4JJNA

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4jjnA00
5B1MC 1P34D 3W99C 3X1TC 1P3FD 4WZSB 3B6GB 3AFAA 1KX3D 4J8VC 5AY8C 1ID3D 3AZHC 5B0ZA 3REHC 3KWQB 5CPJB 3TU4D 3LELA 2HIOB 2NQBA 3WA9B 4H9QA 2YFWA 4XUJD 5GXQB 3UTAC 1F66C 5F99B 3UTBA 1P3OD 5GT0A 4YM6C 3VH6W 4WU8D 5JA4B 3W97C 3REIC 3AV2A 3LJAD 3KXBD 5CPIB 1P3LB 3X1SD 3W98B 3LZ0A 3UT9A 3W96A 1EQZA 2PYOC 2FJ7D 3MNNA 5B24C 4H9NB 1P3IC 5B1LD 2LY8A 1KX4C 1P3PC 5JRGA 5CP6A 3AFAB 5B0ZB 4R8PA 3AV1C 1P3AD 1M19D 2L5AA 3AZMC 5B33C 3AZNB 2NQBB 4H9QB 1JFIA 2YFWB 1P34C 1KX3C 5BNVA 3UTBB 5AVBB 1ID3C 3B6FD 5GT0B 1Q9CA 3AZJA 3AV2B 1M18A 2F8ND 3TU4C 3C1CA 1AOID 3LZ1A 1B6WA 5KDMB 3UT9B 3AZKD 1EQZB 3W96B 2IO5C 3MNNB 5AVCD 5FUGA 3MGSA 3C1BC 4XUJC 4NFTA 3MGRD 1P3GD 4WV4B 1P3OC 4KGCD 4YS3A 4WU8C 4H9SC 5JRGB 3KXBC 5CP6B 5B32A 3X1SC 4H9RA 4R8PB 4Z5TD 5B2JD 1TAFA 2NZDD 3MGQD 4ZUXA 3AZID 3AYWA 4CAYA 5B1LC 4XZQB 5B31A 1JFIB 1ZLAA 5BNVB 3WKJD 3W99D 4J8UA 3AZGD 1P3AC 1M19C 5AY8D 1M18B 5BT1D 4X23D 3C1CB 5B1MA 3LZ1B 5AV5B 5AV9D 3O62A 4J8WA 5DNMA 5FUGB 3MGSB 5AV6D 4J8VA 3AZFD 4JJND 5CHLB 5BO0A 3WTPA 3AN2D 3B6FC 3MVDD 1KX5D 4QLCD 4ZBJB 5B32B 4H9RB 1P3MA 1ULYA 5BS7A 3UTAA 3AZKC 1F66A 5GT3A 5AVCC 5DNND 2CV5A 5G49A 1TAFB 3W97A 2AROD 3MGRC 3REKD 4ZUXB 1P3GC 5GXQA 3A6NA 5B2IA 3AYWB 4CAYB 5B31B 1ZLAB 4AWLC 2CWEA 3KWQD 4J8UB 5CPIA 2HIOD 5B24A 3X1UC 1P3KA 5B2JC 3AZMD 2NZDC 3WA9D 5B1MB 3MGQC 3AZIC 5F99D 3O62B 5DNMB 4J8WB 4J8VB 3AZHB 3AV1A 5C3IC 5BO0B 3WKJC 3WTPB 4Z2MG 3WTPE 3MGPC 3AZGC 1P3LD 3VH5A 3AZEA 5CPKC 5BT1C 4X23C 1P3MB 3UTAB 2YFVA 1P3FA 5AV9C 1H3OA 5GT3B 3AZLD 3AZNA 3AZFC 1F66B 2F8NH 5AV6C 5G49B 2CV5B 4JJNC 3W97B 5B40D 3C1BD 1M1AA 3AN2C 3A6NB 5B2IB 3AFAD 3MVDC 1KX5C 4QLCC 5AVBA 1TZYA 4DRBA 3LELD 1BH9A 5B24B 3NQUB 1P3KB 5DNNC 2NQBD 5KDMA 5GSUA 2AROC 3REKC 3LJAA 1P3PB 3B6GC 1HTAA 4WU9A 3X1SA 4E44A 3AV1B 3RELD 2FJ7A 3KWQC 3AV2D 2HIOC 3LZ0D 3AZEB 3W96D 4J8XD 5E5AA 3WA9C 1U35D 5B1LA 2YFVB 1P3FB 1S32A 1H3OB 5F99C 1M19A 5B0YD 4XZQA 1M1AB 5JRGD 5CP6D 1P3LC 3X1VA 4UUZA 1TZYB 1HQ3D 1BH9B 3AZLC 5AV5A 4Z2MH 4HGAB 5GSUB 5B40C 3LJAB 2F8NA 3AFAC 4WU9B 1AOIA 3X1SB 2FJ7B 3REJD 3AZJD 3LELC 3LZ1D 1P3BD 2NQBC 3X1UD 4KGCA 5E5AB 5B1LB 3MGSD 1S32B 2HUEB 1A7WA 4G91B 3UTBC 5AV8A 4LD9D 5GT0C 4YS3D 1M19B 3RELC 4Z5TA 3AV2C 3X1VB 4UUZB 5B32D 3MGPD 3MGQA 3LZ0C 2RVQD 3UT9C 3W96C 2BYMA 3VH5T 4J8XC 3AZIA 1EQZC 1U35C 3MNNC 5CPKD 3B0CT 3WKJA 4EO5C 4ZUXD 3W99A 3X1TA 5B0YC 5AY8A 3AZHA 1B67A 2F8NB 3REHA 5JRGC 5CP6C 3KUYD 1AOIB 3WAAD 4R8PC 4WNNA 1HQ3C 4CSRA 4JJNA 3B0BA 4KUDD 4KGCB 4Z66D 4J8WD 5DNMD 1BFMA 4YM6A 4AWLB 3REIA 3WTPD 5AV8B 3B6GD 5B32G 4Z5TB 3REJC 3AZJC 1M18C 5B2JB 2PYOA 3B0DB 2AROA 5CPJD 3MGQB 3LZ1C 1P3MD 1P3BC 3AZIB 2BYMB 2BYKA 3NQUA 5GT3D 3MGSC 2CV5D 5B31G 1P3IA 3WKJB 1KX4A 3W99B 5GXQD 3X1TB 3A6ND 1P3PA 3NQJA 4YS3C 4LD9C 5AY8B 4ZBJC 3REHB 3AZMA 1KU5A 4X23B 5B32C 3V9RA 5CPID 4WNNB 2RVQC 5B33A 3W98D 1P3KD 4CSRB 4KHAA 4JJNB 4ZUXC 1P34A 3VH5W 3KSYA 1KX3A 5B31C 1ID3A 4NE5A 3B0CW 4YM6B 3REIB 3KUYC 3WAAC 2JSSA 4G92C 3TU4A 3AZLA 5B0ZD 3AZED 2PYOB 1WWSA 2AROB 5B40A 3REKB 3C1BA 4KUDC 4XUJA 2BYKB 4Z66C 3AZND 3O62C 4J8WC 5DNMC 1P3OA 4WU8A 1P3IB 1R4VA 1M1AD 3WTPC 4NE6A 4H9SA 1KX4B 3KXBA 3NQJB 1N1JA 4NE3A 5AVBD 3UTBD 5GT0D 1TZYD 3AZMB 3VH6A 5CPJC 3V9RB 1P3MC 5BS7C 5B33B 5GT3C 3UT9D 2CV5C 5GSUD 1EQZD 4KHAB 3MNND 3RELA 1P34B 5GXQC 4M6BA 3A6NC 1KX3B 5B2IC 4H9OA 4WU9D 1ID3B 1P3AA 4J8XA 1U35A 3TU4B 5CPIC 3AZLB 3W98C 4R8PD 1P3KC 5E5AD 2IO5B 5B0YA 5B40B 3C1BB 4XUJB 1S32D 1WWIA 1P3OB 3B6FA 4WU8B 4XZQD 1HQ3A 3KXBB 3LELB 3X1VD 1N1JB 5B0ZC 3AZKA 3AZEC 1M18D 3R45A 5AVCA 1P3FC 3C1CD 1BH8A 1F1EA 3MGRA 3AZNC 5AV5D 1P3GA 3RELB 3REJA 1M1AC 4H9OB 5BNXA 5AVBC 1P3AB 1TZYC 1P3BA 3LZ0B 3X1UA 4J8XB 4H9PA 1U35B 5B2JA 2NZDA 4EO5B 4HGAC 5GSUC 4LD9A 5B0YB 3LJAC 4WU9C 3MGPA 3AZGA 5AV8D 3B6FB 3AYWD 5B31D 2FJ7C 1HQ3B 5CPKA 1ZLAD 4DRAA 4X23A 4J8UD 3AZKB 5AV9A 5E5AC 3AZFA 3R45B 5AVCB 5AV6A 1S32C 2F8NG 1BH8B 2HUEC 5B1MD 3MGRB 3KUYA 4G91C 1P3GB 3WAAA 3AN2A 3X1TD 3MVDA 1KX5A 4QLCA 4XZQC 3O62D 4J8VD 3REJB 3AZHD 3AZJB 3REHD 3X1VC 5BNXB 4KUDA 1P3BB 3X1UB 4Z66A 4H9PB 5DNNA 2NZDB 3C1CC 3VH6T 3REKA 5AV5C 3UTAD 3B6GA 1F66D 4LD9B 4YS3B 4YM6D 5C3IB 3W97D 3REID 3KWQA 3MGPB 5CPJA 3AZGB 1AOIC 5B2ID 2HIOA 5CPKB 2PYOD 3WA9A 5AV9B 5B24D 4KGCC 5F99A 3AZFB 5AV6B 1P3ID 5JA4A 3KUYB 1KX4D 3WAAB 3AN2B 4G92B 5AV8C 1P3PD 3MVDB 3AYWC 1P3LA 4QLCB 1KX5B 4Z5TC 3W98A 3AV1D 1ZLAC 3B0DC 4E45A 4KUDB 4J8UC 5B33D 4Z66B 2F8NK 5DNNB 4H9NA
