5G49A

Crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
96
Chain Sequence
GSHMTVREQDRFMPIANVIRIMRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
publication title Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 33
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5g49A00
3AYWD 4WU8A 4QLCC 3UT9A 4G92B 3REKC 1M19B 1H3OA 3AZIC 1BH9A 5B40C 3MVDA 1JFIB 4EO5B 4J8UC 2L5AA 4WNNB 5AY8B 3LZ0A 5AV8C 2AROD 5B1MB 1KX3B 3X1SB 5G49B 4CSRA 5GXQB 5AVBA 3VH6W 5AV6C 4H9SC 1F66A 2PYOA 3C1BD 2F8NA 1TAFA 5BNXB 3A6NB 1HQ3D 5FUGA 1P3GB 4KGCD 5B2IB 4LD9A 1F66C 3UTAB 3MGSC 2HIOD 4J8WD 1P3OA 4WU9C 4R8PC 4YS3A 3R45A 3AZMD 4J8XB 1P3KB 2F8NH 1P3OC 4E44A 5B31A 4YS3C 3AZKB 1P3BA 4M6BA 5B0ZA 5B33C 3O62C 5CPIB 5CPJB 1KX4A 3UT9B 1P3BC 4G91C 4ZBJC 1BH9B 1KU5A 5C3IC 5B0YA 3W96B 1KX5A 3VH5A 3MVDB 3VH5T 2BYKA 4YM6B 3AZNA 5AY8D 3NQUA 3AN2A 1P3MB 1KX3D 3LJAC 1KX5C 3AZHC 5GT0A 4XUJA 3AZEC 3AV2A 5AVCA 4X23B 5GXQD 1ZLAB 5GT0C 4NE5A 3A6ND 4JJNB 1P3GD 4AWLB 2PYOB 3AV1A 5B2ID 5FUGB 1M18C 3MGRA 4H9OA 4LD9B 3UTAD 4Z66D 3X1UA 3KWQB 5AV5A 3MGPA 5BS7A 3REHD 3REJD 3WTPB 3AV1C 1S32B 1BFMA 4J8XD 1P3KD 3WAAC 3MGPC 3B0DB 3REIB 3LZ1D 5B1LD 3AZKD 3AFAB 5B32B 1Q9CA 5CPID 1F1EA 4Z2MG 5KDMA 5CPJD 5B24A 2IO5C 3WTPE 4WZSB 3W96D 3MVDD 5B0YB 2F8NK 1P3IA 2AROC 4YM6D 3B6FD 2YFWA 1P3MD 3WA9B 3KUYA 5DNNB 3AZNB 4XZQD 2CV5A 1P3IC 1EQZA 3WKJA 4X23D 5BT1D 3AV2B 3C1BC 5AVCB 5F99A 1HQ3C 1ZLAD 1U35D 4KGCC 3B6GD 4H9QA 4JJND 4H9RA 5AV9C 2NQBA 3W99B 2HIOC 4J8WC 3AZJB 4H9OB 3KWQD 1S32D 3WTPD 3X1UB 3V9RA 3MGQA 3X1TC 5BNVA 4CAYA 1P3PA 1P3AA 3REID 1P3FA 3AZGA 4KUDC 3MGQC 3KXBD 3W97A 3AFAD 5B32D 1TZYB 3AZGC 1P34A 3VH6A 3VH6T 3LELA 5KDMB 3W97C 1ID3A 2FJ7B 1P34C 4EO5C 4QLCA 5B2JD 3REKA 1ID3C 5CP6A 3NQJB 5B40A 3AZIA 5B32G 3WA9D 5DNND 3AZLD 2YFWB 3RELB 3X1VC 5CP6C 3KUYB 5GSUC 4J8UA 3TU4A 5GXQC 1P3LB 2CV5B 3AV2D 1AOIC 5AVCD 4H9PA 5AV8A 1P3GC 2HUEC 3TU4C 4H9QB 3W99D 4Z66C 5JRGA 3MNNB 3AZJD 3REJC 3REHC 5AV6A 4H9SA 4Z5TB 5E5AC 4J8XC 5JRGC 4UUZA 5BNVB 3LZ1C 5B1LC 3MGSA 3AZKC 5BO0A 5DNMD 1P3PB 1P3AB 4WU9A 4R8PA 1P3FB 5CPIC 5CPKA 5GT3B 3C1CB 1TZYD 4ZUXC 3UTBB 3W98B 3LELB 5CPKC 2FJ7D 3W96C 5JA4A 5B33A 3O62A 4QLCB 4YM6C 3B6FC 1P3MC 4XZQC 4HGAB 4WU8B 4E45A 1M19D 4X23C 3RELD 3KUYD 5BT1C 1P3LD 1H3OB 1U35C 3B6GC 4JJNC 3LJAA 3AZHA 3AZEA 1M1AC 3B0BA 3MNND 5B1MD 1S32C 4J8VA 3X1SD 3LZ0B 3AZFC 5AV6B 4Z5TD 4CSRB 1M18A 2NZDC 3B0DC 4J8VC 5AVBB 4UUZB 3KXBC 3AFAC 1F66B 5B32C 2F8NB 1TAFB 1P3FD 5BO0B 1N1JA 5GT3D 3C1CD 3WAAA 3UTBD 3W98D 1P3OB 3AYWA 3LELD 5B2JC 4YS3B 2YFVA 3R45B 5B33B 3AYWC 3WA9C 5B31B 1B6WA 5DNNC 1P3BB 3AZLC 4H9NA 4WU8D 5B0ZB 4G91B 3UT9D 2BYMA 1KX4B 5C3IB 2AROA 3W99C 3LJAB 1KX5B 3AZEB 2BYKB 3C1BA 3NQUB 1HQ3A 3LZ0D 3AN2B 4KGCA 5GT0B 4XUJB 5AV9A 2HIOA 4J8WA 5DNMC 1M18B 5AVBD 1F66D 3B0CW 2PYOD 2F8ND 3X1TA 3AV1B 4LD9D 3MGRB 4KUDA 3MGPB 5AV5B 3AZMC 1P3OD 2FJ7C 4YS3D 1R4VA 2YFVB 5B33D 4G92C 5B31D 4NFTA 1P3BD 1JFIA 1M19C 3RELC 5B0ZD 1P3LC 1KX4D 5B24B 1KX3A 5G49A 4KHAA 5B0YD 5AY8C 3X1VA 3LJAD 1KX5D 3MNNC 5GSUA 5B1MC 1KX3C 5B31G 5GXQA 3X1SC 1P3IB 1AOIA 3AZND 3AN2D 1P3GA 5GT0D 4XUJD 1EQZB 3WKJB 4Z66A 3A6NC 3REJA 5AV9B 3REHA 5B2IC 1M18D 5F99B 5E5AA 3C1CC 3UTAC 4H9RB 4J8XA 3AV1D 1P3KA 2NQBB 3MGRD 3X1TB 3W98C 3LZ1A 5B1LA 3AZKA 3X1UD 3MGPD 5AV5D 4Z2MH 1P3KC 5CPIA 4KUDB 3MGQB 3V9RB 5CPJA 4CAYB 4ZUXA 3AZGB 4HGAC 4WU8C 5CPJC 3UT9C 3W97B 3W96A 1ULYA 1P34B 4YM6A 3B6FA 5B24D 1P3MA 1ID3B 4XZQA 3MVDC 2CWEA 4X23A 1WWSA 3REKB 4KHAB 3X1VB 5CP6B 3LZ0C 3AZIB 5GSUB 5B40B 1U35A 1P3ID 1ZLAA 3B6GA 4JJNA 1AOIB 2CV5D 4NE3A 1EQZD 1ZLAC 3WKJD 2HUEB 4J8UB 3TU4B 1A7WA 5AVBC 1M1AA 3KWQA 4AWLC 5AV9D 1S32A 2PYOC 4Z66B 4H9PB 5F99D 1BH8A 5AV8B 3WTPA 3REJB 3REHB 3AZFA 4LD9C 3KWQC 5E5AB 2NQBD 2NZDA 3REIA 3WTPC 3X1TD 5JRGB 3KXBA 3AFAA 5B32A 3LZ1B 5B1LB 4KUDD 3MGQD 3REIC 1B67A 1P3PD 4NE6A 5B31C 1P3AD 3MGSB 3AZGD 2RVQD 4DRAA 4WU9B 5B2JA 4ZUXB 5B0ZC 4R8PB 3W97D 5CPKB 1KX4C 1P34D 3B0CT 3WA9A 1ID3D 3B6FB 5DNNA 3AZLA 5B0YC 1HTAA 5JA4B 4QLCD 4XZQB 3O62B 3REKD 3AZNC 3AN2C 3X1VD 5CP6D 3AZID 5GSUD 5B40D 4ZBJB 1AOID 1U35B 4XUJC 3B6GB 3AV2C 3W99A 5AVCC 3AZJA 4J8UD 3TU4D 1M1AB 5AV8D 3AZHB 3AZJC 1BH8B 3MGRC 3AZFB 5E5AD 5JRGD 3X1UC 5DNMA 5AV5C 5BS7C 4J8VB 5AV6D 2NZDB 3KXBB 1TZYA 3VH5W 3MGSD 3AZMA 2FJ7A 1TZYC 4WU9D 4ZUXD 4R8PD 1N1JB 5B2JB 5CPKD 5B24C 3WAAB 3NQJA 3AYWB 1WWIA 3RELA 1M19A 3O62D 3AZLB 2F8NG 1P3LA 3KUYC 2IO5B 4H9NB 2CV5C 1EQZC 4WNNA 5AY8A 3WKJC 2BYMB 3MNNA 5B1MA 3X1SA 5F99C 2AROB 1M1AD 4Z5TA 4DRBA 3AZHD 2NQBC 3AZED 3AZFD 5BNXA 3A6NA 4Z5TC 5B2IA 3C1BB 2NZDD 4J8VD 1HQ3B 3KSYA 2JSSA 5DNMB 4KGCB 5GT3A 3C1CA 2LY8A 3UTAA 1P3PC 1P3AC 3UTBA 4WV4B 2HIOB 4J8WB 1P3FC 2RVQC 3W98A 5GT3C 5CHLB 3AZMB 3UTBC 3LELC 3WAAD
