D 3AZLD 5B32D 5B2ID 3X1UB 1P3PA 2AROC 5C3IB 3NQUB 5GXQC 4WU9D 1P3OD 1KX3D 3A6NA 1P3MB 3AYWD 3TU4A 5AV8A 3W98A 4DRAA 3AZND 5DNNC 1Q9CA 4M6BA 3MNNB 4QLCA 1F66A 5AV6B 3X1UD 1M18A 5AY8B 2BYKB 3LZ0B 1P3MD 5B24C 1S32C 5DNMA 2HUEB 4YM6C 5B33C 4H9NA 3MNND 5B2JB 5AV6D 3W96C 1KX4B 5AY8D 5F99B 3REJB 3KSYA 5JA4B 3AZHB 3MGQC 3LJAB 3X1VB 3O62C 3MGRC 5GT3C 3KXBD 5F99D 5B40B 5BNVB 2NQBD 1AOIC 5FUGA 3LJAD 3X1VD 4LD9C 3C1CB 3AZJB 4NE5A 5AV5B 1P34A 4Z66D 3WAAC 3REKA 4ZUXD 1JFIB 5E5AA 3W99B 3AZJD 1P3BB 2HIOC 1ULYA 1P3KA 1P3LA 5GSUB 4J8UA 1ID3A 4H9QA 4EO5C 2PYOA 1P3FA 3B0CT 1P3PB 3MVDA 4JJNA 1A7WA 3A6NB 1HTAA 3TU4B 5GSUD 5BNXB 4WU8C 4YS3D 3B6GA 3C1BA 3W98B 4UUZA 4Z5TC 4QLCB 1P3IC 1F66B 3WKJA 1P3PD 1M18B 4R8PA 3RELC 4J8XC 3A6ND 3TU4D 5AV8D 3KWQA 5DNMB 1U35C 1HQ3A 3W98D 3AV1A 1TZYC 4H9NB 5B0ZA 3AZFA 1F66D 4G92C 3AFAA 1M18D 3UT9A 1KX5D 3AZMC 4Z2MH 3B0BA 3W97C 5DNMD 5CPKB 4KUDC 3WA9D 5CP6A 3UTBC 2F8NH 4CAYA 5B0YC 4XZQC 4H9RA 5AV9A 3MGPA 3LZ1C 5B2IA 3AN2A 4J8WA 1P34B 4G91B 3AZGC 5G49A 5CHLB 3REKB 3AZNA 5E5AB 4WNNB 3AV2A 4KGCC 1M1AC 4E45A 3MGSC 1P3KB 1P3LB 5BT1D 4J8UB 1ID3B 1EQZC 4H9QB 4XUJC 2PYOB 1P3FB 3MVDB 4JJNB 1P3KD 4J8UD 5GT0D 4H9OA 3C1BB 3B6GB 4UUZB 4E44A 1P3FD 3WKJB 3AZKA 4R8PB 4JJND 5B31C 5B1LC 2NQBA 3AZLC 3KWQB 5B32C 1HQ3B 3B6GD 3C1BD 3AV1B 5CPIC 2YFWA 5B0ZB 3AZFB 4WU9C 1P3GA 2NZDB 3KUYD 3AFAB 3UT9B 4Z66A 5AVCC 2RVQD 4ZUXA 3KWQD 3R45A 1HQ3D 3X1UC 3AV1D 5C3IC 3AZFD 5CPJA 3AFAD 5CP6B 1P3MC 3UT9D 4CAYB 5AV9B 4H9RB 3MNNC 5B2IB 5GXQA 5AV6C 3AN2B 4J8WB 4AWLB 1P3OB 1KX3B 5AY8C 3LZ0C 5CP6D 3AYWB 5DNNA 2HUEC 3MGPD 4YS3A 3AZNB 3X1TD 5B2JC 3AV2B 3AN2D 4J8WD 1KX4C 3REJC 5F99C 3AZHC 5B33A 2CV5D 3X1VC 4KUDA 3AV2D 1KX5A 2F8NK 3NQJA 5B40C 4NE6A 4NE3A 3C1CC 4H9OB 3AZJC 5B1MA 3WA9A 3KXBB 5AV5C 3AZKB 1WWIA 1AOIA 5BS7C 1ZLAA 2NQBB 3V9RA 3W99C 1TAFA 1P3BC 1P3GB 5AVBD 3AZKD 3WAAA 5GSUC 4Z66B 3AZID 4ZUXB 3LELA 3REIA 3R45B 4NFTA 3B6FD 1P3PC 2HIOA 5CPJB 1P3GD 3A6NC 3TU4C 1KU5A 4WV4B 3W98C 5GXQB 4QLCC 1F66C 5CPJD 1M18C 1P3AA 5GT0A 4YS3B 4WZSB 5GXQD 3RELA 1H3OA 5AV8B 5DNND 1TZYA 5CPKC 3KUYA 2YFVA 1KX5B 1S32D 3B0CW 5B33D 2IO5B 5B1MB 4J8VA 3WA9B 5JRGA 1P34C 4G91C 3REKC 1ZLAB 5E5AC 3MGRD 3V9RB 2FJ7C 1TAFB 5B1MD 1N1JA 1P3KC 1P3LC 3VH6A 4J8UC 3X1TA 1ID3C 1AOID 1ZLAD 4KGCA 3LELB 5BO0A 5FUGB 4X23A 3REIB 4HGAB 2PYOC 1P3FC 2HIOB 3MGSA 3MVDC 3AZEC 3WAAD 2CV5A 3LELD 3C1BC 3REID 3WKJC 2HIOD 4R8PC 1P3AB 2RVQC 3X1SA 3KWQC 5GT0B 3AV1C 2NZDC 5B0ZC 3AZFC 2F8NG 3AFAC 3RELB 1H3OB 3UT9C 1P3AD 4WU8D 1TZYB 3WTPA 4G92B 1M19A 3KUYB 2YFVB 5CP6C 5AVBA 5AVCA 4J8XD 3RELD 3AZIA 5KDMA 4ZBJB 5AV9C 1TZYD 5B2IC 3B6FA 3AN2C 4J8WC 4AWLC 1P3OC 1KX3C 4J8VB 3REHA 3AZMD 5JRGB 3AYWC 2F8NA 3UTAA 3AZNC 1BH8A 4KUDD 3AV2C 2BYKA 4J8VD 1WWSA 5B0YD 1N1JB 2LY8A 5JRGD 3MGPB 5B2JA 3X1TB 2AROA 1BH9A 5BO0B 4X23B 1KX4A 3AZHA 3MGSB 3AZGD 4CSRA 2CV5B 5G49B 3VH6T 4KGCD 4X23D 3KXBC 5B40A 5B24A 3MGSD 3AZKC 1S32A 4YM6A 2NQBC 3X1SB 4DRBA 3LJAC 3W96A 1P3GC 3VH6W 3B0DB 5BS7A 3MGQA 4Z66C 3WTPE 4ZUXC 3X1SD 3O62A 3MGRA 5GT3A 3WTPB 1M19B 5CPJC 5B31D 5AVBB 5AVCB 3AZIB 5B1LD 5KDMB 4H9SC 4LD9A 3WTPD 5CPID 3B6FB 1B67A 2YFWB 1M19D 5AVCD 5BNXA 3REHB 2F8NB 3UTAB 1B6WA 4YS3C 1BH8B 3REHD 2F8ND 1BFMA 5AV8C 3UTAD 3VH5T 2AROB 1BH9B 3LZ0D 1KX5C 4H9PA 1F1EA 5DNMC 4WU8A 5DNNB 4CSRB 5CPKA 4Z5TA 5B2JD 2IO5C 1P3IA 2AROD 5B1MC 3WA9C 1R4VA 4J8XA 3REJD 1KX4D 2CWEA 3VH5W 5B24B 3AZHD 1S32B 1U35A 4YM6B 2JSSA 5B33B 1ZLAC 4KHAA 3W96B 3AZMA 5B40D 5B24D 3W97A 3NQJB 3MGQB 4WNNA 4YM6D 3O62B 3LELC 3MGRB 3C1CD 3REIC 2BYMA 5GT3B 2FJ7A 4HGAC 3W96D 3UTBA 5AV5D 5B0YA
chains in the Genus database with same CATH superfamily
4XZQA 3MGQD 3LZ1A 5BT1C 1AOIB 3W99D 3O62D 4LD9B 5GT3D 1P3BD 3H0MC 3AZEA 1P3AC 3AZGA 3WAAB 2VQRA 5GT0C 1M1AA 4LD9D 5B31G 4JJNC 5B32G 2NZDA 1EQZA 4XUJA 4QLCD 4EO5B 3B6GC 3KUYC 4Z2MG 4ZBJC 4H9PB 4WU8B 1HQ3C 4Z5TB 1P3IB 4J8VC 5B31A 4J8XB 2Y2JA 5JRGC 3A1IA 5B1LA 3AZLA 1U35B 5B32A 4KHAB 5CPIA 4Z5TD 4WU9A 5CPKD 1P3ID 1P3OA 1KX3A 3AYWA 3AZMB 3W97B 1U35D 3MGPC 3X1TC 3X1UA 2Y2IA 4KUDB 3NQUA 2FJ7B 4X23C 2BYMB 2ZY5A 1P3MA 3UTBB 1P34D 5B0YB 4XZQB 3VH5A 3W97D 3REKD 3MNNA 3LZ1B 5E5AD 2CV5C 2Y2NA 5AV6A 2FJ7D 5AY8A 3LZ0A 3AZEB 3UTBD 4XZQD 1P3LD 4UPKA 3AZGB 1ID3D 3X1SC 3LZ1D 4KGCB 1M1AB 2PYOD 3KXBA 3REJA 5F99A 3MVDD 3AZED 