chains in the Genus database with same CATH superfamily
5B1MC 1P34D 3W99C 3H0RC 3X1TC 4WZSB 1P3FD 3AFAA 1KX3D 3B6GB 4J8VC 2Y2IA 5AY8C 3AZHC 5B0ZA 1ID3D 3REHC 3KWQB 5CPJB 3TU4D 3LELA 2HIOB 2NQBA 3WA9B 4H9QA 2YFWA 4XUJD 5GXQB 3UTAC 1F66C 5F99B 3UTBA 1P3OD 5GT0A 4YM6C 3VH6W 4WU8D 5JA4B 3W97C 3REIC 3AV2A 3LJAD 3KXBD 5CPIB 1P3LB 3X1SD 3W98B 3LZ0A 3UT9A 3W96A 1EQZA 2PYOC 2FJ7D 3MNNA 5B24C 4H9NB 3EPLA 1P3IC 5B1LD 2LY8A 1KX4C 1P3PC 5JRGA 5CP6A 3AFAB 5B0ZB 4R8PA 3AV1C 1P3AD 1M19D 2L5AA 3AZMC 5B33C 3AZNB 2NQBB 4H9QB 1JFIA 2YFWB 1P34C 2XD1A 1T3UA 1KX3C 5BNVA 4UPKA 3UTBB 5AVBB 1ID3C 3B6FD 5GT0B 1Q9CA 3AZJA 3AV2B 1M18A 2F8ND 3TU4C 3C1CA 1AOID 3LZ1A 1B6WA 5KDMB 3UT9B 3AZKD 1EQZB 3W96B 2IO5C 2XD5A 3MNNB 5AVCD 5FUGA 3MGSA 3C1BC 3FDDA 4XUJC 4NFTA 3MGRD 1P3GD 4WV4B 1P3OC 4KGCD 4YS3A 4WU8C 4H9SC 3EPKA 5JRGB 3KXBC 5CP6B 5B32A 3X1SC 4H9RA 4R8PB 4Z5TD 5B2JD 1TAFA 2NZDD 3H0MC 3MGQD 4ZUXA 3AZID 3AYWA 4CAYA 5B1LC 4XZQB 5B31A 1JFIB 1ZLAA 5BNVB 3WKJD 2ZY4A 3W99D 4J8UA 3AZGD 1P3AC 1M19C 5AY8D 3P5JB 1M18B 2Y2OA 5BT1D 4X23D 3C1CB 5B1MA 3LZ1B 5AV5B 5AV9D 3O62A 4J8WA 5DNMA 5FUGB 3MGSB 5AV6D 4J8VA 3AZFD 4JJND 5CHLB 5BO0A 3WTPA 3AN2D 3B6FC 3MVDD 1KX5D 4QLCD 4ZBJB 5B32B 4H9RB 1P3MA 1ULYA 5BS7A 2ZM5A 3UTAA 3AZKC 1F66A 5GT3A 3EG5B 5DNND 5AVCC 2CV5A 5G49A 1TAFB 3W97A 2AROD 3MGRC 3REKD 4ZUXB 1P3GC 2JE5A 5GXQA 3A6NA 5B2IA 3AYWB 4CAYB 5B31B 1ZLAB 4AWLC 2CWEA 3KWQD 4J8UB 5CPIA 2HIOD 5B24A 3X1UC 1P3KA 3IP4C 5B2JC 3AZMD 2NZDC 3WA9D 5B1MB 3MGQC 3AZIC 5F99D 3O62B 5DNMB 4J8WB 4J8VB 3AZHB 3AV1A 5C3IC 5BO0B 3WKJC 3WTPB 1W2EA 4Z2MG 3WTPE 3MGPC 3AZGC 1P3LD 3VH5A 3AZEA 5CPKC 5BT1C 4X23C 1P3MB 3UTAB 2YFVA 1PZRA 5AV9C 1H3OA 5GT3B 3AZLD 3AZNA 3AZFC 1P3FA 1F66B 2F8NH 5AV6C 5G49B 2CV5B 4JJNC 3W97B 5B40D 3C1BD 1M1AA 3AN2C 3A6NB 5B2IB 3AFAD 3MVDC 1KX5C 4QLCC 5AVBA 1TZYA 4DRBA 3LELD 1BH9A 5B24B 3NQUB 1P3KB 5DNNC 2NQBD 5KDMA 5GSUA 2AROC 3REKC 3LJAA 1P3PB 3B6GC 1HTAA 4WU9A 3X1SA 4E44A 3AV1B 3RELD 2FJ7A 3KWQC 3AV2D 2HIOC 3LZ0D 3AZEB 3W96D 4J8XD 5E5AA 3WA9C 1U35D 5B1LA 2YFVB 1P3FB 1S32A 1H3OB 5F99C 2DF4C 1M19A 5B0YD 4XZQA 1M1AB 5JRGD 5CP6D 1P3LC 3X1VA 4UUZA 1TZYB 1HQ3D 1BH9B 3AZLC 5AV5A 4Z2MH 4HGAB 5GSUB 4DQYB 5B40C 3LJAB 2F8NA 3AFAC 2Y2LA 4WU9B 1AOIA 3X1SB 2FJ7B 3REJD 3AZJD 3LELC 2BG1A 3LZ1D 1P3BD 2NQBC 2Y2JA 3X1UD 4KGCA 5E5AB 5B1LB 3MGSD 2W8SA 1S32B 2HUEB 1A7WA 4G91B 3UTBC 5AV8A 4LD9D 5GT0C 4YS3D 1M19B 3RELC 4Z5TA 3AV2C 3X1VB 4UUZB 5B32D 3MGPD 3MGQA 3LZ0C 2RVQD 3UT9C 3W96C 2BYMA 3VH5T 4J8XC 3AZIA 1EQZC 1U35C 3MNNC 5CPKD 3B0CT 3WKJA 4EO5C 4ZUXD 3W99A 3X1TA 5B0YC 5AY8A 3AZHA 1B67A 2F8NB 3REHA 2RIQA 5JRGC 5CP6C 3KUYD 1AOIB 3WAAD 4R8PC 4WNNA 1HQ3C 4CSRA 4JJNA 3B0BA 4KUDD 3A1IA 4KGCB 4Z66D 2Y2GA 5DNMD 4J8WD 1BFMA 4YM6A 3KFUG 4AWLB 3REIA 3WTPD 3EPHA 5AV8B 3B6GD 5B32G 2DQNC 2VQRA 4Z5TB 3REJC 3AZJC 1M18C 2Y2NA 5B2JB 2PYOA 3B0DB 2AROA 5CPJD 3MGQB 3LZ1C 1P3MD 1P3BC 3AZIB 2BYMB 2BYKA 3NQUA 5GT3D 2G5IC 3MGSC 2CV5D 5B31G 1P3IA 3WKJB 1KX4A 3W99B 5GXQD 3X1TB 3A6ND 1P3PA 3NQJA 4YS3C 4LD9C 5AY8B 4ZBJC 3REHB 3AZMA 1KU5A 4X23B 5B32C 3V9RA 5CPID 4WNNB 2RVQC 5B33A 3W98D 2FFFB 1P3KD 4CSRB 4KHAA 4JJNB 2Y2QA 4ZUXC 1P34A 3VH5W 4WJ3C 3KSYA 1KX3A 5B31C 1ID3A 4NE5A 3B0CW 4YM6B 3REIB 3KUYC 3WAAC 2JSSA 4G92C 3TU4A 3AZLA 5B0ZD 3AZED 2PYOB 1WWSA 2AROB 5B40A 3REKB 3C1BA 4KUDC 4XUJA 2BYKB 4Z66C 3AZND 3O62C 4J8WC 5DNMC 1P3OA 4WU8A 1P3IB 1R4VA 1M1AD 3WTPC 4NE6A 4H9SA 1KX4B 3KXBA 3NQJB 1N1JA 4NE3A 5AVBD 3UTBD 1Z2CB 5GT0D 1TZYD 3AZMB 3VH6A 5CPJC 3V9RB 1P3MC 5BS7C 2Y2KA 5B33B 5GT3C 3UT9D 2CV5C 5GSUD 1EQZD 4KHAB 3MNND 3RELA 1P34B 5GXQC 4M6BA 3A6NC 1KX3B 5B2IC 3A1KA 4H9OA 4WU9D 1ID3B 1P3AA 4J8XA 2Y2HA 1U35A 3TU4B 5CPIC 3AZLB 3W98C 4R8PD 1P3KC 5E5AD 2IO5B 5B0YA 5B40B 3C1BB 4XUJB 1S32D 1WWIA 1P3OB 3B6FA 2F2AC 4WU8B 4XZQD 1HQ3A 3KXBB 3LELB 3X1VD 1N1JB 5B0ZC 2UWXA 3AZKA 3AZEC 1M18D 3R45A 5AVCA 1P3FC 3C1CD 1BH8A 1F1EA 3MGRA 3AZNC 5AV5D 1P3GA 3RELB 3REJA 1M1AC 4H9OB 5BNXA 5AVBC 2ZY3A 1P3AB 1TZYC 1P3BA 3LZ0B 3X1UA 4J8XB 3AL0C 4H9PA 1U35B 2G5HC 5B2JA 2NZDA 4EO5B 4HGAC 5GSUC 4LD9A 5B0YB 3LJAC 4WU9C 3MGPA 3AZGA 5AV8D 3B6FB 3AYWD 5B31D 2FJ7C 1HQ3B 5CPKA 1ZLAD 4DRAA 4X23A 4J8UD 3AZKB 2ZY5A 5AV9A 5E5AC 3AZFA 3R45B 5AVCB 3F6TA 5AV6A 1S32C 2Y2PA 1BH8B 2HUEC 5B1MD 3MGRB 3KUYA 4G91C 1P3GB 2F8NG 3AN2A 3X1TD 3WAAA 3MVDA 1KX5A 4QLCA 4XZQC 3O62D 4J8VD 3REJB 3AZHD 3AZJB 3REHD 3EPJA 3X1VC 5BNXB 4KUDA 1P3BB 3X1UB 4Z66A 4H9PB 5DNNA 3H0LC 2NZDB 3C1CC 3VH6T 3REKA 5AV5C 3UTAD 3B6GA 1F66D 4LD9B 4YS3B 4YM6D 5C3IB 3W97D 3REID 3KWQA 3MGPB 5CPJA 3AZGB 1AOIC 2J8PA 5B2ID 2HIOA 5CPKB 2PYOD 3WA9A 5AV9B 5B24D 4KGCC 5F99A 3AZFB 5AV6B 1P3ID 5JA4A 3KUYB 1KX4D 3WAAB 3AN2B 4G92B 5AV8C 2Y2MA 1P3PD 3MVDB 2ZY2A 3AYWC 4QLCB 1P3LA 1KX5B 4Z5TC 3W98A 3AV1D 2JCHA 1ZLAC 3B0DC 4E45A 4KUDB 4J8UC 5B33D 4Z66B 2F8NK 5DNNB 4H9NA