chains in the Genus database with same CATH superfamily
3AYWD 4WU8A 4QLCC 3UT9A 4G92B 3REKC 1M19B 1H3OA 3AZIC 1BH9A 5B40C 3MVDA 1JFIB 2VQRA 2ZY5A 4EO5B 4J8UC 2L5AA 4WNNB 5AY8B 3LZ0A 5AV8C 2AROD 5B1MB 1KX3B 3X1SB 5G49B 4CSRA 5GXQB 5AVBA 3VH6W 5AV6C 4H9SC 1F66A 2PYOA 3C1BD 2F8NA 1TAFA 5BNXB 3A6NB 1HQ3D 5FUGA 1P3GB 4KGCD 5B2IB 4LD9A 1F66C 3UTAB 2Y2MA 2HIOD 3MGSC 4J8WD 1P3OA 4WU9C 4R8PC 4YS3A 3R45A 3AZMD 4J8XB 1P3KB 2F8NH 1P3OC 3P5JB 4E44A 5B31A 4YS3C 3AZKB 1P3BA 4M6BA 3F6TA 5B0ZA 5B33C 3O62C 5CPIB 2Y2LA 5CPJB 1KX4A 3UT9B 1P3BC 4G91C 4ZBJC 1BH9B 1KU5A 5C3IC 5B0YA 3W96B 1KX5A 3VH5A 3MVDB 3VH5T 2BYKA 4YM6B 3AZNA 5AY8D 3NQUA 3AN2A 1P3MB 1KX3D 3LJAC 2ZM5A 1KX5C 3AZHC 5GT0A 4XUJA 3AZEC 3AV2A 5AVCA 4X23B 2Y2HA 5GXQD 1ZLAB 5GT0C 4NE5A 3A6ND 2ZY4A 4JJNB 1P3GD 4AWLB 3EG5B 3AV1A 5B2ID 2PYOB 2JE5A 5FUGB 1M18C 3MGRA 4H9OA 4LD9B 3UTAD 4Z66D 3X1UA 3H0LC 3KWQB 5AV5A 3MGPA 5BS7A 3REHD 3REJD 3WTPB 3AV1C 1S32B 1BFMA 4J8XD 1P3KD 3WAAC 3MGPC 3B0DB 3REIB 3LZ1D 5B1LD 3AZKD 3AFAB 5B32B 1Q9CA 5CPID 1F1EA 4Z2MG 5KDMA 5CPJD 5B24A 2IO5C 3WTPE 4WZSB 3W96D 3MVDD 5B0YB 2F8NK 1P3IA 2AROC 4YM6D 3B6FD 2YFWA 1P3MD 3WA9B 3KUYA 5DNNB 3AZNB 4XZQD 2CV5A 1P3IC 1EQZA 3WKJA 4X23D 5BT1D 3AV2B 3C1BC 5AVCB 5F99A 1HQ3C 1ZLAD 1U35D 4KGCC 3B6GD 4H9QA 4JJND 4H9RA 5AV9C 2NQBA 3W99B 1W2EA 2HIOC 4J8WC 2Y2OA 3AZJB 4H9OB 3KWQD 1S32D 3WTPD 3X1UB 3V9RA 3MGQA 3X1TC 5BNVA 4CAYA 1P3PA 1P3AA 3REID 1P3FA 3AZGA 4KUDC 3MGQC 3KXBD 3W97A 3AFAD 5B32D 1TZYB 3AZGC 1P34A 3VH6A 3VH6T 3LELA 5KDMB 3W97C 1ID3A 2FJ7B 1P34C 4EO5C 4QLCA 5B2JD 3REKA 1ID3C 5CP6A 3NQJB 5B40A 3AZIA 2DF4C 5B32G 3WA9D 5DNND 3AZLD 2YFWB 3RELB 3X1VC 5CP6C 3KUYB 5GSUC 4J8UA 3TU4A 5GXQC 1P3LB 2CV5B 3AV2D 1AOIC 5AVCD 4H9PA 5AV8A 1P3GC 2XD5A 2HUEC 3TU4C 4H9QB 3W99D 4Z66C 5JRGA 3MNNB 3AZJD 3REJC 3REHC 5AV6A 4H9SA 4Z5TB 3A1KA 5E5AC 4J8XC 5JRGC 4UUZA 5BNVB 3LZ1C 5B1LC 3MGSA 3AZKC 5BO0A 5DNMD 1P3PB 1P3AB 4WU9A 4R8PA 1P3FB 5CPIC 5CPKA 2Y2GA 5GT3B 3C1CB 1TZYD 4ZUXC 2Y2PA 3UTBB 3W98B 3LELB 5CPKC 2FJ7D 3W96C 5JA4A 5B33A 3O62A 2DQNC 4QLCB 4YM6C 3B6FC 1Z2CB 1P3MC 4XZQC 4HGAB 4WU8B 4E45A 1M19D 4X23C 3RELD 3KUYD 5BT1C 1PZRA 1P3LD 1H3OB 1U35C 3B6GC 4JJNC 2J8PA 3LJAA 3AZHA 3AZEA 1M1AC 3B0BA 3MNND 5B1MD 1S32C 4J8VA 3X1SD 3LZ0B 3AZFC 5AV6B 4Z5TD 4CSRB 1M18A 2NZDC 3B0DC 4J8VC 5AVBB 2Y2KA 4UUZB 3KXBC 3AFAC 1F66B 5B32C 2F8NB 1TAFB 1P3FD 5BO0B 1N1JA 5GT3D 3C1CD 3WAAA 3UTBD 3W98D 1P3OB 3AYWA 3LELD 5B2JC 4YS3B 2YFVA 3R45B 5B33B 3AYWC 3WA9C 5B31B 1B6WA 5DNNC 1P3BB 3AZLC 4H9NA 4WU8D 5B0ZB 4G91B 3UT9D 2BYMA 2FFFB 1KX4B 5C3IB 2AROA 3A1IA 2G5HC 3W99C 3LJAB 1KX5B 3AZEB 2BYKB 3C1BA 3NQUB 1HQ3A 3LZ0D 3AN2B 4KGCA 2ZY2A 5GT0B 4XUJB 5AV9A 1T3UA 2HIOA 4J8WA 5DNMC 1M18B 5AVBD 2RIQA 3B0CW 1F66D 2PYOD 2F8ND 4DQYB 3X1TA 3AV1B 4LD9D 3MGRB 4KUDA 3MGPB 5AV5B 3AZMC 1P3OD 2FJ7C 3KFUG 4YS3D 1R4VA 2YFVB 5B33D 4G92C 5B31D 4NFTA 1P3BD 1JFIA 1M19C 3RELC 5B0ZD 1P3LC 1KX4D 5B24B 2XD1A 2BG1A 1KX3A 5G49A 4KHAA 5B0YD 5AY8C 3X1VA 3LJAD 1KX5D 3MNNC 5GSUA 5B1MC 1KX3C 5B31G 5GXQA 3X1SC 3EPLA 1P3IB 1AOIA 3AZND 3AN2D 1P3GA 2JCHA 4XUJD 5GT0D 1EQZB 3WKJB 4Z66A 3A6NC 3AL0C 3EPKA 3REJA 5AV9B 3REHA 5B2IC 2Y2IA 1M18D 5F99B 2Y2QA 5E5AA 3C1CC 3UTAC 4H9RB 4J8XA 3AV1D 1P3KA 2NQBB 3MGRD 3X1TB 3W98C 3LZ1A 5B1LA 2Y2NA 3AZKA 3X1UD 3MGPD 5AV5D 4Z2MH 1P3KC 5CPIA 4KUDB 3MGQB 3V9RB 5CPJA 4CAYB 4ZUXA 3AZGB 4HGAC 4WU8C 5CPJC 2ZY3A 3UT9C 3W97B 3W96A 1ULYA 1P34B 4YM6A 3B6FA 5B24D 1P3MA 1ID3B 4XZQA 3MVDC 2CWEA 4X23A 1WWSA 3REKB 4KHAB 3X1VB 5CP6B 3LZ0C 3AZIB 5GSUB 5B40B 1U35A 1P3ID 1ZLAA 3B6GA 4JJNA 1AOIB 2CV5D 4NE3A 1EQZD 1ZLAC 3WKJD 2HUEB 4J8UB 3TU4B 1A7WA 5AVBC 1M1AA 3KWQA 4AWLC 5AV9D 1S32A 2PYOC 4Z66B 4H9PB 5F99D 1BH8A 5AV8B 3WTPA 3REJB 3REHB 3AZFA 4LD9C 3KWQC 5E5AB 2NQBD 2NZDA 3REIA 3WTPC 3X1TD 5JRGB 3KXBA 3AFAA 5B32A 3LZ1B 5B1LB 4KUDD 2UWXA 3MGQD 4UPKA 3REIC 1B67A 1P3PD 4NE6A 5B31C 1P3AD 3MGSB 3AZGD 2RVQD 4DRAA 4WU9B 5B2JA 4ZUXB 5B0ZC 4R8PB 3W97D 5CPKB 1KX4C 1P34D 3B0CT 3WA9A 1ID3D 3B6FB 5DNNA 3AZLA 5B0YC 1HTAA 5JA4B 4QLCD 4XZQB 3O62B 3REKD 3EPHA 3EPJA 3AZNC 3AN2C 3X1VD 5CP6D 3AZID 5GSUD 5B40D 2Y2JA 4ZBJB 1AOID 1U35B 4XUJC 3B6GB 