5JA4A 3B0DC 3LJAA 3X1VA 3WTPC 1EQZB 4XUJB 1M1AD 1M19C 3WKJD 4R8PD 2L5AA 5AVBC 5BNVA 3AZIC 3C1CA 3AZJA 2NZDD 1EQZD 5B0ZD 3B6FC 4XUJD 5AV5A 5B31B 3REHC 4H9SA 1JFIA 5B1LB 3UTAC 3AZLB 5B32B 3W99A 5CPIB 1P3BA 4WU9B 2BG1A 5GSUA 5AV9D 3AZLD 5B32D 5B2ID 3X1UB 1P3PA 2AROC 2G5HC 3NQUB 5C3IB 5GXQC 4WU9D 1P3OD 1KX3D 3A6NA 1P3MB 3AYWD 3TU4A 5AV8A 3W98A 4DRAA 3AZND 5DNNC 1Q9CA 4M6BA 3MNNB 4QLCA 1F66A 5AV6B 3X1UD 1M18A 5AY8B 2BYKB 3LZ0B 4DQYB 1P3MD 5B24C 1S32C 5DNMA 2HUEB 4YM6C 5B33C 4H9NA 3MNND 5B2JB 5AV6D 3W96C 1KX4B 5AY8D 5F99B 3REJB 3KSYA 5JA4B 3AZHB 3MGQC 3LJAB 3X1VB 3O62C 3MGRC 5GT3C 3KFUG 3KXBD 5F99D 5B40B 5BNVB 2NQBD 1AOIC 5FUGA 3LJAD 3X1VD 4LD9C 3C1CB 3AZJB 4NE5A 5AV5B 1P34A 4Z66D 3WAAC 3REKA 4ZUXD 1JFIB 5E5AA 3W99B 3AZJD 1P3BB 2Y2KA 2HIOC 1ULYA 1P3KA 1P3LA 5GSUB 4J8UA 1ID3A 4H9QA 4EO5C 2PYOA 1P3FA 3B0CT 1P3PB 3MVDA 4JJNA 1A7WA 3A6NB 1HTAA 3TU4B 5GSUD 5BNXB 4WU8C 4YS3D 3B6GA 3C1BA 3W98B 4UUZA 4Z5TC 4QLCB 1P3IC 1F66B 3WKJA 1P3PD 1M18B 4R8PA 2DQNC 3RELC 4J8XC 3A6ND 3TU4D 5AV8D 3KWQA 5DNMB 1U35C 1HQ3A 3W98D 3AV1A 1TZYC 4H9NB 5B0ZA 3AZFA 1F66D 4G92C 3AFAA 1M18D 3UT9A 1KX5D 3AZMC 4Z2MH 3B0BA 3W97C 5DNMD 5CPKB 4KUDC 3WA9D 5CP6A 3UTBC 2F8NH 4CAYA 5B0YC 4XZQC 4H9RA 5AV9A 3MGPA 3LZ1C 5B2IA 3AN2A 4J8WA 1P34B 4G91B 3AZGC 5G49A 5CHLB 3REKB 3AZNA 5E5AB 4WNNB 3AV2A 4KGCC 1M1AC 4E45A 3MGSC 1P3KB 1P3LB 5BT1D 4J8UB 1ID3B 1EQZC 4H9QB 4XUJC 2Y2OA 2PYOB 1P3FB 2Y2HA 2ZY3A 3MVDB 3H0LC 4JJNB 1P3KD 4J8UD 5GT0D 4H9OA 3H0RC 3C1BB 4UUZB 3B6GB 4E44A 1P3FD 3WKJB 3AZKA 4R8PB 4JJND 5B31C 5B1LC 2NQBA 3AZLC 3KWQB 5B32C 1HQ3B 3B6GD 3C1BD 3AV1B 5CPIC 2YFWA 5B0ZB 3AZFB 4WU9C 1P3GA 2NZDB 3KUYD 3AFAB 3UT9B 4Z66A 5AVCC 2RVQD 4ZUXA 3KWQD 3R45A 1HQ3D 3X1UC 3AV1D 5C3IC 3AZFD 5CPJA 3AFAD 5CP6B 1P3MC 3UT9D 2Y2QA 4CAYB 5AV9B 4H9RB 3MNNC 5B2IB 5GXQA 1W2EA 5AV6C 3AN2B 4J8WB 4AWLB 1P3OB 1KX3B 5AY8C 3LZ0C 5CP6D 3AYWB 5DNNA 2HUEC 3MGPD 4YS3A 3AZNB 3X1TD 5B2JC 3AV2B 3AN2D 3A1KA 4J8WD 1KX4C 2ZY2A 5F99C 3REJC 3AZHC 5B33A 2Y2MA 2CV5D 3X1VC 4KUDA 3AV2D 2Y2PA 1KX5A 2F8NK 1PZRA 3NQJA 5B40C 4NE6A 4NE3A 2XD5A 3C1CC 4H9OB 3AZJC 5B1MA 3WA9A 3KXBB 5AV5C 3AZKB 1WWIA 2JCHA 1AOIA 5BS7C 1ZLAA 2W8SA 2NQBB 3V9RA 3W99C 1TAFA 1P3BC 1P3GB 5AVBD 3AZKD 3WAAA 5GSUC 4Z66B 3AZID 4ZUXB 3LELA 3REIA 3R45B 4NFTA 2ZY4A 3B6FD 1P3PC 2HIOA 5CPJB 1P3GD 3A6NC 2G5IC 1KU5A 3TU4C 3EPKA 4WV4B 3W98C 5GXQB 4QLCC 1F66C 5CPJD 1M18C 1P3AA 3P5JB 3AL0C 5GT0A 2FFFB 4YS3B 4WZSB 5GXQD 3RELA 1H3OA 5AV8B 5DNND 1TZYA 5CPKC 3KUYA 2YFVA 1KX5B 1S32D 3B0CW 5B33D 2IO5B 3EPHA 5B1MB 4J8VA 3WA9B 5JRGA 1P34C 4G91C 3REKC 1ZLAB 2JE5A 5E5AC 3MGRD 3V9RB 2FJ7C 1TAFB 5B1MD 1N1JA 1P3KC 1P3LC 3VH6A 4J8UC 3X1TA 2UWXA 1ID3C 1AOID 1ZLAD 3LELB 4KGCA 5BO0A 5FUGB 4X23A 3REIB 4HGAB 2PYOC 1P3FC 2HIOB 3MGSA 3MVDC 2Y2LA 3AZEC 3WAAD 2CV5A 3LELD 3C1BC 3REID 2F2AC 3WKJC 2HIOD 2Y2GA 4R8PC 1P3AB 2RVQC 3X1SA 3KWQC 5GT0B 3AV1C 2NZDC 5B0ZC 3AZFC 2F8NG 3AFAC 3RELB 1H3OB 3UT9C 1P3AD 1T3UA 4WU8D 1TZYB 3WTPA 4G92B 1M19A 3KUYB 2YFVB 5CP6C 5AVBA 2RIQA 5AVCA 4J8XD 3RELD 3AZIA 5KDMA 4ZBJB 5AV9C 1TZYD 5B2IC 3B6FA 3AN2C 4J8WC 4AWLC 1P3OC 1KX3C 4J8VB 3EG5B 3REHA 3AZMD 5JRGB 3AYWC 2F8NA 3UTAA 3AZNC 1BH8A 4KUDD 3AV2C 3IP4C 2BYKA 4J8VD 1WWSA 5B0YD 1N1JB 2LY8A 5JRGD 4WJ3C 2XD1A 3MGPB 5B2JA 3X1TB 2AROA 1BH9A 5BO0B 4X23B 1KX4A 3AZHA 3MGSB 3AZGD 4CSRA 2CV5B 5G49B 3VH6T 4KGCD 4X23D 3KXBC 5B40A 5B24A 3MGSD 3AZKC 1S32A 1Z2CB 4YM6A 2NQBC 3X1SB 4DRBA 3LJAC 3W96A 2J8PA 1P3GC 3VH6W 3B0DB 5BS7A 3MGQA 4Z66C 3WTPE 4ZUXC 3X1SD 3O62A 3MGRA 5GT3A 3WTPB 1M19B 5CPJC 5B31D 5AVBB 5AVCB 3FDDA 5B1LD 3AZIB 5KDMB 4H9SC 4LD9A 3WTPD 5CPID 3B6FB 1B67A 2YFWB 1M19D 2ZM5A 5AVCD 5BNXA 3REHB 3EPLA 2F8NB 3UTAB 1B6WA 4YS3C 1BH8B 3F6TA 2DF4C 3EPJA 3REHD 2F8ND 1BFMA 5AV8C 3UTAD 3VH5T 2AROB 1BH9B 3LZ0D 1KX5C 4H9PA 1F1EA 5DNMC 4WU8A 5DNNB 4CSRB 5CPKA 4Z5TA 5B2JD 2IO5C 1P3IA 2AROD 5B1MC 3WA9C 1R4VA 4J8XA 3REJD 1KX4D 2CWEA 3VH5W 5B24B 3AZHD 1S32B 1U35A 4YM6B 2JSSA 5B33B 1ZLAC 4KHAA 3W96B 3AZMA 5B40D 5B24D 3W97A 3NQJB 3MGQB 4WNNA 4YM6D 3O62B 3LELC 3MGRB 3C1CD 3REIC 2BYMA 5GT3B 2FJ7A 4HGAC 3W96D 3UTBA 5AV5D 5B0YA
chains in the Genus database with same CATH topology