chains in the Genus database with same CATH topology
5B1MC 1P34D 3W99C 3H0RC 3X1TC 4WZSB 1P3FD 3AFAA 1KX3D 3B6GB 4J8VC 2Y2IA 5AY8C 3AZHC 5B0ZA 1ID3D 3REHC 3KWQB 5CPJB 3TU4D 3LELA 2HIOB 2NQBA 3WA9B 4H9QA 2YFWA 4XUJD 5GXQB 3UTAC 1F66C 5F99B 3UTBA 1P3OD 5GT0A 4YM6C 3VH6W 4WU8D 5JA4B 3W97C 3REIC 3AV2A 3LJAD 3KXBD 5CPIB 1P3LB 3X1SD 3W98B 3LZ0A 3UT9A 3W96A 1EQZA 2PYOC 2FJ7D 3MNNA 5B24C 4H9NB 3EPLA 1P3IC 5B1LD 2LY8A 1KX4C 1P3PC 5JRGA 5CP6A 3AFAB 5B0ZB 4R8PA 3AV1C 1P3AD 1M19D 2L5AA 3AZMC 5B33C 3AZNB 2NQBB 4H9QB 1JFIA 2YFWB 1P34C 2XD1A 1T3UA 1KX3C 5BNVA 4UPKA 3UTBB 5AVBB 1ID3C 3B6FD 5GT0B 1Q9CA 3AZJA 3AV2B 1M18A 2F8ND 3TU4C 3C1CA 1AOID 3LZ1A 1B6WA 5KDMB 3UT9B 3AZKD 1EQZB 3W96B 2IO5C 2XD5A 3MNNB 5AVCD 5FUGA 3MGSA 3C1BC 3FDDA 4XUJC 4NFTA 3MGRD 1P3GD 4WV4B 1P3OC 4KGCD 4YS3A 4WU8C 4H9SC 3EPKA 5JRGB 3KXBC 5CP6B 5B32A 3X1SC 4H9RA 4R8PB 4Z5TD 5B2JD 1TAFA 2NZDD 3H0MC 3MGQD 4ZUXA 3AZID 3AYWA 4CAYA 5B1LC 4XZQB 5B31A 1JFIB 1ZLAA 5BNVB 3WKJD 2ZY4A 3W99D 4J8UA 3AZGD 1P3AC 1M19C 5AY8D 3P5JB 1M18B 2Y2OA 5BT1D 4X23D 3C1CB 5B1MA 3LZ1B 5AV5B 5AV9D 3O62A 4J8WA 5DNMA 5FUGB 3MGSB 5AV6D 4J8VA 3AZFD 4JJND 5CHLB 5BO0A 3WTPA 3AN2D 3B6FC 3MVDD 1KX5D 4QLCD 4ZBJB 5B32B 4H9RB 1P3MA 1ULYA 5BS7A 2ZM5A 3UTAA 3AZKC 1F66A 5GT3A 3EG5B 5DNND 5AVCC 2CV5A 5G49A 1TAFB 3W97A 2AROD 3MGRC 3REKD 4ZUXB 1P3GC 2JE5A 5GXQA 3A6NA 5B2IA 3AYWB 4CAYB 5B31B 1ZLAB 4AWLC 2CWEA 3KWQD 4J8UB 5CPIA 2HIOD 5B24A 3X1UC 1P3KA 3IP4C 5B2JC 3AZMD 2NZDC 3WA9D 5B1MB 3MGQC 3AZIC 5F99D 3O62B 5DNMB 4J8WB 4J8VB 3AZHB 3AV1A 5C3IC 5BO0B 3WKJC 3WTPB 1W2EA 4Z2MG 3WTPE 3MGPC 3AZGC 1P3LD 3VH5A 3AZEA 5CPKC 5BT1C 4X23C 1P3MB 3UTAB 2YFVA 1PZRA 5AV9C 1H3OA 5GT3B 3AZLD 3AZNA 3AZFC 1P3FA 1F66B 2F8NH 5AV6C 5G49B 2CV5B 4JJNC 3W97B 5B40D 3C1BD 1M1AA 3AN2C 3A6NB 5B2IB 3AFAD 3MVDC 1KX5C 4QLCC 5AVBA 1TZYA 4DRBA 3LELD 1BH9A 5B24B 3NQUB 1P3KB 5DNNC 2NQBD 5KDMA 5GSUA 2AROC 3REKC 3LJAA 1P3PB 3B6GC 1HTAA 4WU9A 3X1SA 4E44A 3AV1B 3RELD 2FJ7A 3KWQC 3AV2D 2HIOC 3LZ0D 3AZEB 3W96D 4J8XD 5E5AA 3WA9C 1U35D 5B1LA 2YFVB 1P3FB 1S32A 1H3OB 5F99C 2DF4C 1M19A 5B0YD 4XZQA 1M1AB 5JRGD 5CP6D 1P3LC 3X1VA 4UUZA 1TZYB 1HQ3D 1BH9B 3AZLC 5AV5A 4Z2MH 4HGAB 5GSUB 4DQYB 5B40C 3LJAB 2F8NA 3AFAC 2Y2LA 4WU9B 1AOIA 3X1SB 2FJ7B 3REJD 3AZJD 3LELC 2BG1A 3LZ1D 1P3BD 2NQBC 2Y2JA 3X1UD 4KGCA 5E5AB 5B1LB 3MGSD 2W8SA 1S32B 2HUEB 1A7WA 4G91B 3UTBC 5AV8A 4LD9D 5GT0C 4YS3D 1M19B 3RELC 4Z5TA 3AV2C 3X1VB 4UUZB 5B32D 3MGPD 3MGQA 3LZ0C 2RVQD 3UT9C 3W96C 2BYMA 3VH5T 4J8XC 3AZIA 1EQZC 1U35C 3MNNC 5CPKD 3B0CT 3WKJA 4EO5C 4ZUXD 3W99A 3X1TA 5B0YC 5AY8A 3AZHA 1B67A 2F8NB 3REHA 2RIQA 5JRGC 5CP6C 3KUYD 1AOIB 3WAAD 4R8PC 4WNNA 1HQ3C 4CSRA 4JJNA 3B0BA 4KUDD 3A1IA 4KGCB 4Z66D 2Y2GA 5DNMD 4J8WD 1BFMA 4YM6A 3KFUG 4AWLB 3REIA 3WTPD 3EPHA 5AV8B 3B6GD 5B32G 2DQNC 2VQRA 4Z5TB 3REJC 3AZJC 1M18C 2Y2NA 5B2JB 2PYOA 3B0DB 2AROA 5CPJD 3MGQB 3LZ1C 1P3MD 1P3BC 3AZIB 2BYMB 2BYKA 3NQUA 5GT3D 2G5IC 3MGSC 2CV5D 5B31G 1P3IA 3WKJB 1KX4A 3W99B 5GXQD 3X1TB 3A6ND 1P3PA 3NQJA 4YS3C 4LD9C 5AY8B 4ZBJC 3REHB 3AZMA 1KU5A 4X23B 5B32C 3V9RA 5CPID 4WNNB 2RVQC 5B33A 3W98D 2FFFB 1P3KD 4CSRB 4KHAA 4JJNB 2Y2QA 4ZUXC 1P34A 3VH5W 4WJ3C 3KSYA 1KX3A 5B31C 1ID3A 4NE5A 3B0CW 4YM6B 3REIB 3KUYC 3WAAC 2JSSA 4G92C 3TU4A 3AZLA 5B0ZD 3AZED 2PYOB 1WWSA 2AROB 5B40A 3REKB 3C1BA 4KUDC 4XUJA 2BYKB 4Z66C 3AZND 3O62C 4J8WC 5DNMC 1P3OA 4WU8A 1P3IB 1R4VA 1M1AD 3WTPC 4NE6A 4H9SA 1KX4B 3KXBA 3NQJB 1N1JA 4NE3A 5AVBD 3UTBD 1Z2CB 5GT0D 1TZYD 3AZMB 3VH6A 5CPJC 3V9RB 1P3MC 5BS7C 2Y2KA 5B33B 5GT3C 3UT9D 2CV5C 5GSUD 1EQZD 4KHAB 3MNND 3RELA 1P34B 5GXQC 4M6BA 3A6NC 1KX3B 5B2IC 3A1KA 4H9OA 4WU9D 1ID3B 1P3AA 4J8XA 2Y2HA 1U35A 3TU4B 5CPIC 3AZLB 3W98C 4R8PD 1P3KC 5E5AD 2IO5B 5B0YA 5B40B 3C1BB 4XUJB 1S32D 1WWIA 1P3OB 3B6FA 2F2AC 4WU8B 4XZQD 1HQ3A 3KXBB 3LELB 3X1VD 1N1JB 5B0ZC 2UWXA 3AZKA 3AZEC 1M18D 3R45A 5AVCA 1P3FC 3C1CD 1BH8A 1F1EA 3MGRA 3AZNC 5AV5D 