3AV2C 3W99A 5AVCC 2W8SA 3AZJA 4J8UD 3TU4D 1M1AB 5AV8D 3AZHB 3AZJC 1BH8B 3MGRC 3AZFB 5E5AD 5JRGD 3X1UC 5DNMA 5AV5C 5BS7C 4J8VB 5AV6D 2NZDB 3FDDA 3KXBB 1TZYA 3VH5W 3MGSD 3AZMA 2FJ7A 1TZYC 4WU9D 4ZUXD 4R8PD 1N1JB 5B2JB 5CPKD 5B24C 3WAAB 3NQJA 3AYWB 1WWIA 3RELA 1M19A 3O62D 3AZLB 2F8NG 1P3LA 3KUYC 2IO5B 4H9NB 2CV5C 1EQZC 4WNNA 5AY8A 3WKJC 2BYMB 3MNNA 5B1MA 3X1SA 5F99C 2AROB 3H0MC 1M1AD 4Z5TA 4DRBA 3AZHD 2NQBC 3AZED 3AZFD 5BNXA 3A6NA 4Z5TC 5B2IA 3C1BB 2NZDD 4J8VD 1HQ3B 3KSYA 2JSSA 5DNMB 4KGCB 5GT3A 3C1CA 2LY8A 3UTAA 1P3PC 1P3AC 2G5IC 3UTBA 4WV4B 2HIOB 4J8WB 1P3FC 2RVQC 3W98A 3H0RC 5GT3C 4WJ3C 5CHLB 3AZMB 3UTBC 3IP4C 3LELC 3WAAD 2F2AC
chains in the Genus database with same CATH topology
3AYWD 4WU8A 4QLCC 3UT9A 4G92B 3REKC 1M19B 1H3OA 3AZIC 1BH9A 5B40C 3MVDA 1JFIB 2VQRA 2ZY5A 4EO5B 4J8UC 2L5AA 4WNNB 5AY8B 3LZ0A 5AV8C 2AROD 5B1MB 1KX3B 3X1SB 5G49B 4CSRA 5GXQB 5AVBA 3VH6W 5AV6C 4H9SC 1F66A 2PYOA 3C1BD 2F8NA 1TAFA 5BNXB 3A6NB 1HQ3D 5FUGA 1P3GB 4KGCD 5B2IB 4LD9A 1F66C 3UTAB 2Y2MA 2HIOD 3MGSC 4J8WD 1P3OA 4WU9C 4R8PC 4YS3A 3R45A 3AZMD 4J8XB 1P3KB 2F8NH 1P3OC 3P5JB 4E44A 5B31A 4YS3C 3AZKB 1P3BA 4M6BA 3F6TA 5B0ZA 5B33C 3O62C 5CPIB 2Y2LA 5CPJB 1KX4A 3UT9B 1P3BC 4G91C 4ZBJC 1BH9B 1KU5A 5C3IC 5B0YA 3W96B 1KX5A 3VH5A 3MVDB 3VH5T 2BYKA 4YM6B 3AZNA 5AY8D 3NQUA 3AN2A 1P3MB 1KX3D 3LJAC 2ZM5A 1KX5C 3AZHC 5GT0A 4XUJA 3AZEC 3AV2A 5AVCA 4X23B 2Y2HA 5GXQD 1ZLAB 5GT0C 4NE5A 3A6ND 2ZY4A 4JJNB 1P3GD 4AWLB 3EG5B 3AV1A 5B2ID 2PYOB 2JE5A 5FUGB 1M18C 3MGRA 4H9OA 4LD9B 3UTAD 4Z66D 3X1UA 3H0LC 3KWQB 5AV5A 3MGPA 5BS7A 3REHD 3REJD 3WTPB 3AV1C 1S32B 1BFMA 4J8XD 1P3KD 3WAAC 3MGPC 3B0DB 3REIB 3LZ1D 5B1LD 3AZKD 3AFAB 5B32B 1Q9CA 5CPID 1F1EA 4Z2MG 5KDMA 5CPJD 5B24A 2IO5C 3WTPE 4WZSB 3W96D 3MVDD 5B0YB 2F8NK 1P3IA 2AROC 4YM6D 3B6FD 2YFWA 1P3MD 3WA9B 3KUYA 5DNNB 3AZNB 4XZQD 2CV5A 1P3IC 1EQZA 3WKJA 4X23D 5BT1D 3AV2B 3C1BC 5AVCB 5F99A 1HQ3C 1ZLAD 1U35D 4KGCC 3B6GD 4H9QA 4JJND 4H9RA 5AV9C 2NQBA 3W99B 1W2EA 2HIOC 4J8WC 2Y2OA 3AZJB 4H9OB 3KWQD 1S32D 3WTPD 3X1UB 3V9RA 3MGQA 3X1TC 5BNVA 4CAYA 1P3PA 1P3AA 3REID 1P3FA 3AZGA 4KUDC 3MGQC 3KXBD 3W97A 3AFAD 5B32D 1TZYB 3AZGC 1P34A 3VH6A 3VH6T 3LELA 5KDMB 3W97C 1ID3A 2FJ7B 1P34C 4EO5C 4QLCA 5B2JD 3REKA 1ID3C 5CP6A 3NQJB 5B40A 3AZIA 2DF4C 5B32G 3WA9D 5DNND 3AZLD 2YFWB 3RELB 3X1VC 5CP6C 3KUYB 5GSUC 4J8UA 3TU4A 5GXQC 1P3LB 2CV5B 3AV2D 1AOIC 5AVCD 4H9PA 5AV8A 1P3GC 2XD5A 2HUEC 3TU4C 4H9QB 3W99D 4Z66C 5JRGA 3MNNB 3AZJD 3REJC 3REHC 5AV6A 4H9SA 4Z5TB 3A1KA 5E5AC 4J8XC 5JRGC 4UUZA 5BNVB 3LZ1C 5B1LC 3MGSA 3AZKC 5BO0A 5DNMD 1P3PB 1P3AB 4WU9A 4R8PA 1P3FB 5CPIC 5CPKA 2Y2GA 5GT3B 3C1CB 1TZYD 4ZUXC 2Y2PA 3UTBB 3W98B 3LELB 5CPKC 2FJ7D 3W96C 5JA4A 5B33A 3O62A 2DQNC 4QLCB 4YM6C 3B6FC 1Z2CB 1P3MC 4XZQC 4HGAB 4WU8B 4E45A 1M19D 4X23C 3RELD 3KUYD 5BT1C 1PZRA 1P3LD 1H3OB 1U35C 3B6GC 4JJNC 2J8PA 3LJAA 3AZHA 3AZEA 1M1AC 3B0BA 3MNND 5B1MD 1S32C 4J8VA 3X1SD 3LZ0B 3AZFC 5AV6B 4Z5TD 4CSRB 1M18A 2NZDC 3B0DC 4J8VC 5AVBB 2Y2KA 4UUZB 3KXBC 3AFAC 1F66B 5B32C 2F8NB 1TAFB 1P3FD 5BO0B 1N1JA 5GT3D 3C1CD 3WAAA 3UTBD 3W98D 1P3OB 3AYWA 3LELD 5B2JC 4YS3B 2YFVA 3R45B 5B33B 3AYWC 3WA9C 5B31B 1B6WA 5DNNC 1P3BB 3AZLC 4H9NA 4WU8D 5B0ZB 4G91B 3UT9D 2BYMA 2FFFB 1KX4B 5C3IB 2AROA 3A1IA 2G5HC 3W99C 3LJAB 1KX5B 3AZEB 2BYKB 3C1BA 3NQUB 1HQ3A 3LZ0D 3AN2B 4KGCA 2ZY2A 5GT0B 4XUJB 5AV9A 1T3UA 2HIOA 4J8WA 5DNMC 1M18B 5AVBD 2RIQA 3B0CW 1F66D 2PYOD 2F8ND 4DQYB 3X1TA 3AV1B 4LD9D 3MGRB 4KUDA 3MGPB 5AV5B 3AZMC 1P3OD 2FJ7C 3KFUG 4YS3D 1R4VA 2YFVB 5B33D 4G92C 5B31D 4NFTA 1P3BD 1JFIA 1M19C 3RELC 5B0ZD 1P3LC 1KX4D 5B24B 2XD1A 2BG1A 1KX3A 5G49A 4KHAA 5B0YD 5AY8C 3X1VA 3LJAD 1KX5D 3MNNC 5GSUA 5B1MC 1KX3C 5B31G 5GXQA 3X1SC 3EPLA 1P3IB 1AOIA 3AZND 3AN2D 1P3GA 2JCHA 4XUJD 5GT0D 1EQZB 3WKJB 4Z66A 3A6NC 3AL0C 3EPKA 3REJA 5AV9B 3REHA 5B2IC 2Y2IA 1M18D 5F99B 2Y2QA 5E5AA 3C1CC 3UTAC 4H9RB 4J8XA 3AV1D 1P3KA 2NQBB 3MGRD 3X1TB 3W98C 3LZ1A 5B1LA 2Y2NA 3AZKA 3X1UD 3MGPD 5AV5D 4Z2MH 1P3KC 5CPIA 4KUDB 3MGQB 3V9RB 5CPJA 4CAYB 4ZUXA 3AZGB 4HGAC 4WU8C 5CPJC 2ZY3A 3UT9C 3W97B 3W96A 1ULYA 1P34B 4YM6A 3B6FA 5B24D 1P3MA 1ID3B 4XZQA 3MVDC 2CWEA 4X23A 1WWSA 3REKB 4KHAB 3X1VB 5CP6B 3LZ0C 3AZIB 5GSUB 5B40B 1U35A 1P3ID 1ZLAA 3B6GA 4JJNA 1AOIB 2CV5D 4NE3A 1EQZD 1ZLAC 3WKJD 2HUEB 4J8UB 3TU4B 1A7WA 5AVBC 1M1AA 3KWQA 4AWLC 5AV9D 1S32A 2PYOC 4Z66B 4H9PB 5F99D 1BH8A 5AV8B 3WTPA 3REJB 3REHB 3AZFA 4LD9C 3KWQC 5E5AB 2NQBD 2NZDA 