4XZQA 3MGQD 3LZ1A 5BT1C 1AOIB 3W99D 3O62D 4LD9B 5GT3D 1P3BD 3H0MC 3AZEA 1P3AC 3AZGA 3WAAB 2VQRA 5GT0C 1M1AA 4LD9D 5B31G 4JJNC 5B32G 2NZDA 1EQZA 4XUJA 4QLCD 4EO5B 3B6GC 3KUYC 4Z2MG 4ZBJC 4H9PB 4WU8B 1HQ3C 4Z5TB 1P3IB 4J8VC 5B31A 4J8XB 2Y2JA 5JRGC 3A1IA 5B1LA 3AZLA 1U35B 5B32A 4KHAB 5CPIA 4Z5TD 4WU9A 5CPKD 1P3ID 1P3OA 1KX3A 3AYWA 3AZMB 3W97B 1U35D 3MGPC 3X1TC 3X1UA 2Y2IA 4KUDB 3NQUA 2FJ7B 4X23C 2BYMB 2ZY5A 1P3MA 3UTBB 1P34D 5B0YB 4XZQB 3VH5A 3W97D 3REKD 3MNNA 3LZ1B 5E5AD 2CV5C 2Y2NA 5AV6A 2FJ7D 5AY8A 3LZ0A 3AZEB 3UTBD 4XZQD 1P3LD 4UPKA 3AZGB 1ID3D 3X1SC 3LZ1D 4KGCB 1M1AB 2PYOD 3KXBA 3REJA 5F99A 3MVDD 3AZED 5JA4A 3B0DC 3LJAA 3X1VA 3WTPC 1EQZB 4XUJB 1M1AD 1M19C 3WKJD 4R8PD 2L5AA 5AVBC 5BNVA 3AZIC 3C1CA 3AZJA 2NZDD 1EQZD 5B0ZD 3B6FC 4XUJD 5AV5A 5B31B 3REHC 4H9SA 1JFIA 5B1LB 3UTAC 3AZLB 5B32B 3W99A 5CPIB 1P3BA 4WU9B 2BG1A 5GSUA 5AV9D 3AZLD 5B32D 5B2ID 3X1UB 1P3PA 2AROC 2G5HC 3NQUB 5C3IB 5GXQC 4WU9D 1P3OD 1KX3D 3A6NA 1P3MB 3AYWD 3TU4A 5AV8A 3W98A 4DRAA 3AZND 5DNNC 1Q9CA 4M6BA 3MNNB 4QLCA 1F66A 5AV6B 3X1UD 1M18A 5AY8B 2BYKB 3LZ0B 4DQYB 1P3MD 5B24C 1S32C 5DNMA 2HUEB 4YM6C 5B33C 4H9NA 3MNND 5B2JB 5AV6D 3W96C 1KX4B 5AY8D 5F99B 3REJB 3KSYA 5JA4B 3AZHB 3MGQC 3LJAB 3X1VB 3O62C 3MGRC 5GT3C 3KFUG 3KXBD 5F99D 5B40B 5BNVB 2NQBD 1AOIC 5FUGA 3LJAD 3X1VD 4LD9C 3C1CB 3AZJB 4NE5A 5AV5B 1P34A 4Z66D 3WAAC 3REKA 4ZUXD 1JFIB 5E5AA 3W99B 3AZJD 1P3BB 2Y2KA 2HIOC 1ULYA 1P3KA 1P3LA 5GSUB 4J8UA 1ID3A 4H9QA 4EO5C 2PYOA 1P3FA 3B0CT 1P3PB 3MVDA 4JJNA 1A7WA 3A6NB 1HTAA 3TU4B 5GSUD 5BNXB 4WU8C 4YS3D 3B6GA 3C1BA 3W98B 4UUZA 4Z5TC 4QLCB 1P3IC 1F66B 3WKJA 1P3PD 1M18B 4R8PA 2DQNC 3RELC 4J8XC 3A6ND 3TU4D 5AV8D 3KWQA 5DNMB 1U35C 1HQ3A 3W98D 3AV1A 1TZYC 4H9NB 5B0ZA 3AZFA 1F66D 4G92C 3AFAA 1M18D 3UT9A 1KX5D 3AZMC 4Z2MH 3B0BA 3W97C 5DNMD 5CPKB 4KUDC 3WA9D 5CP6A 3UTBC 2F8NH 4CAYA 5B0YC 4XZQC 4H9RA 5AV9A 3MGPA 3LZ1C 5B2IA 3AN2A 4J8WA 1P34B 4G91B 3AZGC 5G49A 5CHLB 3REKB 3AZNA 5E5AB 4WNNB 3AV2A 4KGCC 1M1AC 4E45A 3MGSC 1P3KB 1P3LB 5BT1D 4J8UB 1ID3B 1EQZC 4H9QB 4XUJC 2Y2OA 2PYOB 1P3FB 2Y2HA 2ZY3A 3MVDB 3H0LC 4JJNB 1P3KD 4J8UD 5GT0D 4H9OA 3H0RC 3C1BB 4UUZB 3B6GB 4E44A 1P3FD 3WKJB 3AZKA 4R8PB 4JJND 5B31C 5B1LC 2NQBA 3AZLC 3KWQB 5B32C 1HQ3B 3B6GD 3C1BD 3AV1B 5CPIC 2YFWA 5B0ZB 3AZFB 4WU9C 1P3GA 2NZDB 3KUYD 3AFAB 3UT9B 4Z66A 5AVCC 2RVQD 4ZUXA 3KWQD 3R45A 1HQ3D 3X1UC 3AV1D 5C3IC 3AZFD 5CPJA 3AFAD 5CP6B 1P3MC 3UT9D 2Y2QA 4CAYB 5AV9B 4H9RB 3MNNC 5B2IB 5GXQA 1W2EA 5AV6C 3AN2B 4J8WB 4AWLB 1P3OB 1KX3B 5AY8C 3LZ0C 5CP6D 3AYWB 5DNNA 2HUEC 3MGPD 4YS3A 3AZNB 3X1TD 5B2JC 3AV2B 3AN2D 3A1KA 4J8WD 1KX4C 2ZY2A 5F99C 3REJC 3AZHC 5B33A 2Y2MA 2CV5D 3X1VC 4KUDA 3AV2D 2Y2PA 1KX5A 2F8NK 1PZRA 3NQJA 5B40C 4NE6A 4NE3A 2XD5A 3C1CC 4H9OB 3AZJC 5B1MA 3WA9A 3KXBB 5AV5C 3AZKB 1WWIA 2JCHA 1AOIA 5BS7C 1ZLAA 2W8SA 2NQBB 3V9RA 3W99C 1TAFA 1P3BC 1P3GB 5AVBD 3AZKD 3WAAA 5GSUC 4Z66B 3AZID 4ZUXB 3LELA 3REIA 3R45B 4NFTA 2ZY4A 3B6FD 1P3PC 2HIOA 5CPJB 1P3GD 3A6NC 2G5IC 1KU5A 3TU4C 3EPKA 4WV4B 3W98C 5GXQB 4QLCC 1F66C 5CPJD 1M18C 1P3AA 3P5JB 3AL0C 5GT0A 2FFFB 4YS3B 4WZSB 5GXQD 3RELA 1H3OA 5AV8B 5DNND 1TZYA 5CPKC 3KUYA 2YFVA 1KX5B 1S32D 3B0CW 5B33D 2IO5B 3EPHA 5B1MB 4J8VA 3WA9B 5JRGA 1P34C 4G91C 3REKC 1ZLAB 2JE5A 5E5AC 3MGRD 3V9RB 2FJ7C 1TAFB 5B1MD 1N1JA 1P3KC 1P3LC 3VH6A 4J8UC 3X1TA 2UWXA 1ID3C 1AOID 1ZLAD 3LELB 4KGCA 5BO0A 5FUGB 4X23A 3REIB 4HGAB 2PYOC 1P3FC 2HIOB 3MGSA 3MVDC 2Y2LA 3AZEC 3WAAD 2CV5A 3LELD 3C1BC 3REID 2F2AC 3WKJC 2HIOD 2Y2GA 4R8PC 1P3AB 2RVQC 3X1SA 3KWQC 5GT0B 3AV1C 2NZDC 5B0ZC 3AZFC 2F8NG 3AFAC 3RELB 1H3OB 3UT9C 1P3AD 1T3UA 4WU8D 1TZYB 3WTPA 4G92B 1M19A 3KUYB 2YFVB 5CP6C 5AVBA 2RIQA 5AVCA 4J8XD 3RELD 3AZIA 5KDMA 4ZBJB 5AV9C 1TZYD 5B2IC 3B6FA 3AN2C 4J8WC 4AWLC 1P3OC 1KX3C 4J8VB 3EG5B 3REHA 3AZMD 5JRGB 3AYWC 2F8NA 3UTAA 3AZNC 1BH8A 4KUDD 3AV2C 3IP4C 2BYKA 4J8VD 1WWSA 5B0YD 1N1JB 2LY8A 5JRGD 4WJ3C 2XD1A 3MGPB 5B2JA 3X1TB 2AROA 1BH9A 5BO0B 4X23B 1KX4A 3AZHA 3MGSB 3AZGD 4CSRA 2CV5B 5G49B 3VH6T 4KGCD 4X23D 3KXBC 5B40A 5B24A 3MGSD 3AZKC 1S32A 1Z2CB 4YM6A 2NQBC 3X1SB 4DRBA 3LJAC 3W96A 2J8PA 1P3GC 3VH6W 3B0DB 5BS7A 3MGQA 4Z66C 3WTPE 4ZUXC 3X1SD 3O62A 3MGRA 5GT3A 3WTPB 1M19B 5CPJC 5B31D 5AVBB 5AVCB 3FDDA 5B1LD 3AZIB 5KDMB 4H9SC 4LD9A 3WTPD 5CPID 3B6FB 1B67A 2YFWB 1M19D 2ZM5A 5AVCD 5BNXA 3REHB 3EPLA 2F8NB 3UTAB 1B6WA 4YS3C 1BH8B 3F6TA 2DF4C 3EPJA 3REHD 2F8ND 1BFMA 5AV8C 3UTAD 3VH5T 2AROB 