1P3GA 3RELB 3REJA 1M1AC 4H9OB 5BNXA 5AVBC 2ZY3A 1P3AB 1TZYC 1P3BA 3LZ0B 3X1UA 4J8XB 3AL0C 4H9PA 1U35B 2G5HC 5B2JA 2NZDA 4EO5B 4HGAC 5GSUC 4LD9A 5B0YB 3LJAC 4WU9C 3MGPA 3AZGA 5AV8D 3B6FB 3AYWD 5B31D 2FJ7C 1HQ3B 5CPKA 1ZLAD 4DRAA 4X23A 4J8UD 3AZKB 2ZY5A 5AV9A 5E5AC 3AZFA 3R45B 5AVCB 3F6TA 5AV6A 1S32C 2Y2PA 1BH8B 2HUEC 5B1MD 3MGRB 3KUYA 4G91C 1P3GB 2F8NG 3AN2A 3X1TD 3WAAA 3MVDA 1KX5A 4QLCA 4XZQC 3O62D 4J8VD 3REJB 3AZHD 3AZJB 3REHD 3EPJA 3X1VC 5BNXB 4KUDA 1P3BB 3X1UB 4Z66A 4H9PB 5DNNA 3H0LC 2NZDB 3C1CC 3VH6T 3REKA 5AV5C 3UTAD 3B6GA 1F66D 4LD9B 4YS3B 4YM6D 5C3IB 3W97D 3REID 3KWQA 3MGPB 5CPJA 3AZGB 1AOIC 2J8PA 5B2ID 2HIOA 5CPKB 2PYOD 3WA9A 5AV9B 5B24D 4KGCC 5F99A 3AZFB 5AV6B 1P3ID 5JA4A 3KUYB 1KX4D 3WAAB 3AN2B 4G92B 5AV8C 2Y2MA 1P3PD 3MVDB 2ZY2A 3AYWC 4QLCB 1P3LA 1KX5B 4Z5TC 3W98A 3AV1D 2JCHA 1ZLAC 3B0DC 4E45A 4KUDB 4J8UC 5B33D 4Z66B 2F8NK 5DNNB 4H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M C;  1P34 D;  3W99 C;  3X1T C;  1P3F D;  4WZS B;  3B6G B;  3AFA A;  1KX3 D;  4J8V C;  5AY8 C;  1ID3 D;  3AZH C;  5B0Z A;  3REH C;  3KWQ B;  5CPJ B;  3TU4 D;  3LEL A;  2HIO B;  2NQB A;  3WA9 B;  4H9Q A;  2YFW A;  4XUJ D;  5GXQ B;  3UTA C;  1F66 C;  5F99 B;  3UTB A;  1P3O D;  5GT0 A;  4YM6 C;  3VH6 W;  4WU8 D;  5JA4 B;  3W97 C;  3REI C;  3AV2 A;  3LJA D;  3KXB D;  5CPI B;  1P3L B;  3X1S D;  3W98 B;  3LZ0 A;  3UT9 A;  3W96 A;  1EQZ A;  2PYO C;  2FJ7 D;  3MNN A;  5B24 C;  4H9N B;  1P3I C;  5B1L D;  2LY8 A;  1KX4 C;  1P3P C;  5JRG A;  5CP6 A;  3AFA B;  5B0Z B;  4R8P A;  3AV1 C;  1P3A D;  1M19 D;  2L5A A;  3AZM C;  5B33 C;  3AZN B;  2NQB B;  4H9Q B;  1JFI A;  2YFW B;  1P34 C;  1KX3 C;  5BNV A;  3UTB B;  5AVB B;  1ID3 C;  3B6F D;  5GT0 B;  1Q9C A;  3AZJ A;  3AV2 B;  1M18 A;  2F8N D;  3TU4 C;  3C1C A;  1AOI D;  3LZ1 A;  1B6W A;  5KDM B;  3UT9 B;  3AZK D;  1EQZ B;  3W96 B;  2IO5 C;  3MNN B;  5AVC D;  5FUG A;  3MGS A;  3C1B C;  4XUJ C;  4NFT A;  3MGR D;  1P3G D;  4WV4 B;  1P3O C;  4KGC D;  4YS3 A;  4WU8 C;  4H9S C;  5JRG B;  3KXB C;  5CP6 B;  5B32 A;  3X1S C;  4H9R A;  4R8P B;  4Z5T D;  5B2J D;  1TAF A;  2NZD D;  3MGQ D;  4ZUX A;  3AZI D;  3AYW A;  4CAY A;  5B1L C;  4XZQ B;  5B31 A;  1JFI B;  1ZLA A;  5BNV B;  3WKJ D;  3W99 D;  4J8U A;  3AZG D;  1P3A C;  1M19 C;  5AY8 D;  1M18 B;  5BT1 D;  4X23 D;  3C1C B;  5B1M A;  3LZ1 B;  5AV5 B;  5AV9 D;  3O62 A;  4J8W A;  5DNM A;  5FUG B;  3MGS B;  5AV6 D;  4J8V A;  3AZF D;  4JJN D;  5CHL B;  5BO0 A;  3WTP A;  3AN2 D;  3B6F C;  3MVD D;  1KX5 D;  4QLC D;  4ZBJ B;  5B32 B;  4H9R B;  1P3M A;  1ULY A;  5BS7 A;  3UTA A;  3AZK C;  1F66 A;  5GT3 A;  5AVC C;  5DNN D;  2CV5 A;  5G49 A;  1TAF B;  3W97 A;  2ARO D;  3MGR C;  3REK D;  4ZUX B;  1P3G C;  5GXQ A;  3A6N A;  5B2I A;  3AYW B;  4CAY B;  5B31 B;  1ZLA B;  4AWL C;  2CWE A;  3KWQ D;  4J8U B;  5CPI A;  2HIO D;  5B24 A;  3X1U C;  1P3K A;  5B2J C;  3AZM D;  2NZD C;  3WA9 D;  5B1M B;  3MGQ C;  3AZI C;  5F99 D;  3O62 B;  5DNM B;  4J8W B;  4J8V B;  3AZH B;  3AV1 A;  5C3I C;  5BO0 B;  3WKJ C;  3WTP B;  4Z2M G;  3WTP E;  3MGP C;  3AZG C;  1P3L D;  3VH5 A;  3AZE A;  5CPK C;  5BT1 C;  4X23 C;  1P3M B;  3UTA B;  2YFV A;  1P3F A;  5AV9 C;  1H3O A;  5GT3 B;  3AZL D;  3AZN A;  3AZF C;  1F66 B;  2F8N H;  5AV6 C;  5G49 B;  2CV5 B;  4JJN C;  3W97 B;  5B40 D;  3C1B D;  1M1A A;  3AN2 C;  3A6N B;  5B2I B;  3AFA D;  3MVD C;  1KX5 C;  4QLC C;  5AVB A;  1TZY A;  4DRB A;  3LEL D;  1BH9 A;  5B24 B;  3NQU B;  1P3K B;  5DNN C;  2NQB D;  5KDM A;  5GSU A;  2ARO C;  3REK C;  3LJA A;  1P3P B;  3B6G C;  1HTA A;  4WU9 A;  3X1S A;  4E44 A;  3AV1 B;  3REL D;  2FJ7 A;  3KWQ C;  3AV2 D;  2HIO C;  3LZ0 D;  3AZE B;  3W96 D;  4J8X D;  5E5A A;  3WA9 C;  1U35 D;  5B1L A;  2YFV B;  1P3F B;  1S32 A;  1H3O B;  5F99 C;  1M19 A;  5B0Y D;  4XZQ A;  1M1A B;  5JRG D;  5CP6 D;  1P3L C;  3X1V A;  4UUZ A;  1TZY B;  1HQ3 D;  1BH9 B;  3AZL C;  5AV5 A;  4Z2M H;  4HGA B;  5GSU B;  5B40 C;  3LJA B;  2F8N A;  3AFA C;  4WU9 B;  1AOI A;  3X1S B;  2FJ7 B;  3REJ D;  3AZJ D;  3LEL C;  3LZ1 D;  1P3B D;  2NQB C;  3X1U D;  4KGC A;  5E5A B;  5B1L B;  3MGS D;  1S32 B;  2HUE B;  1A7W A;  4G91 B;  3UTB C;  5AV8 A;  4LD9 D;  5GT0 C;  4YS3 D;  1M19 B;  3REL C;  4Z5T A;  3AV2 C;  3X1V B;  4UUZ B;  5B32 D;  3MGP D;  3MGQ A;  3LZ0 C;  2RVQ D;  3UT9 C;  3W96 C;  2BYM A;  3VH5 T;  4J8X C;  3AZI A;  