3REIA 3WTPC 3X1TD 5JRGB 3KXBA 3AFAA 5B32A 3LZ1B 5B1LB 4KUDD 2UWXA 3MGQD 4UPKA 3REIC 1B67A 1P3PD 4NE6A 5B31C 1P3AD 3MGSB 3AZGD 2RVQD 4DRAA 4WU9B 5B2JA 4ZUXB 5B0ZC 4R8PB 3W97D 5CPKB 1KX4C 1P34D 3B0CT 3WA9A 1ID3D 3B6FB 5DNNA 3AZLA 5B0YC 1HTAA 5JA4B 4QLCD 4XZQB 3O62B 3REKD 3EPHA 3EPJA 3AZNC 3AN2C 3X1VD 5CP6D 3AZID 5GSUD 5B40D 2Y2JA 4ZBJB 1AOID 1U35B 4XUJC 3B6GB 3AV2C 3W99A 5AVCC 2W8SA 3AZJA 4J8UD 3TU4D 1M1AB 5AV8D 3AZHB 3AZJC 1BH8B 3MGRC 3AZFB 5E5AD 5JRGD 3X1UC 5DNMA 5AV5C 5BS7C 4J8VB 5AV6D 2NZDB 3FDDA 3KXBB 1TZYA 3VH5W 3MGSD 3AZMA 2FJ7A 1TZYC 4WU9D 4ZUXD 4R8PD 1N1JB 5B2JB 5CPKD 5B24C 3WAAB 3NQJA 3AYWB 1WWIA 3RELA 1M19A 3O62D 3AZLB 2F8NG 1P3LA 3KUYC 2IO5B 4H9NB 2CV5C 1EQZC 4WNNA 5AY8A 3WKJC 2BYMB 3MNNA 5B1MA 3X1SA 5F99C 2AROB 3H0MC 1M1AD 4Z5TA 4DRBA 3AZHD 2NQBC 3AZED 3AZFD 5BNXA 3A6NA 4Z5TC 5B2IA 3C1BB 2NZDD 4J8VD 1HQ3B 3KSYA 2JSSA 5DNMB 4KGCB 5GT3A 3C1CA 2LY8A 3UTAA 1P3PC 1P3AC 2G5IC 3UTBA 4WV4B 2HIOB 4J8WB 1P3FC 2RVQC 3W98A 3H0RC 5GT3C 4WJ3C 5CHLB 3AZMB 3UTBC 3IP4C 3LELC 3WAAD 2F2AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW D;  4WU8 A;  4QLC C;  3UT9 A;  4G92 B;  3REK C;  1M19 B;  1H3O A;  3AZI C;  1BH9 A;  5B40 C;  3MVD A;  1JFI B;  4EO5 B;  4J8U C;  2L5A A;  4WNN B;  5AY8 B;  3LZ0 A;  5AV8 C;  2ARO D;  5B1M B;  1KX3 B;  3X1S B;  5G49 B;  4CSR A;  5GXQ B;  5AVB A;  3VH6 W;  5AV6 C;  4H9S C;  1F66 A;  2PYO A;  3C1B D;  2F8N A;  1TAF A;  5BNX B;  3A6N B;  1HQ3 D;  5FUG A;  1P3G B;  4KGC D;  5B2I B;  4LD9 A;  1F66 C;  3UTA B;  3MGS C;  2HIO D;  4J8W D;  1P3O A;  4WU9 C;  4R8P C;  4YS3 A;  3R45 A;  3AZM D;  4J8X B;  1P3K B;  2F8N H;  1P3O C;  4E44 A;  5B31 A;  4YS3 C;  3AZK B;  1P3B A;  4M6B A;  5B0Z A;  5B33 C;  3O62 C;  5CPI B;  5CPJ B;  1KX4 A;  3UT9 B;  1P3B C;  4G91 C;  4ZBJ C;  1BH9 B;  1KU5 A;  5C3I C;  5B0Y A;  3W96 B;  1KX5 A;  3VH5 A;  3MVD B;  3VH5 T;  2BYK A;  4YM6 B;  3AZN A;  5AY8 D;  3NQU A;  3AN2 A;  1P3M B;  1KX3 D;  3LJA C;  1KX5 C;  3AZH C;  5GT0 A;  4XUJ A;  3AZE C;  3AV2 A;  5AVC A;  4X23 B;  5GXQ D;  1ZLA B;  5GT0 C;  4NE5 A;  3A6N D;  4JJN B;  1P3G D;  4AWL B;  2PYO B;  3AV1 A;  5B2I D;  5FUG B;  1M18 C;  3MGR A;  4H9O A;  4LD9 B;  3UTA D;  4Z66 D;  3X1U A;  3KWQ B;  5AV5 A;  3MGP A;  5BS7 A;  3REH D;  3REJ D;  3WTP B;  3AV1 C;  1S32 B;  1BFM A;  4J8X D;  1P3K D;  3WAA C;  3MGP C;  3B0D B;  3REI B;  3LZ1 D;  5B1L D;  3AZK D;  3AFA B;  5B32 B;  1Q9C A;  5CPI D;  1F1E A;  4Z2M G;  5KDM A;  5CPJ D;  5B24 A;  2IO5 C;  3WTP E;  4WZS B;  3W96 D;  3MVD D;  5B0Y B;  2F8N K;  1P3I A;  2ARO C;  4YM6 D;  3B6F D;  2YFW A;  1P3M D;  3WA9 B;  3KUY A;  5DNN B;  3AZN B;  4XZQ D;  2CV5 A;  1P3I C;  1EQZ A;  3WKJ A;  4X23 D;  5BT1 D;  3AV2 B;  3C1B C;  5AVC B;  5F99 A;  1HQ3 C;  1ZLA D;  1U35 D;  4KGC C;  3B6G D;  4H9Q A;  4JJN D;  4H9R A;  5AV9 C;  2NQB A;  3W99 B;  2HIO C;  4J8W C;  3AZJ B;  4H9O B;  3KWQ D;  1S32 D;  3WTP D;  3X1U B;  3V9R A;  3MGQ A;  3X1T C;  5BNV A;  4CAY A;  1P3P A;  1P3A A;  3REI D;  1P3F A;  3AZG A;  4KUD C;  3MGQ C;  3KXB D;  3W97 A;  3AFA D;  5B32 D;  1TZY B;  3AZG C;  1P34 A;  3VH6 A;  3VH6 T;  3LEL A;  5KDM B;  3W97 C;  1ID3 A;  2FJ7 B;  1P34 C;  4EO5 C;  4QLC A;  5B2J D;  3REK A;  1ID3 C;  5CP6 A;  3NQJ B;  5B40 A;  3AZI A;  5B32 G;  3WA9 D;  5DNN D;  3AZL D;  2YFW B;  3REL B;  3X1V C;  5CP6 C;  3KUY B;  5GSU C;  4J8U A;  3TU4 A;  5GXQ C;  1P3L B;  2CV5 B;  3AV2 D;  1AOI C;  5AVC D;  4H9P A;  5AV8 A;  1P3G C;  2HUE C;  3TU4 C;  4H9Q B;  3W99 D;  4Z66 C;  5JRG A;  3MNN B;  3AZJ D;  3REJ C;  3REH C;  5AV6 A;  4H9S A;  4Z5T B;  5E5A C;  4J8X C;  5JRG C;  4UUZ A;  5BNV B;  3LZ1 C;  5B1L C;  3MGS A;  3AZK C;  5BO0 A;  5DNM D;  1P3P B;  1P3A B;  4WU9 A;  4R8P A;  1P3F B;  5CPI C;  5CPK A;  5GT3 B;  3C1C B;  1TZY D;  4ZUX C;  3UTB B;  3W98 B;  3LEL B;  5CPK C;  2FJ7 D;  3W96 C;  5JA4 A;  5B33 A;  3O62 A;  4QLC B;  4YM6 C;  3B6F C;  1P3M C;  4XZQ C;  4HGA B;  4WU8 B;  4E45 A;  1M19 D;  4X23 C;  3REL D;  3KUY D;  5BT1 C;  1P3L D;  1H3O B;  1U35 C;  3B6G C;  4JJN C;  3LJA A;  3AZH A;  3AZE A;  1M1A C;  3B0B A;  3MNN D;  5B1M D;  1S32 C;  4J8V A;  3X1S D;  3LZ0 B;  3AZF C;  5AV6 B;  4Z5T D;  4CSR B;  1M18 A;  2NZD C;  3B0D C;  4J8V C;  5AVB B;  4UUZ B;  3KXB C;  3AFA C;  1F66 B;  5B32 C;  2F8N B;  1TAF B;  1P3F D;  5BO0 B;  1N1J A;  5GT3 D;  3C1C D;  3WAA A;  3UTB D;  3W98 D;  1P3O