1BH9B 3LZ0D 1KX5C 4H9PA 1F1EA 5DNMC 4WU8A 5DNNB 4CSRB 5CPKA 4Z5TA 5B2JD 2IO5C 1P3IA 2AROD 5B1MC 3WA9C 1R4VA 4J8XA 3REJD 1KX4D 2CWEA 3VH5W 5B24B 3AZHD 1S32B 1U35A 4YM6B 2JSSA 5B33B 1ZLAC 4KHAA 3W96B 3AZMA 5B40D 5B24D 3W97A 3NQJB 3MGQB 4WNNA 4YM6D 3O62B 3LELC 3MGRB 3C1CD 3REIC 2BYMA 5GT3B 2FJ7A 4HGAC 3W96D 3UTBA 5AV5D 5B0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ A;  3MGQ D;  3LZ1 A;  5BT1 C;  1AOI B;  3W99 D;  3O62 D;  4LD9 B;  5GT3 D;  1P3B D;  3AZE A;  1P3A C;  3AZG A;  3WAA B;  5GT0 C;  1M1A A;  4LD9 D;  5B31 G;  4JJN C;  5B32 G;  2NZD A;  1EQZ A;  4XUJ A;  4QLC D;  4EO5 B;  3B6G C;  3KUY C;  4Z2M G;  4ZBJ C;  4H9P B;  4WU8 B;  1HQ3 C;  4Z5T B;  1P3I B;  4J8V C;  5B31 A;  4J8X B;  5JRG C;  5B1L A;  3AZL A;  1U35 B;  5B32 A;  4KHA B;  5CPI A;  4Z5T D;  4WU9 A;  5CPK D;  1P3I D;  1P3O A;  1KX3 A;  3AYW A;  3AZM B;  3W97 B;  1U35 D;  3MGP C;  3X1T C;  3X1U A;  4KUD B;  3NQU A;  2FJ7 B;  4X23 C;  2BYM B;  1P3M A;  3UTB B;  1P34 D;  5B0Y B;  4XZQ B;  3VH5 A;  3W97 D;  3REK D;  3MNN A;  3LZ1 B;  5E5A D;  2CV5 C;  5AV6 A;  2FJ7 D;  5AY8 A;  3LZ0 A;  3AZE B;  3UTB D;  4XZQ D;  1P3L D;  3AZG B;  1ID3 D;  3X1S C;  3LZ1 D;  4KGC B;  1M1A B;  2PYO D;  3KXB A;  3REJ A;  5F99 A;  3MVD D;  3AZE D;  5JA4 A;  3B0D C;  3LJA A;  3X1V A;  3WTP C;  1EQZ B;  4XUJ B;  1M1A D;  1M19 C;  3WKJ D;  4R8P D;  2L5A A;  5AVB C;  5BNV A;  3AZI C;  3C1C A;  3AZJ A;  2NZD D;  1EQZ D;  5B0Z D;  3B6F C;  4XUJ D;  5AV5 A;  5B31 B;  3REH C;  4H9S A;  1JFI A;  5B1L B;  3UTA C;  3AZL B;  5B32 B;  3W99 A;  5CPI B;  1P3B A;  4WU9 B;  5GSU A;  5AV9 D;  3AZL D;  5B32 D;  5B2I D;  3X1U B;  1P3P A;  2ARO C;  5C3I B;  3NQU B;  5GXQ C;  4WU9 D;  1P3O D;  1KX3 D;  3A6N A;  1P3M B;  3AYW D;  3TU4 A;  5AV8 A;  3W98 A;  4DRA A;  3AZN D;  5DNN C;  1Q9C A;  4M6B A;  3MNN B;  4QLC A;  1F66 A;  5AV6 B;  3X1U D;  1M18 A;  5AY8 B;  2BYK B;  3LZ0 B;  1P3M D;  5B24 C;  1S32 C;  5DNM A;  2HUE B;  4YM6 C;  5B33 C;  4H9N A;  3MNN D;  5B2J B;  5AV6 D;  3W96 C;  1KX4 B;  5AY8 D;  5F99 B;  3REJ B;  3KSY A;  5JA4 B;  3AZH B;  3MGQ C;  3LJA B;  3X1V B;  3O62 C;  3MGR C;  5GT3 C;  3KXB D;  5F99 D;  5B40 B;  5BNV B;  2NQB D;  1AOI C;  5FUG A;  3LJA D;  3X1V D;  4LD9 C;  3C1C B;  3AZJ B;  4NE5 A;  5AV5 B;  1P34 A;  4Z66 D;  3WAA C;  3REK A;  4ZUX D;  1JFI B;  5E5A A;  3W99 B;  3AZJ D;  1P3B B;  2HIO C;  1ULY A;  1P3K A;  1P3L A;  5GSU B;  4J8U A;  1ID3 A;  4H9Q A;  4EO5 C;  2PYO A;  1P3F A;  3B0C T;  1P3P B;  3MVD A;  4JJN A;  1A7W A;  3A6N B;  1HTA A;  3TU4 B;  5GSU D;  5BNX B;  4WU8 C;  4YS3 D;  3B6G A;  3C1B A;  3W98 B;  4UUZ A;  4Z5T C;  4QLC B;  1P3I C;  1F66 B;  3WKJ A;  1P3P D;  1M18 B;  4R8P A;  3REL C;  4J8X C;  3A6N D;  3TU4 D;  5AV8 D;  3KWQ A;  5DNM B;  1U35 C;  1HQ3 A;  3W98 D;  3AV1 A;  1TZY C;  4H9N B;  5B0Z A;  3AZF A;  1F66 D;  4G92 C;  3AFA A;  1M18 D;  3UT9 A;  1KX5 D;  3AZM C;  4Z2M H;  3B0B A;  3W97 C;  5DNM D;  5CPK B;  4KUD C;  3WA9 D;  5CP6 A;  3UTB C;  2F8N H;  4CAY A;  5B0Y C;  4XZQ C;  4H9R A;  5AV9 A;  3MGP A;  3LZ1 C;  5B2I A;  3AN2 A;  4J8W A;  1P34 B;  4G91 B;  3AZG C;  5G49 A;  5CHL B;  3REK B;  3AZN A;  5E5A B;  4WNN B;  3AV2 A;  4KGC C;  1M1A C;  4E45 A;  3MGS C;  1P3K B;  1P3L B;  5BT1 D;  4J8U B;  1ID3 B;  1EQZ C;  4H9Q B;  4XUJ C;  2PYO B;  1P3F B;  3MVD B;  4JJN B;  1P3K D;  4J8U D;  5GT0 D;  4H9O A;  3C1B B;  3B6G B;  4UUZ B;  4E44 A;  1P3F D;  3WKJ B;  3AZK A;  4R8P B;  4JJN D;  5B31 C;  5B1L C;  2NQB A;  3AZL C;  3KWQ B;  5B32 C;  1HQ3 B;  3B6G D;  3C1B D;  3AV1 B;  5CPI C;  2YFW A;  5B0Z B;  3AZF B;  4WU9 C;  1P3G A;  2NZD B;  3KUY D;  3AFA B;  3UT9 B;  4Z66 A;  5AVC C;  2RVQ D;  4ZUX A;  3KWQ D;  3R45 A;  1HQ3 D;  3X1U C;  3AV1 D;  5C3I C;  3AZF D;  5CPJ A;  3AFA D;  5CP6 B;  1P3M C;  3UT9 D;  4CAY B;  5AV9 B;  4H9R B;  3MNN C;  5B2I B;  5GXQ A;  5AV6 C;  3AN2 B;  4J8W B;  4AWL B;  1P3O B;  1KX3 B;  5AY8 C;  3LZ0 C;  5CP6 D;  3AYW B;  5DNN A;  2HUE C;  3MGP D;  4YS3 A;  3AZN B;  3X1T D;  5B2J C;  3AV2 B;  3AN2 D;  4J8W D;  1KX4 C;  3REJ C;  5F99 C;  3AZH C;  5B33 A;  2CV5 D;  3X1V C;  4KUD A;  3AV2 D;  1KX5 A;  2F8N K;  3NQJ A;  5B40 C;  4NE6 A;  4NE3 A;  3C1C C;  4H9O B;  3AZJ C;  5B1M A;  3WA9 