1EQZ C;  1U35 C;  3MNN C;  5CPK D;  3B0C T;  3WKJ A;  4EO5 C;  4ZUX D;  3W99 A;  3X1T A;  5B0Y C;  5AY8 A;  3AZH A;  1B67 A;  2F8N B;  3REH A;  5JRG C;  5CP6 C;  3KUY D;  1AOI B;  3WAA D;  4R8P C;  4WNN A;  1HQ3 C;  4CSR A;  4JJN A;  3B0B A;  4KUD D;  4KGC B;  4Z66 D;  4J8W D;  5DNM D;  1BFM A;  4YM6 A;  4AWL B;  3REI A;  3WTP D;  5AV8 B;  3B6G D;  5B32 G;  4Z5T B;  3REJ C;  3AZJ C;  1M18 C;  5B2J B;  2PYO A;  3B0D B;  2ARO A;  5CPJ D;  3MGQ B;  3LZ1 C;  1P3M D;  1P3B C;  3AZI B;  2BYM B;  2BYK A;  3NQU A;  5GT3 D;  3MGS C;  2CV5 D;  5B31 G;  1P3I A;  3WKJ B;  1KX4 A;  3W99 B;  5GXQ D;  3X1T B;  3A6N D;  1P3P A;  3NQJ A;  4YS3 C;  4LD9 C;  5AY8 B;  4ZBJ C;  3REH B;  3AZM A;  1KU5 A;  4X23 B;  5B32 C;  3V9R A;  5CPI D;  4WNN B;  2RVQ C;  5B33 A;  3W98 D;  1P3K D;  4CSR B;  4KHA A;  4JJN B;  4ZUX C;  1P34 A;  3VH5 W;  3KSY A;  1KX3 A;  5B31 C;  1ID3 A;  4NE5 A;  3B0C W;  4YM6 B;  3REI B;  3KUY C;  3WAA C;  2JSS A;  4G92 C;  3TU4 A;  3AZL A;  5B0Z D;  3AZE D;  2PYO B;  1WWS A;  2ARO B;  5B40 A;  3REK B;  3C1B A;  4KUD C;  4XUJ A;  2BYK B;  4Z66 C;  3AZN D;  3O62 C;  4J8W C;  5DNM C;  1P3O A;  4WU8 A;  1P3I B;  1R4V A;  1M1A D;  3WTP C;  4NE6 A;  4H9S A;  1KX4 B;  3KXB A;  3NQJ B;  1N1J A;  4NE3 A;  5AVB D;  3UTB D;  5GT0 D;  1TZY D;  3AZM B;  3VH6 A;  5CPJ C;  3V9R B;  1P3M C;  5BS7 C;  5B33 B;  5GT3 C;  3UT9 D;  2CV5 C;  5GSU D;  1EQZ D;  4KHA B;  3MNN D;  3REL A;  1P34 B;  5GXQ C;  4M6B A;  3A6N C;  1KX3 B;  5B2I C;  4H9O A;  4WU9 D;  1ID3 B;  1P3A A;  4J8X A;  1U35 A;  3TU4 B;  5CPI C;  3AZL B;  3W98 C;  4R8P D;  1P3K C;  5E5A D;  2IO5 B;  5B0Y A;  5B40 B;  3C1B B;  4XUJ B;  1S32 D;  1WWI A;  1P3O B;  3B6F A;  4WU8 B;  4XZQ D;  1HQ3 A;  3KXB B;  3LEL B;  3X1V D;  1N1J B;  5B0Z C;  3AZK A;  3AZE C;  1M18 D;  3R45 A;  5AVC A;  1P3F C;  3C1C D;  1BH8 A;  1F1E A;  3MGR A;  3AZN C;  5AV5 D;  1P3G A;  3REL B;  3REJ A;  1M1A C;  4H9O B;  5BNX A;  5AVB C;  1P3A B;  1TZY C;  1P3B A;  3LZ0 B;  3X1U A;  4J8X B;  4H9P A;  1U35 B;  5B2J A;  2NZD A;  4EO5 B;  4HGA C;  5GSU C;  4LD9 A;  5B0Y B;  3LJA C;  4WU9 C;  3MGP A;  3AZG A;  5AV8 D;  3B6F B;  3AYW D;  5B31 D;  2FJ7 C;  1HQ3 B;  5CPK A;  1ZLA D;  4DRA A;  4X23 A;  4J8U D;  3AZK B;  5AV9 A;  5E5A C;  3AZF A;  3R45 B;  5AVC B;  5AV6 A;  1S32 C;  2F8N G;  1BH8 B;  2HUE C;  5B1M D;  3MGR B;  3KUY A;  4G91 C;  1P3G B;  3WAA A;  3AN2 A;  3X1T D;  3MVD A;  1KX5 A;  4QLC A;  4XZQ C;  3O62 D;  4J8V D;  3REJ B;  3AZH D;  3AZJ B;  3REH D;  3X1V C;  5BNX B;  4KUD A;  1P3B B;  3X1U B;  4Z66 A;  4H9P B;  5DNN A;  2NZD B;  3C1C C;  3VH6 T;  3REK A;  5AV5 C;  3UTA D;  3B6G A;  1F66 D;  4LD9 B;  4YS3 B;  4YM6 D;  5C3I B;  3W97 D;  3REI D;  3KWQ A;  3MGP B;  5CPJ A;  3AZG B;  1AOI C;  5B2I D;  2HIO A;  5CPK B;  2PYO D;  3WA9 A;  5AV9 B;  5B24 D;  4KGC C;  5F99 A;  3AZF B;  5AV6 B;  1P3I D;  5JA4 A;  3KUY B;  1KX4 D;  3WAA B;  3AN2 B;  4G92 B;  5AV8 C;  1P3P D;  3MVD B;  3AYW C;  1P3L A;  4QLC B;  1KX5 B;  4Z5T C;  3W98 A;  3AV1 D;  1ZLA C;  3B0D C;  4E45 A;  4KUD B;  4J8U C;  5B33 D;  4Z66 B;  2F8N K;  5DNN B;  4H9N A; 
#chains in the Genus database with same CATH topology
 5B1M C;  1P34 D;  3W99 C;  3H0R C;  3X1T C;  4WZS B;  1P3F D;  3AFA A;  1KX3 D;  3B6G B;  4J8V C;  2Y2I A;  5AY8 C;  3AZH C;  5B0Z A;  1ID3 D;  3REH C;  3KWQ B;  5CPJ B;  3TU4 D;  3LEL A;  2HIO B;  2NQB A;  3WA9 B;  4H9Q A;  2YFW A;  4XUJ D;  5GXQ B;  3UTA C;  1F66 C;  5F99 B;  3UTB A;  1P3O D;  5GT0 A;  4YM6 C;  3VH6 W;  4WU8 D;  5JA4 B;  3W97 C;  3REI C;  3AV2 A;  3LJA D;  3KXB D;  5CPI B;  1P3L B;  3X1S D;  3W98 B;  3LZ0 A;  3UT9 A;  3W96 A;  1EQZ A;  2PYO C;  2FJ7 D;  3MNN A;  5B24 C;  4H9N B;  3EPL A;  1P3I C;  5B1L D;  2LY8 A;  1KX4 C;  1P3P C;  5JRG A;  5CP6 A;  3AFA B;  5B0Z B;  4R8P A;  3AV1 C;  1P3A D;  1M19 D;  2L5A A;  3AZM C;  5B33 C;  3AZN B;  2NQB B;  4H9Q B;  1JFI A;  2YFW B;  1P34 C;  2XD1 A;  1T3U A;  1KX3 C;  5BNV A;  4UPK A;  3UTB B;  5AVB B;  1ID3 C;  3B6F D;  5GT0 B;  1Q9C A;  3AZJ A;  3AV2 B;  1M18 A;  2F8N D;  3TU4 C;  3C1C A;  1AOI D;  3LZ1 A;  1B6W A;  5KDM B;  3UT9 B;  3AZK D;  1EQZ B;  3W96 B;  2IO5 C;  2XD5 A;  3MNN B;  5AVC D;  5FUG A;  3MGS A;  3C1B C;  3FDD A;  4XUJ C;  4NFT A;  3MGR D;  1P3G D;  4WV4 B;  1P3O C;  4KGC D;  4YS3 A;  4WU8 C;  4H9S C;  3EPK A;  5JRG