B;  3AYW A;  3LEL D;  5B2J C;  4YS3 B;  2YFV A;  3R45 B;  5B33 B;  3AYW C;  3WA9 C;  5B31 B;  1B6W A;  5DNN C;  1P3B B;  3AZL C;  4H9N A;  4WU8 D;  5B0Z B;  4G91 B;  3UT9 D;  2BYM A;  1KX4 B;  5C3I B;  2ARO A;  3W99 C;  3LJA B;  1KX5 B;  3AZE B;  2BYK B;  3C1B A;  3NQU B;  1HQ3 A;  3LZ0 D;  3AN2 B;  4KGC A;  5GT0 B;  4XUJ B;  5AV9 A;  2HIO A;  4J8W A;  5DNM C;  1M18 B;  5AVB D;  1F66 D;  3B0C W;  2PYO D;  2F8N D;  3X1T A;  3AV1 B;  4LD9 D;  3MGR B;  4KUD A;  3MGP B;  5AV5 B;  3AZM C;  1P3O D;  2FJ7 C;  4YS3 D;  1R4V A;  2YFV B;  5B33 D;  4G92 C;  5B31 D;  4NFT A;  1P3B D;  1JFI A;  1M19 C;  3REL C;  5B0Z D;  1P3L C;  1KX4 D;  5B24 B;  1KX3 A;  5G49 A;  4KHA A;  5B0Y D;  5AY8 C;  3X1V A;  3LJA D;  1KX5 D;  3MNN C;  5GSU A;  5B1M C;  1KX3 C;  5B31 G;  5GXQ A;  3X1S C;  1P3I B;  1AOI A;  3AZN D;  3AN2 D;  1P3G A;  5GT0 D;  4XUJ D;  1EQZ B;  3WKJ B;  4Z66 A;  3A6N C;  3REJ A;  5AV9 B;  3REH A;  5B2I C;  1M18 D;  5F99 B;  5E5A A;  3C1C C;  3UTA C;  4H9R B;  4J8X A;  3AV1 D;  1P3K A;  2NQB B;  3MGR D;  3X1T B;  3W98 C;  3LZ1 A;  5B1L A;  3AZK A;  3X1U D;  3MGP D;  5AV5 D;  4Z2M H;  1P3K C;  5CPI A;  4KUD B;  3MGQ B;  3V9R B;  5CPJ A;  4CAY B;  4ZUX A;  3AZG B;  4HGA C;  4WU8 C;  5CPJ C;  3UT9 C;  3W97 B;  3W96 A;  1ULY A;  1P34 B;  4YM6 A;  3B6F A;  5B24 D;  1P3M A;  1ID3 B;  4XZQ A;  3MVD C;  2CWE A;  4X23 A;  1WWS A;  3REK B;  4KHA B;  3X1V B;  5CP6 B;  3LZ0 C;  3AZI B;  5GSU B;  5B40 B;  1U35 A;  1P3I D;  1ZLA A;  3B6G A;  4JJN A;  1AOI B;  2CV5 D;  4NE3 A;  1EQZ D;  1ZLA C;  3WKJ D;  2HUE B;  4J8U B;  3TU4 B;  1A7W A;  5AVB C;  1M1A A;  3KWQ A;  4AWL C;  5AV9 D;  1S32 A;  2PYO C;  4Z66 B;  4H9P B;  5F99 D;  1BH8 A;  5AV8 B;  3WTP A;  3REJ B;  3REH B;  3AZF A;  4LD9 C;  3KWQ C;  5E5A B;  2NQB D;  2NZD A;  3REI A;  3WTP C;  3X1T D;  5JRG B;  3KXB A;  3AFA A;  5B32 A;  3LZ1 B;  5B1L B;  4KUD D;  3MGQ D;  3REI C;  1B67 A;  1P3P D;  4NE6 A;  5B31 C;  1P3A D;  3MGS B;  3AZG D;  2RVQ D;  4DRA A;  4WU9 B;  5B2J A;  4ZUX B;  5B0Z C;  4R8P B;  3W97 D;  5CPK B;  1KX4 C;  1P34 D;  3B0C T;  3WA9 A;  1ID3 D;  3B6F B;  5DNN A;  3AZL A;  5B0Y C;  1HTA A;  5JA4 B;  4QLC D;  4XZQ B;  3O62 B;  3REK D;  3AZN C;  3AN2 C;  3X1V D;  5CP6 D;  3AZI D;  5GSU D;  5B40 D;  4ZBJ B;  1AOI D;  1U35 B;  4XUJ C;  3B6G B;  3AV2 C;  3W99 A;  5AVC C;  3AZJ A;  4J8U D;  3TU4 D;  1M1A B;  5AV8 D;  3AZH B;  3AZJ C;  1BH8 B;  3MGR C;  3AZF B;  5E5A D;  5JRG D;  3X1U C;  5DNM A;  5AV5 C;  5BS7 C;  4J8V B;  5AV6 D;  2NZD B;  3KXB B;  1TZY A;  3VH5 W;  3MGS D;  3AZM A;  2FJ7 A;  1TZY C;  4WU9 D;  4ZUX D;  4R8P D;  1N1J B;  5B2J B;  5CPK D;  5B24 C;  3WAA B;  3NQJ A;  3AYW B;  1WWI A;  3REL A;  1M19 A;  3O62 D;  3AZL B;  2F8N G;  1P3L A;  3KUY C;  2IO5 B;  4H9N B;  2CV5 C;  1EQZ C;  4WNN A;  5AY8 A;  3WKJ C;  2BYM B;  3MNN A;  5B1M A;  3X1S A;  5F99 C;  2ARO B;  1M1A D;  4Z5T A;  4DRB A;  3AZH D;  2NQB C;  3AZE D;  3AZF D;  5BNX A;  3A6N A;  4Z5T C;  5B2I A;  3C1B B;  2NZD D;  4J8V D;  1HQ3 B;  3KSY A;  2JSS A;  5DNM B;  4KGC B;  5GT3 A;  3C1C A;  2LY8 A;  3UTA A;  1P3P C;  1P3A C;  3UTB A;  4WV4 B;  2HIO B;  4J8W B;  1P3F C;  2RVQ C;  3W98 A;  5GT3 C;  5CHL B;  3AZM B;  3UTB C;  3LEL C;  3WAA D; 
#chains in the Genus database with same CATH topology
 3AYW D;  4WU8 A;  4QLC C;  3UT9 A;  4G92 B;  3REK C;  1M19 B;  1H3O A;  3AZI C;  1BH9 A;  5B40 C;  3MVD A;  1JFI B;  2VQR A;  2ZY5 A;  4EO5 B;  4J8U C;  2L5A A;  4WNN B;  5AY8 B;  3LZ0 A;  5AV8 C;  2ARO D;  5B1M B;  1KX3 B;  3X1S B;  5G49 B;  4CSR A;  5GXQ B;  5AVB A;  3VH6 W;  5AV6 C;  4H9S C;  1F66 A;  2PYO A;  3C1B D;  2F8N A;  1TAF A;  5BNX B;  3A6N B;  1HQ3 D;  5FUG A;  1P3G B;  4KGC D;  5B2I B;  4LD9 A;  1F66 C;  3UTA B;  2Y2M A;  2HIO D;  3MGS C;  4J8W D;  1P3O A;  4WU9 C;  4R8P C;  4YS3 A;  3R45 A;  3AZM D;  4J8X B;  1P3K B;  2F8N H;  1P3O C;  3P5J B;  4E44 A;  5B31 A;  4YS3 C;  3AZK B;  1P3B A;  4M6B A;  3F6T A;  5B0Z A;  5B33 C;  3O62 C;  5CPI B;  2Y2L A;  5CPJ B;  1KX4 A;  3UT9 B;  1P3B C;  4G91 C;  4ZBJ C;  1BH9 B;  1KU5 A;  5C3I C;  5B0Y A;  3W96 B;  1KX5 A;  3VH5 A;  3MVD B;  3VH5 T;  2BYK A;  4YM6 B;  3AZN A;  5AY8 D;  3NQU A;  3AN2 A;  1P3M B;  1KX3 D;  3LJA C;  2ZM5 A;  1KX5 C;  3AZH C;  5GT0 A;  4XUJ A;  3AZE C;  3AV2 A;  5AVC A;  4X23 B;  2Y2H A;  5GXQ D;  1ZLA B;  5GT0 C;  4NE5 A;  3A6N D;  2ZY4 