A;  3KXB B;  5AV5 C;  3AZK B;  1WWI A;  1AOI A;  5BS7 C;  1ZLA A;  2NQB B;  3V9R A;  3W99 C;  1TAF A;  1P3B C;  1P3G B;  5AVB D;  3AZK D;  3WAA A;  5GSU C;  4Z66 B;  3AZI D;  4ZUX B;  3LEL A;  3REI A;  3R45 B;  4NFT A;  3B6F D;  1P3P C;  2HIO A;  5CPJ B;  1P3G D;  3A6N C;  3TU4 C;  1KU5 A;  4WV4 B;  3W98 C;  5GXQ B;  4QLC C;  1F66 C;  5CPJ D;  1M18 C;  1P3A A;  5GT0 A;  4YS3 B;  4WZS B;  5GXQ D;  3REL A;  1H3O A;  5AV8 B;  5DNN D;  1TZY A;  5CPK C;  3KUY A;  2YFV A;  1KX5 B;  1S32 D;  3B0C W;  5B33 D;  2IO5 B;  5B1M B;  4J8V A;  3WA9 B;  5JRG A;  1P34 C;  4G91 C;  3REK C;  1ZLA B;  5E5A C;  3MGR D;  3V9R B;  2FJ7 C;  1TAF B;  5B1M D;  1N1J A;  1P3K C;  1P3L C;  3VH6 A;  4J8U C;  3X1T A;  1ID3 C;  1AOI D;  1ZLA D;  4KGC A;  3LEL B;  5BO0 A;  5FUG B;  4X23 A;  3REI B;  4HGA B;  2PYO C;  1P3F C;  2HIO B;  3MGS A;  3MVD C;  3AZE C;  3WAA D;  2CV5 A;  3LEL D;  3C1B C;  3REI D;  3WKJ C;  2HIO D;  4R8P C;  1P3A B;  2RVQ C;  3X1S A;  3KWQ C;  5GT0 B;  3AV1 C;  2NZD C;  5B0Z C;  3AZF C;  2F8N G;  3AFA C;  3REL B;  1H3O B;  3UT9 C;  1P3A D;  4WU8 D;  1TZY B;  3WTP A;  4G92 B;  1M19 A;  3KUY B;  2YFV B;  5CP6 C;  5AVB A;  5AVC A;  4J8X D;  3REL D;  3AZI A;  5KDM A;  4ZBJ B;  5AV9 C;  1TZY D;  5B2I C;  3B6F A;  3AN2 C;  4J8W C;  4AWL C;  1P3O C;  1KX3 C;  4J8V B;  3REH A;  3AZM D;  5JRG B;  3AYW C;  2F8N A;  3UTA A;  3AZN C;  1BH8 A;  4KUD D;  3AV2 C;  2BYK A;  4J8V D;  1WWS A;  5B0Y D;  1N1J B;  2LY8 A;  5JRG D;  3MGP B;  5B2J A;  3X1T B;  2ARO A;  1BH9 A;  5BO0 B;  4X23 B;  1KX4 A;  3AZH A;  3MGS B;  3AZG D;  4CSR A;  2CV5 B;  5G49 B;  3VH6 T;  4KGC D;  4X23 D;  3KXB C;  5B40 A;  5B24 A;  3MGS D;  3AZK C;  1S32 A;  4YM6 A;  2NQB C;  3X1S B;  4DRB A;  3LJA C;  3W96 A;  1P3G C;  3VH6 W;  3B0D B;  5BS7 A;  3MGQ A;  4Z66 C;  3WTP E;  4ZUX C;  3X1S D;  3O62 A;  3MGR A;  5GT3 A;  3WTP B;  1M19 B;  5CPJ C;  5B31 D;  5AVB B;  5AVC B;  3AZI B;  5B1L D;  5KDM B;  4H9S C;  4LD9 A;  3WTP D;  5CPI D;  3B6F B;  1B67 A;  2YFW B;  1M19 D;  5AVC D;  5BNX A;  3REH B;  2F8N B;  3UTA B;  1B6W A;  4YS3 C;  1BH8 B;  3REH D;  2F8N D;  1BFM A;  5AV8 C;  3UTA D;  3VH5 T;  2ARO B;  1BH9 B;  3LZ0 D;  1KX5 C;  4H9P A;  1F1E A;  5DNM C;  4WU8 A;  5DNN B;  4CSR B;  5CPK A;  4Z5T A;  5B2J D;  2IO5 C;  1P3I A;  2ARO D;  5B1M C;  3WA9 C;  1R4V A;  4J8X A;  3REJ D;  1KX4 D;  2CWE A;  3VH5 W;  5B24 B;  3AZH D;  1S32 B;  1U35 A;  4YM6 B;  2JSS A;  5B33 B;  1ZLA C;  4KHA A;  3W96 B;  3AZM A;  5B40 D;  5B24 D;  3W97 A;  3NQJ B;  3MGQ B;  4WNN A;  4YM6 D;  3O62 B;  3LEL C;  3MGR B;  3C1C D;  3REI C;  2BYM A;  5GT3 B;  2FJ7 A;  4HGA C;  3W96 D;  3UTB A;  5AV5 D;  5B0Y A; 
#chains in the Genus database with same CATH topology
 4XZQ A;  3MGQ D;  3LZ1 A;  5BT1 C;  1AOI B;  3W99 D;  3O62 D;  4LD9 B;  5GT3 D;  1P3B D;  3H0M C;  3AZE A;  1P3A C;  3AZG A;  3WAA B;  2VQR A;  5GT0 C;  1M1A A;  4LD9 D;  5B31 G;  4JJN C;  5B32 G;  2NZD A;  1EQZ A;  4XUJ A;  4QLC D;  4EO5 B;  3B6G C;  3KUY C;  4Z2M G;  4ZBJ C;  4H9P B;  4WU8 B;  1HQ3 C;  4Z5T B;  1P3I B;  4J8V C;  5B31 A;  4J8X B;  2Y2J A;  5JRG C;  3A1I A;  5B1L A;  3AZL A;  1U35 B;  5B32 A;  4KHA B;  5CPI A;  4Z5T D;  4WU9 A;  5CPK D;  1P3I D;  1P3O A;  1KX3 A;  3AYW A;  3AZM B;  3W97 B;  1U35 D;  3MGP C;  3X1T C;  3X1U A;  2Y2I A;  4KUD B;  3NQU A;  2FJ7 B;  4X23 C;  2BYM B;  2ZY5 A;  1P3M A;  3UTB B;  1P34 D;  5B0Y B;  4XZQ B;  3VH5 A;  3W97 D;  3REK D;  3MNN A;  3LZ1 B;  5E5A D;  2CV5 C;  2Y2N A;  5AV6 A;  2FJ7 D;  5AY8 A;  3LZ0 A;  3AZE B;  3UTB D;  4XZQ D;  1P3L D;  4UPK A;  3AZG B;  1ID3 D;  3X1S C;  3LZ1 D;  4KGC B;  1M1A B;  2PYO D;  3KXB A;  3REJ A;  5F99 A;  3MVD D;  3AZE D;  5JA4 A;  3B0D C;  3LJA A;  3X1V A;  3WTP C;  1EQZ B;  4XUJ B;  1M1A D;  1M19 C;  3WKJ D;  4R8P D;  2L5A A;  5AVB C;  5BNV A;  3AZI C;  3C1C A;  3AZJ A;  2NZD D;  1EQZ D;  5B0Z D;  3B6F C;  4XUJ D;  5AV5 A;  5B31 B;  3REH C;  4H9S A;  1JFI A;  5B1L B;  3UTA C;  3AZL B;  5B32 B;  3W99 A;  5CPI B;  1P3B A;  4WU9 B;  2BG1 A;  5GSU A;  5AV9 D;  3AZL D;  5B32 D;  5B2I D;  3X1U B;  1P3P A;  2ARO C;  2G5H C;  3NQU B;  5C3I B;  5GXQ C;  4WU9 D;  1P3O D;  1KX3 D;  3A6N A;  1P3M B;  3AYW D;  3TU4 A;  5AV8 A;  3W98 A;  4DRA