B;  3KXB C;  5CP6 B;  5B32 A;  3X1S C;  4H9R A;  4R8P B;  4Z5T D;  5B2J D;  1TAF A;  2NZD D;  3H0M C;  3MGQ D;  4ZUX A;  3AZI D;  3AYW A;  4CAY A;  5B1L C;  4XZQ B;  5B31 A;  1JFI B;  1ZLA A;  5BNV B;  3WKJ D;  2ZY4 A;  3W99 D;  4J8U A;  3AZG D;  1P3A C;  1M19 C;  5AY8 D;  3P5J B;  1M18 B;  2Y2O A;  5BT1 D;  4X23 D;  3C1C B;  5B1M A;  3LZ1 B;  5AV5 B;  5AV9 D;  3O62 A;  4J8W A;  5DNM A;  5FUG B;  3MGS B;  5AV6 D;  4J8V A;  3AZF D;  4JJN D;  5CHL B;  5BO0 A;  3WTP A;  3AN2 D;  3B6F C;  3MVD D;  1KX5 D;  4QLC D;  4ZBJ B;  5B32 B;  4H9R B;  1P3M A;  1ULY A;  5BS7 A;  2ZM5 A;  3UTA A;  3AZK C;  1F66 A;  5GT3 A;  3EG5 B;  5DNN D;  5AVC C;  2CV5 A;  5G49 A;  1TAF B;  3W97 A;  2ARO D;  3MGR C;  3REK D;  4ZUX B;  1P3G C;  2JE5 A;  5GXQ A;  3A6N A;  5B2I A;  3AYW B;  4CAY B;  5B31 B;  1ZLA B;  4AWL C;  2CWE A;  3KWQ D;  4J8U B;  5CPI A;  2HIO D;  5B24 A;  3X1U C;  1P3K A;  3IP4 C;  5B2J C;  3AZM D;  2NZD C;  3WA9 D;  5B1M B;  3MGQ C;  3AZI C;  5F99 D;  3O62 B;  5DNM B;  4J8W B;  4J8V B;  3AZH B;  3AV1 A;  5C3I C;  5BO0 B;  3WKJ C;  3WTP B;  1W2E A;  4Z2M G;  3WTP E;  3MGP C;  3AZG C;  1P3L D;  3VH5 A;  3AZE A;  5CPK C;  5BT1 C;  4X23 C;  1P3M B;  3UTA B;  2YFV A;  1PZR A;  5AV9 C;  1H3O A;  5GT3 B;  3AZL D;  3AZN A;  3AZF C;  1P3F A;  1F66 B;  2F8N H;  5AV6 C;  5G49 B;  2CV5 B;  4JJN C;  3W97 B;  5B40 D;  3C1B D;  1M1A A;  3AN2 C;  3A6N B;  5B2I B;  3AFA D;  3MVD C;  1KX5 C;  4QLC C;  5AVB A;  1TZY A;  4DRB A;  3LEL D;  1BH9 A;  5B24 B;  3NQU B;  1P3K B;  5DNN C;  2NQB D;  5KDM A;  5GSU A;  2ARO C;  3REK C;  3LJA A;  1P3P B;  3B6G C;  1HTA A;  4WU9 A;  3X1S A;  4E44 A;  3AV1 B;  3REL D;  2FJ7 A;  3KWQ C;  3AV2 D;  2HIO C;  3LZ0 D;  3AZE B;  3W96 D;  4J8X D;  5E5A A;  3WA9 C;  1U35 D;  5B1L A;  2YFV B;  1P3F B;  1S32 A;  1H3O B;  5F99 C;  2DF4 C;  1M19 A;  5B0Y D;  4XZQ A;  1M1A B;  5JRG D;  5CP6 D;  1P3L C;  3X1V A;  4UUZ A;  1TZY B;  1HQ3 D;  1BH9 B;  3AZL C;  5AV5 A;  4Z2M H;  4HGA B;  5GSU B;  4DQY B;  5B40 C;  3LJA B;  2F8N A;  3AFA C;  2Y2L A;  4WU9 B;  1AOI A;  3X1S B;  2FJ7 B;  3REJ D;  3AZJ D;  3LEL C;  2BG1 A;  3LZ1 D;  1P3B D;  2NQB C;  2Y2J A;  3X1U D;  4KGC A;  5E5A B;  5B1L B;  3MGS D;  2W8S A;  1S32 B;  2HUE B;  1A7W A;  4G91 B;  3UTB C;  5AV8 A;  4LD9 D;  5GT0 C;  4YS3 D;  1M19 B;  3REL C;  4Z5T A;  3AV2 C;  3X1V B;  4UUZ B;  5B32 D;  3MGP D;  3MGQ A;  3LZ0 C;  2RVQ D;  3UT9 C;  3W96 C;  2BYM A;  3VH5 T;  4J8X C;  3AZI A;  1EQZ C;  1U35 C;  3MNN C;  5CPK D;  3B0C T;  3WKJ A;  4EO5 C;  4ZUX D;  3W99 A;  3X1T A;  5B0Y C;  5AY8 A;  3AZH A;  1B67 A;  2F8N B;  3REH A;  2RIQ A;  5JRG C;  5CP6 C;  3KUY D;  1AOI B;  3WAA D;  4R8P C;  4WNN A;  1HQ3 C;  4CSR A;  4JJN A;  3B0B A;  4KUD D;  3A1I A;  4KGC B;  4Z66 D;  2Y2G A;  5DNM D;  4J8W D;  1BFM A;  4YM6 A;  3KFU G;  4AWL B;  3REI A;  3WTP D;  3EPH A;  5AV8 B;  3B6G D;  5B32 G;  2DQN C;  2VQR A;  4Z5T B;  3REJ C;  3AZJ C;  1M18 C;  2Y2N A;  5B2J B;  2PYO A;  3B0D B;  2ARO A;  5CPJ D;  3MGQ B;  3LZ1 C;  1P3M D;  1P3B C;  3AZI B;  2BYM B;  2BYK A;  3NQU A;  5GT3 D;  2G5I C;  3MGS C;  2CV5 D;  5B31 G;  1P3I A;  3WKJ B;  1KX4 A;  3W99 B;  5GXQ D;  3X1T B;  3A6N D;  1P3P A;  3NQJ A;  4YS3 C;  4LD9 C;  5AY8 B;  4ZBJ C;  3REH B;  3AZM A;  1KU5 A;  4X23 B;  5B32 C;  3V9R A;  5CPI D;  4WNN B;  2RVQ C;  5B33 A;  3W98 D;  2FFF B;  1P3K D;  4CSR B;  4KHA A;  4JJN B;  2Y2Q A;  4ZUX C;  1P34 A;  3VH5 W;  4WJ3 C;  3KSY A;  1KX3 A;  5B31 C;  1ID3 A;  4NE5 A;  3B0C W;  4YM6 B;  3REI B;  3KUY C;  3WAA C;  2JSS A;  4G92 C;  3TU4 A;  3AZL A;  5B0Z D;  3AZE D;  2PYO B;  1WWS A;  2ARO B;  5B40 A;  3REK B;  3C1B A;  4KUD C;  4XUJ A;  2BYK B;  4Z66 C;  3AZN D;  3O62 C;  4J8W C;  5DNM C;  1P3O A;  4WU8 A;  1P3I B;  1R4V A;  1M1A D;  3WTP C;  4NE6 A;  4H9S A;  1KX4 B;  3KXB A;  3NQJ B;  1N1J A;  4NE3 A;  5AVB D;  3UTB D;  1Z2C B;  5GT0 D;  1TZY D;  3AZM B;  3VH6 A;  5CPJ C;  3V9R B;  1P3M C;  5BS7 C;  2Y2K A;  5B33 B;  5GT3 C;  3UT9 D;  2CV5 C;  5GSU D;  1EQZ D;  4KHA B;  3MNN D;  3REL A;  1P34 B;  5GXQ C;  4M6B A;  3A6N C;  1KX3 B;  5B2I C;  3A1K A;  4H9O A;  4WU9 D;  1ID3 B;  1P3A A;  4J8X A;  2Y2H A;  1U35 A;  3TU4 B;  5CPI C;  3AZL B;  3W98 C;  4R8P D;  1P3K C;  5E5A D;  2IO5 B;  5B0Y A;  5B40 B;  3C1B B;  4XUJ B;  1S32 D;  1WWI A;  1P3O B;  3B6F A;  2F2A C;  4WU8 