A;  4JJN B;  1P3G D;  4AWL B;  3EG5 B;  3AV1 A;  5B2I D;  2PYO B;  2JE5 A;  5FUG B;  1M18 C;  3MGR A;  4H9O A;  4LD9 B;  3UTA D;  4Z66 D;  3X1U A;  3H0L C;  3KWQ B;  5AV5 A;  3MGP A;  5BS7 A;  3REH D;  3REJ D;  3WTP B;  3AV1 C;  1S32 B;  1BFM A;  4J8X D;  1P3K D;  3WAA C;  3MGP C;  3B0D B;  3REI B;  3LZ1 D;  5B1L D;  3AZK D;  3AFA B;  5B32 B;  1Q9C A;  5CPI D;  1F1E A;  4Z2M G;  5KDM A;  5CPJ D;  5B24 A;  2IO5 C;  3WTP E;  4WZS B;  3W96 D;  3MVD D;  5B0Y B;  2F8N K;  1P3I A;  2ARO C;  4YM6 D;  3B6F D;  2YFW A;  1P3M D;  3WA9 B;  3KUY A;  5DNN B;  3AZN B;  4XZQ D;  2CV5 A;  1P3I C;  1EQZ A;  3WKJ A;  4X23 D;  5BT1 D;  3AV2 B;  3C1B C;  5AVC B;  5F99 A;  1HQ3 C;  1ZLA D;  1U35 D;  4KGC C;  3B6G D;  4H9Q A;  4JJN D;  4H9R A;  5AV9 C;  2NQB A;  3W99 B;  1W2E A;  2HIO C;  4J8W C;  2Y2O A;  3AZJ B;  4H9O B;  3KWQ D;  1S32 D;  3WTP D;  3X1U B;  3V9R A;  3MGQ A;  3X1T C;  5BNV A;  4CAY A;  1P3P A;  1P3A A;  3REI D;  1P3F A;  3AZG A;  4KUD C;  3MGQ C;  3KXB D;  3W97 A;  3AFA D;  5B32 D;  1TZY B;  3AZG C;  1P34 A;  3VH6 A;  3VH6 T;  3LEL A;  5KDM B;  3W97 C;  1ID3 A;  2FJ7 B;  1P34 C;  4EO5 C;  4QLC A;  5B2J D;  3REK A;  1ID3 C;  5CP6 A;  3NQJ B;  5B40 A;  3AZI A;  2DF4 C;  5B32 G;  3WA9 D;  5DNN D;  3AZL D;  2YFW B;  3REL B;  3X1V C;  5CP6 C;  3KUY B;  5GSU C;  4J8U A;  3TU4 A;  5GXQ C;  1P3L B;  2CV5 B;  3AV2 D;  1AOI C;  5AVC D;  4H9P A;  5AV8 A;  1P3G C;  2XD5 A;  2HUE C;  3TU4 C;  4H9Q B;  3W99 D;  4Z66 C;  5JRG A;  3MNN B;  3AZJ D;  3REJ C;  3REH C;  5AV6 A;  4H9S A;  4Z5T B;  3A1K A;  5E5A C;  4J8X C;  5JRG C;  4UUZ A;  5BNV B;  3LZ1 C;  5B1L C;  3MGS A;  3AZK C;  5BO0 A;  5DNM D;  1P3P B;  1P3A B;  4WU9 A;  4R8P A;  1P3F B;  5CPI C;  5CPK A;  2Y2G A;  5GT3 B;  3C1C B;  1TZY D;  4ZUX C;  2Y2P A;  3UTB B;  3W98 B;  3LEL B;  5CPK C;  2FJ7 D;  3W96 C;  5JA4 A;  5B33 A;  3O62 A;  2DQN C;  4QLC B;  4YM6 C;  3B6F C;  1Z2C B;  1P3M C;  4XZQ C;  4HGA B;  4WU8 B;  4E45 A;  1M19 D;  4X23 C;  3REL D;  3KUY D;  5BT1 C;  1PZR A;  1P3L D;  1H3O B;  1U35 C;  3B6G C;  4JJN C;  2J8P A;  3LJA A;  3AZH A;  3AZE A;  1M1A C;  3B0B A;  3MNN D;  5B1M D;  1S32 C;  4J8V A;  3X1S D;  3LZ0 B;  3AZF C;  5AV6 B;  4Z5T D;  4CSR B;  1M18 A;  2NZD C;  3B0D C;  4J8V C;  5AVB B;  2Y2K A;  4UUZ B;  3KXB C;  3AFA C;  1F66 B;  5B32 C;  2F8N B;  1TAF B;  1P3F D;  5BO0 B;  1N1J A;  5GT3 D;  3C1C D;  3WAA A;  3UTB D;  3W98 D;  1P3O B;  3AYW A;  3LEL D;  5B2J C;  4YS3 B;  2YFV A;  3R45 B;  5B33 B;  3AYW C;  3WA9 C;  5B31 B;  1B6W A;  5DNN C;  1P3B B;  3AZL C;  4H9N A;  4WU8 D;  5B0Z B;  4G91 B;  3UT9 D;  2BYM A;  2FFF B;  1KX4 B;  5C3I B;  2ARO A;  3A1I A;  2G5H C;  3W99 C;  3LJA B;  1KX5 B;  3AZE B;  2BYK B;  3C1B A;  3NQU B;  1HQ3 A;  3LZ0 D;  3AN2 B;  4KGC A;  2ZY2 A;  5GT0 B;  4XUJ B;  5AV9 A;  1T3U A;  2HIO A;  4J8W A;  5DNM C;  1M18 B;  5AVB D;  2RIQ A;  3B0C W;  1F66 D;  2PYO D;  2F8N D;  4DQY B;  3X1T A;  3AV1 B;  4LD9 D;  3MGR B;  4KUD A;  3MGP B;  5AV5 B;  3AZM C;  1P3O D;  2FJ7 C;  3KFU G;  4YS3 D;  1R4V A;  2YFV B;  5B33 D;  4G92 C;  5B31 D;  4NFT A;  1P3B D;  1JFI A;  1M19 C;  3REL C;  5B0Z D;  1P3L C;  1KX4 D;  5B24 B;  2XD1 A;  2BG1 A;  1KX3 A;  5G49 A;  4KHA A;  5B0Y D;  5AY8 C;  3X1V A;  3LJA D;  1KX5 D;  3MNN C;  5GSU A;  5B1M C;  1KX3 C;  5B31 G;  5GXQ A;  3X1S C;  3EPL A;  1P3I B;  1AOI A;  3AZN D;  3AN2 D;  1P3G A;  2JCH A;  4XUJ D;  5GT0 D;  1EQZ B;  3WKJ B;  4Z66 A;  3A6N C;  3AL0 C;  3EPK A;  3REJ A;  5AV9 B;  3REH A;  5B2I C;  2Y2I A;  1M18 D;  5F99 B;  2Y2Q A;  5E5A A;  3C1C C;  3UTA C;  4H9R B;  4J8X A;  3AV1 D;  1P3K A;  2NQB B;  3MGR D;  3X1T B;  3W98 C;  3LZ1 A;  5B1L A;  2Y2N A;  3AZK A;  3X1U D;  3MGP D;  5AV5 D;  4Z2M H;  1P3K C;  5CPI A;  4KUD B;  3MGQ B;  3V9R B;  5CPJ A;  4CAY B;  4ZUX A;  3AZG B;  4HGA C;  4WU8 C;  5CPJ C;  2ZY3 A;  3UT9 C;  3W97 B;  3W96 A;  1ULY A;  1P34 B;  4YM6 A;  3B6F A;  5B24 D;  1P3M A;  1ID3 B;  4XZQ A;  3MVD C;  2CWE A;  4X23 A;  1WWS A;  3REK B;  4KHA B;  3X1V B;  5CP6 B;  3LZ0 C;  3AZI B;  5GSU B;  5B40 B;  1U35 A;  1P3I D;  1ZLA A;  3B6G A;  4JJN A;  1AOI B;  2CV5 D;  4NE3 A;  1EQZ D;  1ZLA C;  3WKJ D;  2HUE B;  4J8U B;  3TU4 B;  1A7W A;  5AVB C;  1M1A A;  3KWQ A;  4AWL C;  5AV9 D;  1S32 A;  2PYO C;  4Z66 B;  4H9P B;  5F99 D;  1BH8 A;  5AV8 B;  3WTP A;  3REJ B;  3REH B;  3AZF A;  4LD9 C;  