A;  3AZN D;  5DNN C;  1Q9C A;  4M6B A;  3MNN B;  4QLC A;  1F66 A;  5AV6 B;  3X1U D;  1M18 A;  5AY8 B;  2BYK B;  3LZ0 B;  4DQY B;  1P3M D;  5B24 C;  1S32 C;  5DNM A;  2HUE B;  4YM6 C;  5B33 C;  4H9N A;  3MNN D;  5B2J B;  5AV6 D;  3W96 C;  1KX4 B;  5AY8 D;  5F99 B;  3REJ B;  3KSY A;  5JA4 B;  3AZH B;  3MGQ C;  3LJA B;  3X1V B;  3O62 C;  3MGR C;  5GT3 C;  3KFU G;  3KXB D;  5F99 D;  5B40 B;  5BNV B;  2NQB D;  1AOI C;  5FUG A;  3LJA D;  3X1V D;  4LD9 C;  3C1C B;  3AZJ B;  4NE5 A;  5AV5 B;  1P34 A;  4Z66 D;  3WAA C;  3REK A;  4ZUX D;  1JFI B;  5E5A A;  3W99 B;  3AZJ D;  1P3B B;  2Y2K A;  2HIO C;  1ULY A;  1P3K A;  1P3L A;  5GSU B;  4J8U A;  1ID3 A;  4H9Q A;  4EO5 C;  2PYO A;  1P3F A;  3B0C T;  1P3P B;  3MVD A;  4JJN A;  1A7W A;  3A6N B;  1HTA A;  3TU4 B;  5GSU D;  5BNX B;  4WU8 C;  4YS3 D;  3B6G A;  3C1B A;  3W98 B;  4UUZ A;  4Z5T C;  4QLC B;  1P3I C;  1F66 B;  3WKJ A;  1P3P D;  1M18 B;  4R8P A;  2DQN C;  3REL C;  4J8X C;  3A6N D;  3TU4 D;  5AV8 D;  3KWQ A;  5DNM B;  1U35 C;  1HQ3 A;  3W98 D;  3AV1 A;  1TZY C;  4H9N B;  5B0Z A;  3AZF A;  1F66 D;  4G92 C;  3AFA A;  1M18 D;  3UT9 A;  1KX5 D;  3AZM C;  4Z2M H;  3B0B A;  3W97 C;  5DNM D;  5CPK B;  4KUD C;  3WA9 D;  5CP6 A;  3UTB C;  2F8N H;  4CAY A;  5B0Y C;  4XZQ C;  4H9R A;  5AV9 A;  3MGP A;  3LZ1 C;  5B2I A;  3AN2 A;  4J8W A;  1P34 B;  4G91 B;  3AZG C;  5G49 A;  5CHL B;  3REK B;  3AZN A;  5E5A B;  4WNN B;  3AV2 A;  4KGC C;  1M1A C;  4E45 A;  3MGS C;  1P3K B;  1P3L B;  5BT1 D;  4J8U B;  1ID3 B;  1EQZ C;  4H9Q B;  4XUJ C;  2Y2O A;  2PYO B;  1P3F B;  2Y2H A;  2ZY3 A;  3MVD B;  3H0L C;  4JJN B;  1P3K D;  4J8U D;  5GT0 D;  4H9O A;  3H0R C;  3C1B B;  4UUZ B;  3B6G B;  4E44 A;  1P3F D;  3WKJ B;  3AZK A;  4R8P B;  4JJN D;  5B31 C;  5B1L C;  2NQB A;  3AZL C;  3KWQ B;  5B32 C;  1HQ3 B;  3B6G D;  3C1B D;  3AV1 B;  5CPI C;  2YFW A;  5B0Z B;  3AZF B;  4WU9 C;  1P3G A;  2NZD B;  3KUY D;  3AFA B;  3UT9 B;  4Z66 A;  5AVC C;  2RVQ D;  4ZUX A;  3KWQ D;  3R45 A;  1HQ3 D;  3X1U C;  3AV1 D;  5C3I C;  3AZF D;  5CPJ A;  3AFA D;  5CP6 B;  1P3M C;  3UT9 D;  2Y2Q A;  4CAY B;  5AV9 B;  4H9R B;  3MNN C;  5B2I B;  5GXQ A;  1W2E A;  5AV6 C;  3AN2 B;  4J8W B;  4AWL B;  1P3O B;  1KX3 B;  5AY8 C;  3LZ0 C;  5CP6 D;  3AYW B;  5DNN A;  2HUE C;  3MGP D;  4YS3 A;  3AZN B;  3X1T D;  5B2J C;  3AV2 B;  3AN2 D;  3A1K A;  4J8W D;  1KX4 C;  2ZY2 A;  5F99 C;  3REJ C;  3AZH C;  5B33 A;  2Y2M A;  2CV5 D;  3X1V C;  4KUD A;  3AV2 D;  2Y2P A;  1KX5 A;  2F8N K;  1PZR A;  3NQJ A;  5B40 C;  4NE6 A;  4NE3 A;  2XD5 A;  3C1C C;  4H9O B;  3AZJ C;  5B1M A;  3WA9 A;  3KXB B;  5AV5 C;  3AZK B;  1WWI A;  2JCH A;  1AOI A;  5BS7 C;  1ZLA A;  2W8S A;  2NQB B;  3V9R A;  3W99 C;  1TAF A;  1P3B C;  1P3G B;  5AVB D;  3AZK D;  3WAA A;  5GSU C;  4Z66 B;  3AZI D;  4ZUX B;  3LEL A;  3REI A;  3R45 B;  4NFT A;  2ZY4 A;  3B6F D;  1P3P C;  2HIO A;  5CPJ B;  1P3G D;  3A6N C;  2G5I C;  1KU5 A;  3TU4 C;  3EPK A;  4WV4 B;  3W98 C;  5GXQ B;  4QLC C;  1F66 C;  5CPJ D;  1M18 C;  1P3A A;  3P5J B;  3AL0 C;  5GT0 A;  2FFF B;  4YS3 B;  4WZS B;  5GXQ D;  3REL A;  1H3O A;  5AV8 B;  5DNN D;  1TZY A;  5CPK C;  3KUY A;  2YFV A;  1KX5 B;  1S32 D;  3B0C W;  5B33 D;  2IO5 B;  3EPH A;  5B1M B;  4J8V A;  3WA9 B;  5JRG A;  1P34 C;  4G91 C;  3REK C;  1ZLA B;  2JE5 A;  5E5A C;  3MGR D;  3V9R B;  2FJ7 C;  1TAF B;  5B1M D;  1N1J A;  1P3K C;  1P3L C;  3VH6 A;  4J8U C;  3X1T A;  2UWX A;  1ID3 C;  1AOI D;  1ZLA D;  3LEL B;  4KGC A;  5BO0 A;  5FUG B;  4X23 A;  3REI B;  4HGA B;  2PYO C;  1P3F C;  2HIO B;  3MGS A;  3MVD C;  2Y2L A;  3AZE C;  3WAA D;  2CV5 A;  3LEL D;  3C1B C;  3REI D;  2F2A C;  3WKJ C;  2HIO D;  2Y2G A;  4R8P C;  1P3A B;  2RVQ C;  3X1S A;  3KWQ C;  5GT0 B;  3AV1 C;  2NZD C;  5B0Z C;  3AZF C;  2F8N G;  3AFA C;  3REL B;  1H3O B;  3UT9 C;  1P3A D;  1T3U A;  4WU8 D;  1TZY B;  3WTP A;  4G92 B;  1M19 A;  3KUY B;  2YFV B;  5CP6 C;  5AVB A;  2RIQ A;  5AVC A;  4J8X D;  3REL D;  3AZI A;  5KDM A;  4ZBJ B;  5AV9 C;  1TZY D;  5B2I C;  3B6F A;  3AN2 C;  4J8W C;  4AWL C;  1P3O C;  1KX3 C;  4J8V B;  3EG5 B;  3REH A;  3AZM D;  5JRG B;  3AYW C;  2F8N A;  3UTA A;  3AZN C;  1BH8 A;  4KUD D;  3AV2 C;  3IP4 C;  2BYK A;  4J8V D;  1WWS A;  5B0Y D;  