B;  4XZQ D;  1HQ3 A;  3KXB B;  3LEL B;  3X1V D;  1N1J B;  5B0Z C;  2UWX A;  3AZK A;  3AZE C;  1M18 D;  3R45 A;  5AVC A;  1P3F C;  3C1C D;  1BH8 A;  1F1E A;  3MGR A;  3AZN C;  5AV5 D;  1P3G A;  3REL B;  3REJ A;  1M1A C;  4H9O B;  5BNX A;  5AVB C;  2ZY3 A;  1P3A B;  1TZY C;  1P3B A;  3LZ0 B;  3X1U A;  4J8X B;  3AL0 C;  4H9P A;  1U35 B;  2G5H C;  5B2J A;  2NZD A;  4EO5 B;  4HGA C;  5GSU C;  4LD9 A;  5B0Y B;  3LJA C;  4WU9 C;  3MGP A;  3AZG A;  5AV8 D;  3B6F B;  3AYW D;  5B31 D;  2FJ7 C;  1HQ3 B;  5CPK A;  1ZLA D;  4DRA A;  4X23 A;  4J8U D;  3AZK B;  2ZY5 A;  5AV9 A;  5E5A C;  3AZF A;  3R45 B;  5AVC B;  3F6T A;  5AV6 A;  1S32 C;  2Y2P A;  1BH8 B;  2HUE C;  5B1M D;  3MGR B;  3KUY A;  4G91 C;  1P3G B;  2F8N G;  3AN2 A;  3X1T D;  3WAA A;  3MVD A;  1KX5 A;  4QLC A;  4XZQ C;  3O62 D;  4J8V D;  3REJ B;  3AZH D;  3AZJ B;  3REH D;  3EPJ A;  3X1V C;  5BNX B;  4KUD A;  1P3B B;  3X1U B;  4Z66 A;  4H9P B;  5DNN A;  3H0L C;  2NZD B;  3C1C C;  3VH6 T;  3REK A;  5AV5 C;  3UTA D;  3B6G A;  1F66 D;  4LD9 B;  4YS3 B;  4YM6 D;  5C3I B;  3W97 D;  3REI D;  3KWQ A;  3MGP B;  5CPJ A;  3AZG B;  1AOI C;  2J8P A;  5B2I D;  2HIO A;  5CPK B;  2PYO D;  3WA9 A;  5AV9 B;  5B24 D;  4KGC C;  5F99 A;  3AZF B;  5AV6 B;  1P3I D;  5JA4 A;  3KUY B;  1KX4 D;  3WAA B;  3AN2 B;  4G92 B;  5AV8 C;  2Y2M A;  1P3P D;  3MVD B;  2ZY2 A;  3AYW C;  4QLC B;  1P3L A;  1KX5 B;  4Z5T C;  3W98 A;  3AV1 D;  2JCH A;  1ZLA C;  3B0D C;  4E45 A;  4KUD B;  4J8U C;  5B33 D;  4Z66 B;  2F8N K;  5DNN B;  4H9N A; 
#chains in the Genus database with same CATH homology
 5B1M C;  1P34 D;  3W99 C;  3H0R C;  3X1T C;  4WZS B;  1P3F D;  3AFA A;  1KX3 D;  3B6G B;  4J8V C;  2Y2I A;  5AY8 C;  3AZH C;  5B0Z A;  1ID3 D;  3REH C;  3KWQ B;  5CPJ B;  3TU4 D;  3LEL A;  2HIO B;  2NQB A;  3WA9 B;  4H9Q A;  2YFW A;  4XUJ D;  5GXQ B;  3UTA C;  1F66 C;  5F99 B;  3UTB A;  1P3O D;  5GT0 A;  4YM6 C;  3VH6 W;  4WU8 D;  5JA4 B;  3W97 C;  3REI C;  3AV2 A;  3LJA D;  3KXB D;  5CPI B;  1P3L B;  3X1S D;  3W98 B;  3LZ0 A;  3UT9 A;  3W96 A;  1EQZ A;  2PYO C;  2FJ7 D;  3MNN A;  5B24 C;  4H9N B;  3EPL A;  1P3I C;  5B1L D;  2LY8 A;  1KX4 C;  1P3P C;  5JRG A;  5CP6 A;  3AFA B;  5B0Z B;  4R8P A;  3AV1 C;  1P3A D;  1M19 D;  2L5A A;  3AZM C;  5B33 C;  3AZN B;  2NQB B;  4H9Q B;  1JFI A;  2YFW B;  1P34 C;  2XD1 A;  1T3U A;  1KX3 C;  5BNV A;  4UPK A;  3UTB B;  5AVB B;  1ID3 C;  3B6F D;  5GT0 B;  1Q9C A;  3AZJ A;  3AV2 B;  1M18 A;  2F8N D;  3TU4 C;  3C1C A;  1AOI D;  3LZ1 A;  1B6W A;  5KDM B;  3UT9 B;  3AZK D;  1EQZ B;  3W96 B;  2IO5 C;  2XD5 A;  3MNN B;  5AVC D;  5FUG A;  3MGS A;  3C1B C;  3FDD A;  4XUJ C;  4NFT A;  3MGR D;  1P3G D;  4WV4 B;  1P3O C;  4KGC D;  4YS3 A;  4WU8 C;  4H9S C;  3EPK A;  5JRG B;  3KXB C;  5CP6 B;  5B32 A;  3X1S C;  4H9R A;  4R8P B;  4Z5T D;  5B2J D;  1TAF A;  2NZD D;  3H0M C;  3MGQ D;  4ZUX A;  3AZI D;  3AYW A;  4CAY A;  5B1L C;  4XZQ B;  5B31 A;  1JFI B;  1ZLA A;  5BNV B;  3WKJ D;  2ZY4 A;  3W99 D;  4J8U A;  3AZG D;  1P3A C;  1M19 C;  5AY8 D;  3P5J B;  1M18 B;  2Y2O A;  5BT1 D;  4X23 D;  3C1C B;  5B1M A;  3LZ1 B;  5AV5 B;  5AV9 D;  3O62 A;  4J8W A;  5DNM A;  5FUG B;  3MGS B;  5AV6 D;  4J8V A;  3AZF D;  4JJN D;  5CHL B;  5BO0 A;  3WTP A;  3AN2 D;  3B6F C;  3MVD D;  1KX5 D;  4QLC D;  4ZBJ B;  5B32 B;  4H9R B;  1P3M A;  1ULY A;  5BS7 A;  2ZM5 A;  3UTA A;  3AZK C;  1F66 A;  5GT3 A;  3EG5 B;  5DNN D;  5AVC C;  2CV5 A;  5G49 A;  1TAF B;  3W97 A;  2ARO D;  3MGR C;  3REK D;  4ZUX B;  1P3G C;  2JE5 A;  5GXQ A;  3A6N A;  5B2I A;  3AYW B;  4CAY B;  5B31 B;  1ZLA B;  4AWL C;  2CWE A;  3KWQ D;  4J8U B;  5CPI A;  2HIO D;  5B24 A;  3X1U C;  1P3K A;  3IP4 C;  5B2J C;  3AZM D;  2NZD C;  3WA9 D;  5B1M B;  3MGQ C;  3AZI C;  5F99 D;  3O62 B;  5DNM B;  4J8W B;  4J8V B;  3AZH B;  3AV1 A;  5C3I C;  5BO0 B;  3WKJ C;  3WTP B;  1W2E A;  4Z2M G;  3WTP E;  3MGP C;  3AZG C;  1P3L D;  3VH5 A;  3AZE A;  5CPK C;  5BT1 C;  4X23 C;  1P3M B;  3UTA B;  2YFV A;  1PZR A;  5AV9 C;  1H3O A;  5GT3 B;  3AZL D;  3AZN A;  3AZF C;  1P3F A;  1F66 B;  2F8N H;  5AV6 C;  5G49 B;  2CV5 B;  4JJN C;  3W97 B;  5B40 D;  3C1B D;  1M1A A;  3AN2 C;  3A6N B;  5B2I B;  3AFA D;  3MVD C;  1KX5 C;  4QLC C;  5AVB A;  1TZY A;  4DRB A;  3LEL D;  1BH9 A;  5B24 B;  3NQU B;  1P3K B;  5DNN C;  2NQB D;  5KDM A;  5GSU A;  2ARO C;  3REK C;  