3KWQ C;  5E5A B;  2NQB D;  2NZD A;  3REI A;  3WTP C;  3X1T D;  5JRG B;  3KXB A;  3AFA A;  5B32 A;  3LZ1 B;  5B1L B;  4KUD D;  2UWX A;  3MGQ D;  4UPK A;  3REI C;  1B67 A;  1P3P D;  4NE6 A;  5B31 C;  1P3A D;  3MGS B;  3AZG D;  2RVQ D;  4DRA A;  4WU9 B;  5B2J A;  4ZUX B;  5B0Z C;  4R8P B;  3W97 D;  5CPK B;  1KX4 C;  1P34 D;  3B0C T;  3WA9 A;  1ID3 D;  3B6F B;  5DNN A;  3AZL A;  5B0Y C;  1HTA A;  5JA4 B;  4QLC D;  4XZQ B;  3O62 B;  3REK D;  3EPH A;  3EPJ A;  3AZN C;  3AN2 C;  3X1V D;  5CP6 D;  3AZI D;  5GSU D;  5B40 D;  2Y2J A;  4ZBJ B;  1AOI D;  1U35 B;  4XUJ C;  3B6G B;  3AV2 C;  3W99 A;  5AVC C;  2W8S A;  3AZJ A;  4J8U D;  3TU4 D;  1M1A B;  5AV8 D;  3AZH B;  3AZJ C;  1BH8 B;  3MGR C;  3AZF B;  5E5A D;  5JRG D;  3X1U C;  5DNM A;  5AV5 C;  5BS7 C;  4J8V B;  5AV6 D;  2NZD B;  3FDD A;  3KXB B;  1TZY A;  3VH5 W;  3MGS D;  3AZM A;  2FJ7 A;  1TZY C;  4WU9 D;  4ZUX D;  4R8P D;  1N1J B;  5B2J B;  5CPK D;  5B24 C;  3WAA B;  3NQJ A;  3AYW B;  1WWI A;  3REL A;  1M19 A;  3O62 D;  3AZL B;  2F8N G;  1P3L A;  3KUY C;  2IO5 B;  4H9N B;  2CV5 C;  1EQZ C;  4WNN A;  5AY8 A;  3WKJ C;  2BYM B;  3MNN A;  5B1M A;  3X1S A;  5F99 C;  2ARO B;  3H0M C;  1M1A D;  4Z5T A;  4DRB A;  3AZH D;  2NQB C;  3AZE D;  3AZF D;  5BNX A;  3A6N A;  4Z5T C;  5B2I A;  3C1B B;  2NZD D;  4J8V D;  1HQ3 B;  3KSY A;  2JSS A;  5DNM B;  4KGC B;  5GT3 A;  3C1C A;  2LY8 A;  3UTA A;  1P3P C;  1P3A C;  2G5I C;  3UTB A;  4WV4 B;  2HIO B;  4J8W B;  1P3F C;  2RVQ C;  3W98 A;  3H0R C;  5GT3 C;  4WJ3 C;  5CHL B;  3AZM B;  3UTB C;  3IP4 C;  3LEL C;  3WAA D;  2F2A C; 
#chains in the Genus database with same CATH homology
 3AYW D;  4WU8 A;  4QLC C;  3UT9 A;  4G92 B;  3REK C;  1M19 B;  1H3O A;  3AZI C;  1BH9 A;  5B40 C;  3MVD A;  1JFI B;  2VQR A;  2ZY5 A;  4EO5 B;  4J8U C;  2L5A A;  4WNN B;  5AY8 B;  3LZ0 A;  5AV8 C;  2ARO D;  5B1M B;  1KX3 B;  3X1S B;  5G49 B;  4CSR A;  5GXQ B;  5AVB A;  3VH6 W;  5AV6 C;  4H9S C;  1F66 A;  2PYO A;  3C1B D;  2F8N A;  1TAF A;  5BNX B;  3A6N B;  1HQ3 D;  5FUG A;  1P3G B;  4KGC D;  5B2I B;  4LD9 A;  1F66 C;  3UTA B;  2Y2M A;  2HIO D;  3MGS C;  4J8W D;  1P3O A;  4WU9 C;  4R8P C;  4YS3 A;  3R45 A;  3AZM D;  4J8X B;  1P3K B;  2F8N H;  1P3O C;  3P5J B;  4E44 A;  5B31 A;  4YS3 C;  3AZK B;  1P3B A;  4M6B A;  3F6T A;  5B0Z A;  5B33 C;  3O62 C;  5CPI B;  2Y2L A;  5CPJ B;  1KX4 A;  3UT9 B;  1P3B C;  4G91 C;  4ZBJ C;  1BH9 B;  1KU5 A;  5C3I C;  5B0Y A;  3W96 B;  1KX5 A;  3VH5 A;  3MVD B;  3VH5 T;  2BYK A;  4YM6 B;  3AZN A;  5AY8 D;  3NQU A;  3AN2 A;  1P3M B;  1KX3 D;  3LJA C;  2ZM5 A;  1KX5 C;  3AZH C;  5GT0 A;  4XUJ A;  3AZE C;  3AV2 A;  5AVC A;  4X23 B;  2Y2H A;  5GXQ D;  1ZLA B;  5GT0 C;  4NE5 A;  3A6N D;  2ZY4 A;  4JJN B;  1P3G D;  4AWL B;  3EG5 B;  3AV1 A;  5B2I D;  2PYO B;  2JE5 A;  5FUG B;  1M18 C;  3MGR A;  4H9O A;  4LD9 B;  3UTA D;  4Z66 D;  3X1U A;  3H0L C;  3KWQ B;  5AV5 A;  3MGP A;  5BS7 A;  3REH D;  3REJ D;  3WTP B;  3AV1 C;  1S32 B;  1BFM A;  4J8X D;  1P3K D;  3WAA C;  3MGP C;  3B0D B;  3REI B;  3LZ1 D;  5B1L D;  3AZK D;  3AFA B;  5B32 B;  1Q9C A;  5CPI D;  1F1E A;  4Z2M G;  5KDM A;  5CPJ D;  5B24 A;  2IO5 C;  3WTP E;  4WZS B;  3W96 D;  3MVD D;  5B0Y B;  2F8N K;  1P3I A;  2ARO C;  4YM6 D;  3B6F D;  2YFW A;  1P3M D;  3WA9 B;  3KUY A;  5DNN B;  3AZN B;  4XZQ D;  2CV5 A;  1P3I C;  1EQZ A;  3WKJ A;  4X23 D;  5BT1 D;  3AV2 B;  3C1B C;  5AVC B;  5F99 A;  1HQ3 C;  1ZLA D;  1U35 D;  4KGC C;  3B6G D;  4H9Q A;  4JJN D;  4H9R A;  5AV9 C;  2NQB A;  3W99 B;  1W2E A;  2HIO C;  4J8W C;  2Y2O A;  3AZJ B;  4H9O B;  3KWQ D;  1S32 D;  3WTP D;  3X1U B;  3V9R A;  3MGQ A;  3X1T C;  5BNV A;  4CAY A;  1P3P A;  1P3A A;  3REI D;  1P3F A;  3AZG A;  4KUD C;  3MGQ C;  3KXB D;  3W97 A;  3AFA D;  5B32 D;  1TZY B;  3AZG C;  1P34 A;  3VH6 A;  3VH6 T;  3LEL A;  5KDM B;  3W97 C;  1ID3 A;  2FJ7 B;  1P34 C;  4EO5 C;  4QLC A;  5B2J D;  3REK A;  1ID3 C;  5CP6 A;  3NQJ B;  5B40 A;  3AZI A;  2DF4 C;  5B32 G;  3WA9 D;  5DNN D;  3AZL D;  2YFW B;  3REL B;  3X1V C;  5CP6 C;  3KUY B;  5GSU C;  4J8U A;  3TU4 A;  5GXQ C;  1P3L B;  2CV5 B;  3AV2 D;  1AOI C;  5AVC D;  4H9P A;  5AV8 A;  1P3G C;  2XD5 A;  2HUE C;  3TU4 C;  4H9Q B;  3W99 D;  4Z66 C;  5JRG A;  3MNN B;  3AZJ D;  3REJ C;  3REH C;  5AV6 A;  4H9S A;  4Z5T B;  3A1K A;  5E5A C;  4J8X C;  5JRG C;  4UUZ A;  5BNV B;  3LZ1 C;  5B1L C;  3MGS A;  