1N1J B;  2LY8 A;  5JRG D;  4WJ3 C;  2XD1 A;  3MGP B;  5B2J A;  3X1T B;  2ARO A;  1BH9 A;  5BO0 B;  4X23 B;  1KX4 A;  3AZH A;  3MGS B;  3AZG D;  4CSR A;  2CV5 B;  5G49 B;  3VH6 T;  4KGC D;  4X23 D;  3KXB C;  5B40 A;  5B24 A;  3MGS D;  3AZK C;  1S32 A;  1Z2C B;  4YM6 A;  2NQB C;  3X1S B;  4DRB A;  3LJA C;  3W96 A;  2J8P A;  1P3G C;  3VH6 W;  3B0D B;  5BS7 A;  3MGQ A;  4Z66 C;  3WTP E;  4ZUX C;  3X1S D;  3O62 A;  3MGR A;  5GT3 A;  3WTP B;  1M19 B;  5CPJ C;  5B31 D;  5AVB B;  5AVC B;  3FDD A;  5B1L D;  3AZI B;  5KDM B;  4H9S C;  4LD9 A;  3WTP D;  5CPI D;  3B6F B;  1B67 A;  2YFW B;  1M19 D;  2ZM5 A;  5AVC D;  5BNX A;  3REH B;  3EPL A;  2F8N B;  3UTA B;  1B6W A;  4YS3 C;  1BH8 B;  3F6T A;  2DF4 C;  3EPJ A;  3REH D;  2F8N D;  1BFM A;  5AV8 C;  3UTA D;  3VH5 T;  2ARO B;  1BH9 B;  3LZ0 D;  1KX5 C;  4H9P A;  1F1E A;  5DNM C;  4WU8 A;  5DNN B;  4CSR B;  5CPK A;  4Z5T A;  5B2J D;  2IO5 C;  1P3I A;  2ARO D;  5B1M C;  3WA9 C;  1R4V A;  4J8X A;  3REJ D;  1KX4 D;  2CWE A;  3VH5 W;  5B24 B;  3AZH D;  1S32 B;  1U35 A;  4YM6 B;  2JSS A;  5B33 B;  1ZLA C;  4KHA A;  3W96 B;  3AZM A;  5B40 D;  5B24 D;  3W97 A;  3NQJ B;  3MGQ B;  4WNN A;  4YM6 D;  3O62 B;  3LEL C;  3MGR B;  3C1C D;  3REI C;  2BYM A;  5GT3 B;  2FJ7 A;  4HGA C;  3W96 D;  3UTB A;  5AV5 D;  5B0Y A; 
#chains in the Genus database with same CATH homology
 4XZQ A;  3MGQ D;  3LZ1 A;  5BT1 C;  1AOI B;  3W99 D;  3O62 D;  4LD9 B;  5GT3 D;  1P3B D;  3H0M C;  3AZE A;  1P3A C;  3AZG A;  3WAA B;  2VQR A;  5GT0 C;  1M1A A;  4LD9 D;  5B31 G;  4JJN C;  5B32 G;  2NZD A;  1EQZ A;  4XUJ A;  4QLC D;  4EO5 B;  3B6G C;  3KUY C;  4Z2M G;  4ZBJ C;  4H9P B;  4WU8 B;  1HQ3 C;  4Z5T B;  1P3I B;  4J8V C;  5B31 A;  4J8X B;  2Y2J A;  5JRG C;  3A1I A;  5B1L A;  3AZL A;  1U35 B;  5B32 A;  4KHA B;  5CPI A;  4Z5T D;  4WU9 A;  5CPK D;  1P3I D;  1P3O A;  1KX3 A;  3AYW A;  3AZM B;  3W97 B;  1U35 D;  3MGP C;  3X1T C;  3X1U A;  2Y2I A;  4KUD B;  3NQU A;  2FJ7 B;  4X23 C;  2BYM B;  2ZY5 A;  1P3M A;  3UTB B;  1P34 D;  5B0Y B;  4XZQ B;  3VH5 A;  3W97 D;  3REK D;  3MNN A;  3LZ1 B;  5E5A D;  2CV5 C;  2Y2N A;  5AV6 A;  2FJ7 D;  5AY8 A;  3LZ0 A;  3AZE B;  3UTB D;  4XZQ D;  1P3L D;  4UPK A;  3AZG B;  1ID3 D;  3X1S C;  3LZ1 D;  4KGC B;  1M1A B;  2PYO D;  3KXB A;  3REJ A;  5F99 A;  3MVD D;  3AZE D;  5JA4 A;  3B0D C;  3LJA A;  3X1V A;  3WTP C;  1EQZ B;  4XUJ B;  1M1A D;  1M19 C;  3WKJ D;  4R8P D;  2L5A A;  5AVB C;  5BNV A;  3AZI C;  3C1C A;  3AZJ A;  2NZD D;  1EQZ D;  5B0Z D;  3B6F C;  4XUJ D;  5AV5 A;  5B31 B;  3REH C;  4H9S A;  1JFI A;  5B1L B;  3UTA C;  3AZL B;  5B32 B;  3W99 A;  5CPI B;  1P3B A;  4WU9 B;  2BG1 A;  5GSU A;  5AV9 D;  3AZL D;  5B32 D;  5B2I D;  3X1U B;  1P3P A;  2ARO C;  2G5H C;  3NQU B;  5C3I B;  5GXQ C;  4WU9 D;  1P3O D;  1KX3 D;  3A6N A;  1P3M B;  3AYW D;  3TU4 A;  5AV8 A;  3W98 A;  4DRA A;  3AZN D;  5DNN C;  1Q9C A;  4M6B A;  3MNN B;  4QLC A;  1F66 A;  5AV6 B;  3X1U D;  1M18 A;  5AY8 B;  2BYK B;  3LZ0 B;  4DQY B;  1P3M D;  5B24 C;  1S32 C;  5DNM A;  2HUE B;  4YM6 C;  5B33 C;  4H9N A;  3MNN D;  5B2J B;  5AV6 D;  3W96 C;  1KX4 B;  5AY8 D;  5F99 B;  3REJ B;  3KSY A;  5JA4 B;  3AZH B;  3MGQ C;  3LJA B;  3X1V B;  3O62 C;  3MGR C;  5GT3 C;  3KFU G;  3KXB D;  5F99 D;  5B40 B;  5BNV B;  2NQB D;  1AOI C;  5FUG A;  3LJA D;  3X1V D;  4LD9 C;  3C1C B;  3AZJ B;  4NE5 A;  5AV5 B;  1P34 A;  4Z66 D;  3WAA C;  3REK A;  4ZUX D;  1JFI B;  5E5A A;  3W99 B;  3AZJ D;  1P3B B;  2Y2K A;  2HIO C;  1ULY A;  1P3K A;  1P3L A;  5GSU B;  4J8U A;  1ID3 A;  4H9Q A;  4EO5 C;  2PYO A;  1P3F A;  3B0C T;  1P3P B;  3MVD A;  4JJN A;  1A7W A;  3A6N B;  1HTA A;  3TU4 B;  5GSU D;  5BNX B;  4WU8 C;  4YS3 D;  3B6G A;  3C1B A;  3W98 B;  4UUZ A;  4Z5T C;  4QLC B;  1P3I C;  1F66 B;  3WKJ A;  1P3P D;  1M18 B;  4R8P A;  2DQN C;  3REL C;  4J8X C;  3A6N D;  3TU4 D;  5AV8 D;  3KWQ A;  5DNM B;  1U35 C;  1HQ3 A;  3W98 D;  3AV1 A;  1TZY C;  4H9N B;  5B0Z A;  3AZF A;  1F66 D;  4G92 C;  3AFA A;  1M18 D;  3UT9 A;  1KX5 D;  3AZM C;  4Z2M H;  3B0B A;  3W97 C;  5DNM D;  5CPK B;  4KUD C;  3WA9 D;  5CP6 A;  3UTB C;  2F8N H;  4CAY A;  5B0Y C;  4XZQ C;  4H9R A;  5AV9 A;  3MGP A;  3LZ1 C;  5B2I A;  3AN2 A;  4J8W A;  1P34 B;  4G91 