3LJA A;  1P3P B;  3B6G C;  1HTA A;  4WU9 A;  3X1S A;  4E44 A;  3AV1 B;  3REL D;  2FJ7 A;  3KWQ C;  3AV2 D;  2HIO C;  3LZ0 D;  3AZE B;  3W96 D;  4J8X D;  5E5A A;  3WA9 C;  1U35 D;  5B1L A;  2YFV B;  1P3F B;  1S32 A;  1H3O B;  5F99 C;  2DF4 C;  1M19 A;  5B0Y D;  4XZQ A;  1M1A B;  5JRG D;  5CP6 D;  1P3L C;  3X1V A;  4UUZ A;  1TZY B;  1HQ3 D;  1BH9 B;  3AZL C;  5AV5 A;  4Z2M H;  4HGA B;  5GSU B;  4DQY B;  5B40 C;  3LJA B;  2F8N A;  3AFA C;  2Y2L A;  4WU9 B;  1AOI A;  3X1S B;  2FJ7 B;  3REJ D;  3AZJ D;  3LEL C;  2BG1 A;  3LZ1 D;  1P3B D;  2NQB C;  2Y2J A;  3X1U D;  4KGC A;  5E5A B;  5B1L B;  3MGS D;  2W8S A;  1S32 B;  2HUE B;  1A7W A;  4G91 B;  3UTB C;  5AV8 A;  4LD9 D;  5GT0 C;  4YS3 D;  1M19 B;  3REL C;  4Z5T A;  3AV2 C;  3X1V B;  4UUZ B;  5B32 D;  3MGP D;  3MGQ A;  3LZ0 C;  2RVQ D;  3UT9 C;  3W96 C;  2BYM A;  3VH5 T;  4J8X C;  3AZI A;  1EQZ C;  1U35 C;  3MNN C;  5CPK D;  3B0C T;  3WKJ A;  4EO5 C;  4ZUX D;  3W99 A;  3X1T A;  5B0Y C;  5AY8 A;  3AZH A;  1B67 A;  2F8N B;  3REH A;  2RIQ A;  5JRG C;  5CP6 C;  3KUY D;  1AOI B;  3WAA D;  4R8P C;  4WNN A;  1HQ3 C;  4CSR A;  4JJN A;  3B0B A;  4KUD D;  3A1I A;  4KGC B;  4Z66 D;  2Y2G A;  5DNM D;  4J8W D;  1BFM A;  4YM6 A;  3KFU G;  4AWL B;  3REI A;  3WTP D;  3EPH A;  5AV8 B;  3B6G D;  5B32 G;  2DQN C;  2VQR A;  4Z5T B;  3REJ C;  3AZJ C;  1M18 C;  2Y2N A;  5B2J B;  2PYO A;  3B0D B;  2ARO A;  5CPJ D;  3MGQ B;  3LZ1 C;  1P3M D;  1P3B C;  3AZI B;  2BYM B;  2BYK A;  3NQU A;  5GT3 D;  2G5I C;  3MGS C;  2CV5 D;  5B31 G;  1P3I A;  3WKJ B;  1KX4 A;  3W99 B;  5GXQ D;  3X1T B;  3A6N D;  1P3P A;  3NQJ A;  4YS3 C;  4LD9 C;  5AY8 B;  4ZBJ C;  3REH B;  3AZM A;  1KU5 A;  4X23 B;  5B32 C;  3V9R A;  5CPI D;  4WNN B;  2RVQ C;  5B33 A;  3W98 D;  2FFF B;  1P3K D;  4CSR B;  4KHA A;  4JJN B;  2Y2Q A;  4ZUX C;  1P34 A;  3VH5 W;  4WJ3 C;  3KSY A;  1KX3 A;  5B31 C;  1ID3 A;  4NE5 A;  3B0C W;  4YM6 B;  3REI B;  3KUY C;  3WAA C;  2JSS A;  4G92 C;  3TU4 A;  3AZL A;  5B0Z D;  3AZE D;  2PYO B;  1WWS A;  2ARO B;  5B40 A;  3REK B;  3C1B A;  4KUD C;  4XUJ A;  2BYK B;  4Z66 C;  3AZN D;  3O62 C;  4J8W C;  5DNM C;  1P3O A;  4WU8 A;  1P3I B;  1R4V A;  1M1A D;  3WTP C;  4NE6 A;  4H9S A;  1KX4 B;  3KXB A;  3NQJ B;  1N1J A;  4NE3 A;  5AVB D;  3UTB D;  1Z2C B;  5GT0 D;  1TZY D;  3AZM B;  3VH6 A;  5CPJ C;  3V9R B;  1P3M C;  5BS7 C;  2Y2K A;  5B33 B;  5GT3 C;  3UT9 D;  2CV5 C;  5GSU D;  1EQZ D;  4KHA B;  3MNN D;  3REL A;  1P34 B;  5GXQ C;  4M6B A;  3A6N C;  1KX3 B;  5B2I C;  3A1K A;  4H9O A;  4WU9 D;  1ID3 B;  1P3A A;  4J8X A;  2Y2H A;  1U35 A;  3TU4 B;  5CPI C;  3AZL B;  3W98 C;  4R8P D;  1P3K C;  5E5A D;  2IO5 B;  5B0Y A;  5B40 B;  3C1B B;  4XUJ B;  1S32 D;  1WWI A;  1P3O B;  3B6F A;  2F2A C;  4WU8 B;  4XZQ D;  1HQ3 A;  3KXB B;  3LEL B;  3X1V D;  1N1J B;  5B0Z C;  2UWX A;  3AZK A;  3AZE C;  1M18 D;  3R45 A;  5AVC A;  1P3F C;  3C1C D;  1BH8 A;  1F1E A;  3MGR A;  3AZN C;  5AV5 D;  1P3G A;  3REL B;  3REJ A;  1M1A C;  4H9O B;  5BNX A;  5AVB C;  2ZY3 A;  1P3A B;  1TZY C;  1P3B A;  3LZ0 B;  3X1U A;  4J8X B;  3AL0 C;  4H9P A;  1U35 B;  2G5H C;  5B2J A;  2NZD A;  4EO5 B;  4HGA C;  5GSU C;  4LD9 A;  5B0Y B;  3LJA C;  4WU9 C;  3MGP A;  3AZG A;  5AV8 D;  3B6F B;  3AYW D;  5B31 D;  2FJ7 C;  1HQ3 B;  5CPK A;  1ZLA D;  4DRA A;  4X23 A;  4J8U D;  3AZK B;  2ZY5 A;  5AV9 A;  5E5A C;  3AZF A;  3R45 B;  5AVC B;  3F6T A;  5AV6 A;  1S32 C;  2Y2P A;  1BH8 B;  2HUE C;  5B1M D;  3MGR B;  3KUY A;  4G91 C;  1P3G B;  2F8N G;  3AN2 A;  3X1T D;  3WAA A;  3MVD A;  1KX5 A;  4QLC A;  4XZQ C;  3O62 D;  4J8V D;  3REJ B;  3AZH D;  3AZJ B;  3REH D;  3EPJ A;  3X1V C;  5BNX B;  4KUD A;  1P3B B;  3X1U B;  4Z66 A;  4H9P B;  5DNN A;  3H0L C;  2NZD B;  3C1C C;  3VH6 T;  3REK A;  5AV5 C;  3UTA D;  3B6G A;  1F66 D;  4LD9 B;  4YS3 B;  4YM6 D;  5C3I B;  3W97 D;  3REI D;  3KWQ A;  3MGP B;  5CPJ A;  3AZG B;  1AOI C;  2J8P A;  5B2I D;  2HIO A;  5CPK B;  2PYO D;  3WA9 A;  5AV9 B;  5B24 D;  4KGC C;  5F99 A;  3AZF B;  5AV6 B;  1P3I D;  5JA4 A;  3KUY B;  1KX4 D;  3WAA B;  3AN2 B;  4G92 B;  5AV8 C;  2Y2M A;  1P3P D;  3MVD B;  2ZY2 A;  3AYW C;  4QLC B;  1P3L A;  1KX5 B;  4Z5T C;  3W98 A;  3AV1 D;  2JCH A;  1ZLA C;  3B0D C;  4E45 A;  4KUD B;  4J8U C;  5B33 D;  4Z66 B;  2F8N K;  5DNN B;  4H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...