3AZK C;  5BO0 A;  5DNM D;  1P3P B;  1P3A B;  4WU9 A;  4R8P A;  1P3F B;  5CPI C;  5CPK A;  2Y2G A;  5GT3 B;  3C1C B;  1TZY D;  4ZUX C;  2Y2P A;  3UTB B;  3W98 B;  3LEL B;  5CPK C;  2FJ7 D;  3W96 C;  5JA4 A;  5B33 A;  3O62 A;  2DQN C;  4QLC B;  4YM6 C;  3B6F C;  1Z2C B;  1P3M C;  4XZQ C;  4HGA B;  4WU8 B;  4E45 A;  1M19 D;  4X23 C;  3REL D;  3KUY D;  5BT1 C;  1PZR A;  1P3L D;  1H3O B;  1U35 C;  3B6G C;  4JJN C;  2J8P A;  3LJA A;  3AZH A;  3AZE A;  1M1A C;  3B0B A;  3MNN D;  5B1M D;  1S32 C;  4J8V A;  3X1S D;  3LZ0 B;  3AZF C;  5AV6 B;  4Z5T D;  4CSR B;  1M18 A;  2NZD C;  3B0D C;  4J8V C;  5AVB B;  2Y2K A;  4UUZ B;  3KXB C;  3AFA C;  1F66 B;  5B32 C;  2F8N B;  1TAF B;  1P3F D;  5BO0 B;  1N1J A;  5GT3 D;  3C1C D;  3WAA A;  3UTB D;  3W98 D;  1P3O B;  3AYW A;  3LEL D;  5B2J C;  4YS3 B;  2YFV A;  3R45 B;  5B33 B;  3AYW C;  3WA9 C;  5B31 B;  1B6W A;  5DNN C;  1P3B B;  3AZL C;  4H9N A;  4WU8 D;  5B0Z B;  4G91 B;  3UT9 D;  2BYM A;  2FFF B;  1KX4 B;  5C3I B;  2ARO A;  3A1I A;  2G5H C;  3W99 C;  3LJA B;  1KX5 B;  3AZE B;  2BYK B;  3C1B A;  3NQU B;  1HQ3 A;  3LZ0 D;  3AN2 B;  4KGC A;  2ZY2 A;  5GT0 B;  4XUJ B;  5AV9 A;  1T3U A;  2HIO A;  4J8W A;  5DNM C;  1M18 B;  5AVB D;  2RIQ A;  3B0C W;  1F66 D;  2PYO D;  2F8N D;  4DQY B;  3X1T A;  3AV1 B;  4LD9 D;  3MGR B;  4KUD A;  3MGP B;  5AV5 B;  3AZM C;  1P3O D;  2FJ7 C;  3KFU G;  4YS3 D;  1R4V A;  2YFV B;  5B33 D;  4G92 C;  5B31 D;  4NFT A;  1P3B D;  1JFI A;  1M19 C;  3REL C;  5B0Z D;  1P3L C;  1KX4 D;  5B24 B;  2XD1 A;  2BG1 A;  1KX3 A;  5G49 A;  4KHA A;  5B0Y D;  5AY8 C;  3X1V A;  3LJA D;  1KX5 D;  3MNN C;  5GSU A;  5B1M C;  1KX3 C;  5B31 G;  5GXQ A;  3X1S C;  3EPL A;  1P3I B;  1AOI A;  3AZN D;  3AN2 D;  1P3G A;  2JCH A;  4XUJ D;  5GT0 D;  1EQZ B;  3WKJ B;  4Z66 A;  3A6N C;  3AL0 C;  3EPK A;  3REJ A;  5AV9 B;  3REH A;  5B2I C;  2Y2I A;  1M18 D;  5F99 B;  2Y2Q A;  5E5A A;  3C1C C;  3UTA C;  4H9R B;  4J8X A;  3AV1 D;  1P3K A;  2NQB B;  3MGR D;  3X1T B;  3W98 C;  3LZ1 A;  5B1L A;  2Y2N A;  3AZK A;  3X1U D;  3MGP D;  5AV5 D;  4Z2M H;  1P3K C;  5CPI A;  4KUD B;  3MGQ B;  3V9R B;  5CPJ A;  4CAY B;  4ZUX A;  3AZG B;  4HGA C;  4WU8 C;  5CPJ C;  2ZY3 A;  3UT9 C;  3W97 B;  3W96 A;  1ULY A;  1P34 B;  4YM6 A;  3B6F A;  5B24 D;  1P3M A;  1ID3 B;  4XZQ A;  3MVD C;  2CWE A;  4X23 A;  1WWS A;  3REK B;  4KHA B;  3X1V B;  5CP6 B;  3LZ0 C;  3AZI B;  5GSU B;  5B40 B;  1U35 A;  1P3I D;  1ZLA A;  3B6G A;  4JJN A;  1AOI B;  2CV5 D;  4NE3 A;  1EQZ D;  1ZLA C;  3WKJ D;  2HUE B;  4J8U B;  3TU4 B;  1A7W A;  5AVB C;  1M1A A;  3KWQ A;  4AWL C;  5AV9 D;  1S32 A;  2PYO C;  4Z66 B;  4H9P B;  5F99 D;  1BH8 A;  5AV8 B;  3WTP A;  3REJ B;  3REH B;  3AZF A;  4LD9 C;  3KWQ C;  5E5A B;  2NQB D;  2NZD A;  3REI A;  3WTP C;  3X1T D;  5JRG B;  3KXB A;  3AFA A;  5B32 A;  3LZ1 B;  5B1L B;  4KUD D;  2UWX A;  3MGQ D;  4UPK A;  3REI C;  1B67 A;  1P3P D;  4NE6 A;  5B31 C;  1P3A D;  3MGS B;  3AZG D;  2RVQ D;  4DRA A;  4WU9 B;  5B2J A;  4ZUX B;  5B0Z C;  4R8P B;  3W97 D;  5CPK B;  1KX4 C;  1P34 D;  3B0C T;  3WA9 A;  1ID3 D;  3B6F B;  5DNN A;  3AZL A;  5B0Y C;  1HTA A;  5JA4 B;  4QLC D;  4XZQ B;  3O62 B;  3REK D;  3EPH A;  3EPJ A;  3AZN C;  3AN2 C;  3X1V D;  5CP6 D;  3AZI D;  5GSU D;  5B40 D;  2Y2J A;  4ZBJ B;  1AOI D;  1U35 B;  4XUJ C;  3B6G B;  3AV2 C;  3W99 A;  5AVC C;  2W8S A;  3AZJ A;  4J8U D;  3TU4 D;  1M1A B;  5AV8 D;  3AZH B;  3AZJ C;  1BH8 B;  3MGR C;  3AZF B;  5E5A D;  5JRG D;  3X1U C;  5DNM A;  5AV5 C;  5BS7 C;  4J8V B;  5AV6 D;  2NZD B;  3FDD A;  3KXB B;  1TZY A;  3VH5 W;  3MGS D;  3AZM A;  2FJ7 A;  1TZY C;  4WU9 D;  4ZUX D;  4R8P D;  1N1J B;  5B2J B;  5CPK D;  5B24 C;  3WAA B;  3NQJ A;  3AYW B;  1WWI A;  3REL A;  1M19 A;  3O62 D;  3AZL B;  2F8N G;  1P3L A;  3KUY C;  2IO5 B;  4H9N B;  2CV5 C;  1EQZ C;  4WNN A;  5AY8 A;  3WKJ C;  2BYM B;  3MNN A;  5B1M A;  3X1S A;  5F99 C;  2ARO B;  3H0M C;  1M1A D;  4Z5T A;  4DRB A;  3AZH D;  2NQB C;  3AZE D;  3AZF D;  5BNX A;  3A6N A;  4Z5T C;  5B2I A;  3C1B B;  2NZD D;  4J8V D;  1HQ3 B;  3KSY A;  2JSS A;  5DNM B;  4KGC B;  5GT3 A;  3C1C A;  2LY8 A;  3UTA A;  1P3P C;  1P3A C;  2G5I C;  3UTB A;  4WV4 B;  2HIO B;  4J8W B;  1P3F C;  2RVQ C;  3W98 A;  3H0R C;  5GT3 C;  4WJ3 C;  5CHL B;  3AZM B;  3UTB C;  3IP4 C;  3LEL C;  3WAA D;  2F2A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...