B;  3AZG C;  5G49 A;  5CHL B;  3REK B;  3AZN A;  5E5A B;  4WNN B;  3AV2 A;  4KGC C;  1M1A C;  4E45 A;  3MGS C;  1P3K B;  1P3L B;  5BT1 D;  4J8U B;  1ID3 B;  1EQZ C;  4H9Q B;  4XUJ C;  2Y2O A;  2PYO B;  1P3F B;  2Y2H A;  2ZY3 A;  3MVD B;  3H0L C;  4JJN B;  1P3K D;  4J8U D;  5GT0 D;  4H9O A;  3H0R C;  3C1B B;  4UUZ B;  3B6G B;  4E44 A;  1P3F D;  3WKJ B;  3AZK A;  4R8P B;  4JJN D;  5B31 C;  5B1L C;  2NQB A;  3AZL C;  3KWQ B;  5B32 C;  1HQ3 B;  3B6G D;  3C1B D;  3AV1 B;  5CPI C;  2YFW A;  5B0Z B;  3AZF B;  4WU9 C;  1P3G A;  2NZD B;  3KUY D;  3AFA B;  3UT9 B;  4Z66 A;  5AVC C;  2RVQ D;  4ZUX A;  3KWQ D;  3R45 A;  1HQ3 D;  3X1U C;  3AV1 D;  5C3I C;  3AZF D;  5CPJ A;  3AFA D;  5CP6 B;  1P3M C;  3UT9 D;  2Y2Q A;  4CAY B;  5AV9 B;  4H9R B;  3MNN C;  5B2I B;  5GXQ A;  1W2E A;  5AV6 C;  3AN2 B;  4J8W B;  4AWL B;  1P3O B;  1KX3 B;  5AY8 C;  3LZ0 C;  5CP6 D;  3AYW B;  5DNN A;  2HUE C;  3MGP D;  4YS3 A;  3AZN B;  3X1T D;  5B2J C;  3AV2 B;  3AN2 D;  3A1K A;  4J8W D;  1KX4 C;  2ZY2 A;  5F99 C;  3REJ C;  3AZH C;  5B33 A;  2Y2M A;  2CV5 D;  3X1V C;  4KUD A;  3AV2 D;  2Y2P A;  1KX5 A;  2F8N K;  1PZR A;  3NQJ A;  5B40 C;  4NE6 A;  4NE3 A;  2XD5 A;  3C1C C;  4H9O B;  3AZJ C;  5B1M A;  3WA9 A;  3KXB B;  5AV5 C;  3AZK B;  1WWI A;  2JCH A;  1AOI A;  5BS7 C;  1ZLA A;  2W8S A;  2NQB B;  3V9R A;  3W99 C;  1TAF A;  1P3B C;  1P3G B;  5AVB D;  3AZK D;  3WAA A;  5GSU C;  4Z66 B;  3AZI D;  4ZUX B;  3LEL A;  3REI A;  3R45 B;  4NFT A;  2ZY4 A;  3B6F D;  1P3P C;  2HIO A;  5CPJ B;  1P3G D;  3A6N C;  2G5I C;  1KU5 A;  3TU4 C;  3EPK A;  4WV4 B;  3W98 C;  5GXQ B;  4QLC C;  1F66 C;  5CPJ D;  1M18 C;  1P3A A;  3P5J B;  3AL0 C;  5GT0 A;  2FFF B;  4YS3 B;  4WZS B;  5GXQ D;  3REL A;  1H3O A;  5AV8 B;  5DNN D;  1TZY A;  5CPK C;  3KUY A;  2YFV A;  1KX5 B;  1S32 D;  3B0C W;  5B33 D;  2IO5 B;  3EPH A;  5B1M B;  4J8V A;  3WA9 B;  5JRG A;  1P34 C;  4G91 C;  3REK C;  1ZLA B;  2JE5 A;  5E5A C;  3MGR D;  3V9R B;  2FJ7 C;  1TAF B;  5B1M D;  1N1J A;  1P3K C;  1P3L C;  3VH6 A;  4J8U C;  3X1T A;  2UWX A;  1ID3 C;  1AOI D;  1ZLA D;  3LEL B;  4KGC A;  5BO0 A;  5FUG B;  4X23 A;  3REI B;  4HGA B;  2PYO C;  1P3F C;  2HIO B;  3MGS A;  3MVD C;  2Y2L A;  3AZE C;  3WAA D;  2CV5 A;  3LEL D;  3C1B C;  3REI D;  2F2A C;  3WKJ C;  2HIO D;  2Y2G A;  4R8P C;  1P3A B;  2RVQ C;  3X1S A;  3KWQ C;  5GT0 B;  3AV1 C;  2NZD C;  5B0Z C;  3AZF C;  2F8N G;  3AFA C;  3REL B;  1H3O B;  3UT9 C;  1P3A D;  1T3U A;  4WU8 D;  1TZY B;  3WTP A;  4G92 B;  1M19 A;  3KUY B;  2YFV B;  5CP6 C;  5AVB A;  2RIQ A;  5AVC A;  4J8X D;  3REL D;  3AZI A;  5KDM A;  4ZBJ B;  5AV9 C;  1TZY D;  5B2I C;  3B6F A;  3AN2 C;  4J8W C;  4AWL C;  1P3O C;  1KX3 C;  4J8V B;  3EG5 B;  3REH A;  3AZM D;  5JRG B;  3AYW C;  2F8N A;  3UTA A;  3AZN C;  1BH8 A;  4KUD D;  3AV2 C;  3IP4 C;  2BYK A;  4J8V D;  1WWS A;  5B0Y D;  1N1J B;  2LY8 A;  5JRG D;  4WJ3 C;  2XD1 A;  3MGP B;  5B2J A;  3X1T B;  2ARO A;  1BH9 A;  5BO0 B;  4X23 B;  1KX4 A;  3AZH A;  3MGS B;  3AZG D;  4CSR A;  2CV5 B;  5G49 B;  3VH6 T;  4KGC D;  4X23 D;  3KXB C;  5B40 A;  5B24 A;  3MGS D;  3AZK C;  1S32 A;  1Z2C B;  4YM6 A;  2NQB C;  3X1S B;  4DRB A;  3LJA C;  3W96 A;  2J8P A;  1P3G C;  3VH6 W;  3B0D B;  5BS7 A;  3MGQ A;  4Z66 C;  3WTP E;  4ZUX C;  3X1S D;  3O62 A;  3MGR A;  5GT3 A;  3WTP B;  1M19 B;  5CPJ C;  5B31 D;  5AVB B;  5AVC B;  3FDD A;  5B1L D;  3AZI B;  5KDM B;  4H9S C;  4LD9 A;  3WTP D;  5CPI D;  3B6F B;  1B67 A;  2YFW B;  1M19 D;  2ZM5 A;  5AVC D;  5BNX A;  3REH B;  3EPL A;  2F8N B;  3UTA B;  1B6W A;  4YS3 C;  1BH8 B;  3F6T A;  2DF4 C;  3EPJ A;  3REH D;  2F8N D;  1BFM A;  5AV8 C;  3UTA D;  3VH5 T;  2ARO B;  1BH9 B;  3LZ0 D;  1KX5 C;  4H9P A;  1F1E A;  5DNM C;  4WU8 A;  5DNN B;  4CSR B;  5CPK A;  4Z5T A;  5B2J D;  2IO5 C;  1P3I A;  2ARO D;  5B1M C;  3WA9 C;  1R4V A;  4J8X A;  3REJ D;  1KX4 D;  2CWE A;  3VH5 W;  5B24 B;  3AZH D;  1S32 B;  1U35 A;  4YM6 B;  2JSS A;  5B33 B;  1ZLA C;  4KHA A;  3W96 B;  3AZM A;  5B40 D;  5B24 D;  3W97 A;  3NQJ B;  3MGQ B;  4WNN A;  4YM6 D;  3O62 B;  3LEL C;  3MGR B;  3C1C D;  3REI C;  2BYM A;  5GT3 B;  2FJ7 A;  4HGA C;  3W96 D;  3UTB A;  5AV5 D;  5B0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...